Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15

Overview
NamePre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
Smed IDSMED30032886
Length (bp)2448
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 (SMED30032886) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 (SMED30032886) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 (SMED30032886) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 (SMED30032886) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032886

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032886SMESG000009126.1 SmedASXL_016782SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032886SMESG000009126.1 SmedASXL_016782SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032886SMESG000009126.1 Contig48284newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032886SMESG000009126.1 Contig48284uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Match: DHX15 (DEAH-box helicase 15 [Source:HGNC Symbol;Acc:HGNC:2738])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 440/676 (65.09%), Postives = 541/676 (80.03%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR L+RI
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRI 783          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 339/652 (51.99%), Postives = 461/652 (70.71%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  +S  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S   ++     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  546 NKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1185          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 339/652 (51.99%), Postives = 461/652 (70.71%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  +S  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S   ++     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  546 NKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1185          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 321/614 (52.28%), Postives = 434/614 (70.68%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPD 1937
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  +S  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S   ++     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+
Sbjct:  546 NKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 1147          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 312/663 (47.06%), Postives = 454/663 (68.48%), Query Frame = 3
Query:  117 SQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSV-PPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIART 2099
            +Q+   I   R  LPV+ ++EE +  ++++Q++++ GETGSGKTTQIPQ+  E    N      + CTQPRRVAAMSVA RVA E+ V+LG EVGY IRFED TS  T+L+Y+TDGMLLRE +S+P L +Y V+++DEAHERTL TDIL GL+K++   R +LK++V SAT+D  +F  +F +AP+ +IPGR FPV+IF+T  P  DY++A V  +  IH  +  GDIL+FLTGQEEI+ AC  ++     LG ++ ++  +P+Y++LP ++Q RIF+  PP       +RK+VVATNIAETS+TI+G+ +V+DPGF K+K +NPRT +ESLTVT  S+ASA QRAGRAGR   GKCFRLY+  +Y +EL E T PEI R++L NV+L LK LG+ D++ FDF+DPP  + ++ A + LY LGA++  G LT  GR MAE P+DP LSK ++AS  ++CS+++L + +MLSV    F RP +    AD A++      GDHL LLNVY ++  +  S++WC  NF+ +RS++ A +VR QL  +L++    ++   +   +Y  ++K++ AG+F  +A   + G Y TVK  Q   +HP+++L  ++P W++Y+E V+TT  F+R V EI  SWL+  AP YY   +  D  AK++ ++I +T
Sbjct:  386 AQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKG--MKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPG------ARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERV---EVGLSSCQGDYIRVRKAITAGYFYHTARLTRSG-YRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKT 1036          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 419/681 (61.53%), Postives = 532/681 (78.12%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEF-----KCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIART 2099
            ++  IN  NN+P+S +Y+ I +KR +LPVW+YKE+FM++L +NQ I LVGETGSGKTTQIPQW VE++            + V CTQPRRVAAMSVA RVA+E+DV LG+EVGY IRFED  S  T+LKY TDGMLLREAM+ P L  Y+V++LDEAHERTL TDILMGL+KEI  NR+D+K+++MSATLDA KFQ YF + PL+ +PGRTFPVEIFFT    +DY++AA+  +  IH +E+ EGDILLFLTGQEEI+EAC+RI+ EI  LG   G +SCIPLYS+LPP  QQRIFE APPN  +G ISRK V++TNIAETS+TIDGV FVIDPGF+K+KV+NPR RVESL V  +S+ASA QRAGRAGRT PGKCFRLY+E +Y +E+ + TYPEILRSNL +V+L LKKLG  D+V FDF+DPP P+ +MRA +LL YL AI+ DG LT+LG +MAEFPLDPQL+K LI S + NCS+++L+I +MLSVP C+VRP E +  AD AK R +  +GDHLTLLNVY+ F  N++  +WC +NFINYR++KTA+ VR QLSR++DK+ L+++S D  S +Y  NI+K+LVAGFFMQ AH ++ G Y+TVKD Q+  LHPST L  KP+W +YNEFV+TT NF+R VT++ P WL+  AP+YY+  +FPDG  KR L  + +T
Sbjct:   50 MKIQINPYNNQPFSNRYWAIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDHKPEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDLDNFPDGDTKRKLTTVMQT 730          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 405/650 (62.31%), Postives = 512/650 (78.77%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEF-----KCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINP 2006
            ++  IN  NN+P+S +Y+ I +KR +LPVW+YKE+FM++L +NQ I LVGETGSGKTTQIPQW VE++            + V CTQPRRVAAMSVA RVA+E+DV LG+EVGY IRFED  S  T+LKY TDGMLLREAM+ P L  Y+V++LDEAHERTL TDILMGL+KEI  NR+D+K+++MSATLDA KFQ YF + PL+ +PGRTFPVEIFFT    +DY++AA+  +  IH +E+ EGDILLFLTGQEEI+EAC+RI+ EI  LG   G +SCIPLYS+LPP  QQRIFE APPN  +G ISRK V++TNIAETS+TIDGV FVIDPGF+K+KV+NPR RVESL V  +S+ASA QRAGRAGRT PGKCFRLY+E +Y +E+ + TYPEILRSNL +V+L LKKLG  D+V FDF+DPP P+ +MRA +LL YL AI+ DG LT+LG +MAEFPLDPQL+K LI S + NCS+++L+I +MLSVP C+VRP E +  AD AK R +  +GDHLTLLNVY+ F  N++  +WC +NFINYR++KTA+ VR QLSR++DK+ L+++S D  S +Y  NI+K+LVAGFFMQ AH ++ G Y+TVKD Q+  LHPST L  KP+W +YNEFV+TT NF+R VT++ P
Sbjct:   50 MKIQINPYNNQPFSNRYWAIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDHKPEWALYNEFVLTTKNFIRTVTDVRP 699          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 323/640 (50.47%), Postives = 448/640 (70.00%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            ++++R  LP++  K+  M+ + DNQI+V+VGETGSGKTTQ+ Q+ +E       +   +GCTQPRRVAAMSVAKRVA+E   +LG +VGY IRFED TS +TI+KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK     R +LKLI+ SATLD+ KF  YF  AP+  IPGRTFPVEI +T EP  DY++AA   +  IH  E  GD+L+FLTGQEEID +C  +   + ++G  V ++  +P+Y +LP  +Q RIF+ AP     GK  RK+V+ATNIAETS+TIDG+ +V+DPGF K+K++NP++ ++SL VT +S+A+AKQR+GRAGRTGPGKC+RLY+E ++ +E++    PEI R+NL++ +L LK +G+ +++ FDF+D P  D+M+ A + L+ L A+D DG+LT LGR MAEFPL+P LSK LI S D  CS++VL IV+ML+V   F RP E Q  AD  K +  + EGDHLTLL VYN + N+  S  WC  NFI  RS+K A ++R QL  I+D+ KL  +S      +   ++K++ +GFF  +A  D +  Y T+ D Q   +HPS+A   ++P+WV+Y+E VMTT  ++R VT I+P WLV  AP ++   D
Sbjct:  533 MVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK---IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPA----GK--RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 1160          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 321/662 (48.49%), Postives = 450/662 (67.98%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFG-NAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLR---KPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGT 2108
            I ++R  LPV+  +++ M ++ +N ++++VGETGSGKTTQ+ Q+ +E   D   +   +GCTQPRRVAAMSVA+RVADE+ V+LG++VGY IRFED TS  TI+KY+TDG+LLRE + D +L  Y  I++DEAHER+L TD+L GLL+E+   R+DLKLIV SAT+DA+KF ++FG N P   IPGRTFPVE+F    PVEDYVDAAV     IH    +GDIL+F+ GQE+I+  C  I+ ++  L D+   ++ +P+YS LP ++Q +IF+ AP         RK +VATNIAETS+T+DG+ FVIDPGF K KV+NPR  +++L++  VS+ASA QR GRAGRTGPG+C+RLY+E  + +EL+++T PEI R+NL+NV+L LK LGV D++ F F+D P  DNM+ +   L+ LGA+D  G LT +GR M EFPLDP LSK LI S +  CSD+VL IVSMLSVP  F RP   +  ADA K +    E DHLT LNVY ++  +K SAKWC++N+++ ++LK   EVR QL  I+   KL  ISN    S ++ ++K + + +F  +A     G Y+ V+      LHP++AL      PD+V+Y+E +MT   +++ VT ++  WL    P +Y+  +    R +  +E + RT  T
Sbjct:  434 IKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLE---DGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGM------RKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISN---GSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKESKQSRKELKMESV-RTVET 1081          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 321/662 (48.49%), Postives = 450/662 (67.98%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFG-NAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLR---KPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGT 2108
            I ++R  LPV+  +++ M ++ +N ++++VGETGSGKTTQ+ Q+ +E   D   +   +GCTQPRRVAAMSVA+RVADE+ V+LG++VGY IRFED TS  TI+KY+TDG+LLRE + D +L  Y  I++DEAHER+L TD+L GLL+E+   R+DLKLIV SAT+DA+KF ++FG N P   IPGRTFPVE+F    PVEDYVDAAV     IH    +GDIL+F+ GQE+I+  C  I+ ++  L D+   ++ +P+YS LP ++Q +IF+ AP         RK +VATNIAETS+T+DG+ FVIDPGF K KV+NPR  +++L++  VS+ASA QR GRAGRTGPG+C+RLY+E  + +EL+++T PEI R+NL+NV+L LK LGV D++ F F+D P  DNM+ +   L+ LGA+D  G LT +GR M EFPLDP LSK LI S +  CSD+VL IVSMLSVP  F RP   +  ADA K +    E DHLT LNVY ++  +K SAKWC++N+++ ++LK   EVR QL  I+   KL  ISN    S ++ ++K + + +F  +A     G Y+ V+      LHP++AL      PD+V+Y+E +MT   +++ VT ++  WL    P +Y+  +    R +  +E + RT  T
Sbjct:  434 IKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLE---DGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGM------RKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISN---GSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKESKQSRKELKMESV-RTVET 1081          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 436/678 (64.31%), Postives = 547/678 (80.68%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            ++N L N PYSQ+Y ++ KKR+ LPV++Y+ +FM++LS +Q IVLVGETGSGKTTQIPQWCV++    S   K V CTQPRRVAAMSVA+RV++E+DV+LGEEVGY IRFED ++  T+LKY+TDGMLLREAMSDP L  YQVILLDEAHERTL TDILMG+LKE+   RSDLKL+VMSATLDA KFQ YF NAPLMK+PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDIL+FLTGQEEI+EAC+RI+ EI NLG ++G++ CIPLYS+LPPN+QQRIFE APP  A+G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL V+ +S+ASA+QR+GRAGRT PGKCFRLY+E ++ NE+ +NTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG +M+EFPLDPQL+K LIASC  NCS+++L+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  + +   WC  NFIN+RSLK+A+ VR QL+RI+D+F L++ S + TS +Y  NI+K+LV GFFMQ AH ++ G YLT+KD Q  +LHPST L  KPDWVIYNEFV+TT N++R VT++ P WL   AP+YY+  +FP   AKR LE + +   T++
Sbjct:   49 TMNPLTNTPYSQRYQNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAV--SKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLNNFPQCEAKRQLELLQQRLETKQ 724          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 436/678 (64.31%), Postives = 547/678 (80.68%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            ++N L N PYSQ+Y ++ KKR+ LPV++Y+ +FM++LS +Q IVLVGETGSGKTTQIPQWCV++    S   K V CTQPRRVAAMSVA+RV++E+DV+LGEEVGY IRFED ++  T+LKY+TDGMLLREAMSDP L  YQVILLDEAHERTL TDILMG+LKE+   RSDLKL+VMSATLDA KFQ YF NAPLMK+PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDIL+FLTGQEEI+EAC+RI+ EI NLG ++G++ CIPLYS+LPPN+QQRIFE APP  A+G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL V+ +S+ASA+QR+GRAGRT PGKCFRLY+E ++ NE+ +NTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG +M+EFPLDPQL+K LIASC  NCS+++L+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  + +   WC  NFIN+RSLK+A+ VR QL+RI+D+F L++ S + TS +Y  NI+K+LV GFFMQ AH ++ G YLT+KD Q  +LHPST L  KPDWVIYNEFV+TT N++R VT++ P WL   AP+YY+  +FP   AKR LE + +   T++
Sbjct:   49 TMNPLTNTPYSQRYQNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAV--SKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLNNFPQCEAKRQLELLQQRLETKQ 724          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Match: pea (gene:FBgn0086895 transcript:FBtr0087518)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 332/640 (51.88%), Postives = 453/640 (70.78%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            ++++R  LP++  +++ ++ ++DNQI++++GETGSGKTTQI Q+  E      +    +GCTQPRRVAAMSVAKRVA+E    LG+EVGY IRFED TSP TI+KY+TDGMLLRE + +  LK+Y VI+LDEAHERT+ TD+L GLLK   + R +LKLIV SATLDA KF  YF  AP+  IPGRTFPVE+ +T EP  DY+DA++  +  IH  E  GDILLFLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ AP        SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++SL VT +S+A+AKQRAGRAGRTGPGK +RLY+E +Y +E++    PEI R+NL+  +L LK +G+ D++ FDF+D P  ++++ A + L+ L A+D +G+LT LGR MAEFPL+P LSK LI S    CSD++L IVSMLSV   F RP + Q  AD  K + ++ EGDHLTLL VYN + NNK S  WC  NF+  R+LK + +VR QL  I+D+ KL  +S      N   I+K++ +GFF  +A  D +  Y T+ D+Q+  +HPS+AL  R+P+WVIY+E V TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  579 LVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGEC---GFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAG------SRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVS---AGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSD 1206          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Match: l(2)37Cb (gene:FBgn0086444 transcript:FBtr0081163)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 312/646 (48.30%), Postives = 439/646 (67.96%), Query Frame = 3
Query:  147 RVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSV-PPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRK-PDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRI 2078
            R  LPV+ +KE+ +  + ++Q++++ GETGSGKTTQ+PQ+ VE  +  + + K +GCTQPRRVAAMSVA RVA+E+ V+LG EVGY IRFED TS  TILKY+TDG L RE +S+P L +Y V+++DEAHERTL TDIL GL+K+I   R +LKL++ SATLDAEKF  +F +AP+ +IPGR +PV+IF+T  P  DY+DA    +  IH  +  GDIL+FLTGQ+EI+     +   +  LG ++ ++  IP+Y++LP ++Q +IFE  PPN      +RK+++ATNIAETS+TID + +VIDPGFAK+  FN RT +ESL V  +S+ASA QRAGRAGRT PGKCFRLY+  +Y +EL +NT PEI R NL N +L LK LG+ D++ FDF+DPP  + ++ A + LY LGA++  G LT LGR MAEFP+DP + K L+AS  + CS++++ I +MLSV    F RP +    AD A+   +   GDHL+LL VYN++     S +WC  NFI YRS+K A +VR QL  ++ + ++  +S    +    N++K+  AG+F   A   K G Y T+K  Q   +HP+++L  + P WV+Y+E V T+  ++R V EI   WL+  AP YY   +  D   K++
Sbjct:  249 RRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVE--AGFTKDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIETCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPN------ARKVILATNIAETSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSCLPETV---NVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELPRWVLYHELVFTSKEYMRQVIEIESKWLLEVAPHYYKAKELEDSTNKKM 883          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Match: l(1)G0007 (gene:FBgn0026713 transcript:FBtr0073900)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 298/650 (45.85%), Postives = 436/650 (67.08%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL---RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKR 2075
            I ++R  LPV+  ++E + ++ +N +I++VGETGSGKTTQ+ Q+  E   D  S+   +GCTQPRRVAAMSVAKRV+DE+D +LGE+VGY IRFED TS  T++KY+TDG+LLRE++ DP L +Y  I++DEAHER+L TD+L GLL+EI   R DLKLIV SAT+D+ KF  +FGN P   IPGRTFPV++ F+    EDYV++AV     +H   +EGD+L+F+ GQE+I+  C  +E  ++ + D    +S +P+YS LP ++Q +IF+     ++DG   RK VVATNIAETS+T+DG+ +VID G+ K KV+NPR  +++L +  +S+A+A QR+GRAGRTGPG+ +RLY++  Y +EL+  T PEI R+NL+N +L LK LGV D++ F F+DPP  DN++ +   L+ LGA+D  G LT LGR MAEFPLDP   + LI +C   CS +VL IVSMLSVP  F RP   +  AD  + +  + E DHLT LNVY ++  N  S+ WC+ +FI+ ++++   EVR QL  I+ +  L  IS      +++ ++K + + +F Q+A     G Y+ ++      LHP++AL      PD+V+Y+E +MT   +++  T ++  WL    P +++  +   GR+ R
Sbjct:  527 ISEQRRFLPVFASRQELLNVIRENSVIIIVGETGSGKTTQLTQYLHE---DGYSKRGMIGCTQPRRVAAMSVAKRVSDEMDTQLGEDVGYAIRFEDCTSERTVIKYMTDGILLRESLRDPELDSYSAIIMDEAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFGNVPTFTIPGRTFPVDVMFSKNTCEDYVESAVKQALQVHLTPNEGDMLIFMPGQEDIEVTCEVLEERLAEI-DNAPALSILPIYSQLPSDLQAKIFQ----KSSDG--LRKCVVATNIAETSLTVDGIIYVIDSGYCKLKVYNPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYKDELLALTVPEIQRTNLANTVLLLKSLGVVDLLQFHFMDPPPQDNILNSLYQLWILGALDHTGALTTLGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVPSIFYRPKGREDEADGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQQNLSVIS---CGIDWDIVRKCICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTPDYVVYHELIMTAKEYMQCATAVDGYWLAELGPMFFSVKE--SGRSGR 1161          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Match: dhx15 (DEAH (Asp-Glu-Ala-His) box helicase 15 [Source:ZFIN;Acc:ZDB-GENE-030131-650])

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 440/678 (64.90%), Postives = 538/678 (79.35%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE-DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
             IN   N P++ +YY+ILKKR++LPVW+YKE F  IL+ +Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E DEGD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCDFNCS++VL+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S + TS +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY  ++FP   AKR LERI     T++
Sbjct:   88 QINPFTNLPHTPRYYEILKKRLQLPVWEYKERFNDILNRHQSFVLVGETGSGKTTQIPQWCVDMVRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEDEGDVLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDFNCSNEVLSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYEMSNFPQCEAKRQLERIVAKLQTKE 765          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 335/652 (51.38%), Postives = 457/652 (70.09%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R+D+KLIV SATLDA KF  YF  AP+  IPGRT+PVE+ +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  536 NKASYGKKTQLSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1175          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 335/652 (51.38%), Postives = 457/652 (70.09%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R+D+KLIV SATLDA KF  YF  AP+  IPGRT+PVE+ +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  483 NKASYGKKTQLSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1122          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 335/680 (49.26%), Postives = 457/680 (67.21%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED----------------------------EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R+D+KLIV SATLDA KF  YF  AP+  IPGRT+PVE+ +T EP  DY+DA++  +  IH  E                              GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  536 NKASYGKKTQLSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGKLSNTILQNKIIKFEKQFQLIKIINCAGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1203          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 319/646 (49.38%), Postives = 443/646 (68.58%), Query Frame = 3
Query:  147 RVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSV-PPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRI 2078
            R  LP++ Y+E+ +  + D+QI+V+ GETGSGKTTQIPQ+ +E     +     +GCTQPRRVAAMSVA RVA E+ V+LG EVGY IRFED TS  TILKY+TDGMLLRE +++P L +Y VI++DEAHERTL TDIL GL+K+I   R DLK++V SATLD E+F ++F +AP+ +IPGR FPV+I++T  P  DY++A V  +  IH  +  GD+L+FLTGQEEI+  C  ++     LG ++ ++  +P+Y++LP ++Q +IF   PP       +RK+VVATNIAETS+TIDG+ +VIDPGF K+K +N +T +ESL VT  SRASA QRAGRAGR   GKCFRLY+  ++ +E+ E T PEI R+NL NV+L LK LG+ D++ FDF+DPP  + ++ A + LY LGA++  G LT LGR MAE P+DP LSK ++AS  + CS++VL I +MLSV    F RP +    AD A+M      GDHL LLNVY +++ +  S +WC  NFI +RS+K A +VR QL  ++D+ +++  S++  S     I+K++ AG+F  +A    KG Y TVK  Q   +HP+++L   +P W+IY+E V TT  F+R V EI   WL+  AP YY   +  D  +K++
Sbjct:  409 RRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLE--EGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPG------ARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSM---PIRKAVTAGYFYHTARLS-KGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYKNKELEDSSSKKM 1042          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Match: atp2c1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:Xenbase;Acc:XB-GENE-968174])

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 435/678 (64.16%), Postives = 537/678 (79.20%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
             IN   N P++ +YYDILKKR+ LPVW+YKE F +IL  NQ  VLVGETGSGKTTQIPQWCV+++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y V++LDEAHERTL TDILMG+LKE+   R+DLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS+++L+I +MLSVP CF+RP E + AAD AKMR +  +GDHLTLLNVY+ F  N +S++WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  A +YY+ ++FP   AKR LERI     T++
Sbjct:   80 GINPFTNLPHTPRYYDILKKRLLLPVWEYKERFTEILMKNQSFVLVGETGSGKTTQIPQWCVDYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVVILDEAHERTLATDILMGVLKEVVRQRNDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPKKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITAMLSVPQCFIRPTEVKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESSQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAAQYYDMSNFPQCEAKRQLERIVAKLQTKE 757          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Match: atp2c1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:Xenbase;Acc:XB-GENE-968174])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 424/677 (62.63%), Postives = 523/677 (77.25%), Query Frame = 3
Query:   90 INYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            IN   N P++ +YYDILKKR+ LPVW+YKE F +IL  NQ  VLVGETGSGKTTQIPQWCV+++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y V++LDEAHERTL TDILMG+LKE+   R+DLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP         K  ++TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS+++L+I +MLSVP CF+RP E + AAD AKMR +  +GDHLTLLNVY+ F  N +S++WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P              +FP   AKR LERI     T++
Sbjct:   82 INPFTNLPHTPRYYDILKKRLLLPVWEYKERFTEILMKNQSFVLVGETGSGKTTQIPQWCVDYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVVILDEAHERTLATDILMGVLKEVVRQRNDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPP---------KKPISTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITAMLSVPQCFIRPTEVKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESSQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPE------------CNFPQCEAKRQLERIVAKLQTKE 737          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Match: atp2c1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:Xenbase;Acc:XB-GENE-968174])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 395/625 (63.20%), Postives = 493/625 (78.88%), Query Frame = 3
Query:  255 IPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSV-PPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNK--KSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            IPQWCV+++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y V++LDEAHERTL TDILMG+LKE+   R+DLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS+++L+I +MLS    CF+RP E + AAD AKMR +  +GDHLTLLNVY+ F  ++  +S++WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  A +YY+ ++FP   AKR LERI     T++
Sbjct:   74 IPQWCVDYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVVILDEAHERTLATDILMGVLKEVVRQRNDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPKKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITAMLSGNSRCFIRPTEVKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSEYHESSQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAAQYYDMSNFPQCEAKRQLERIVAKLQTKE 698          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 336/652 (51.53%), Postives = 457/652 (70.09%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    I+++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:   22 NKASYGKKTQMSIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 661          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 336/652 (51.53%), Postives = 457/652 (70.09%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    I+++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  539 NKASYGKKTQMSIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1178          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 440/676 (65.09%), Postives = 541/676 (80.03%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR L+RI
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRI 783          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 393/593 (66.27%), Postives = 479/593 (80.78%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQ 1841
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQ 700          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 339/652 (51.99%), Postives = 461/652 (70.71%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  +S  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S   ++     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  517 NKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1156          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 339/652 (51.99%), Postives = 461/652 (70.71%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  +S  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  +TEGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S   ++     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  570 NKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1209          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 331/489 (67.69%), Postives = 400/489 (81.80%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSV 1532
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSV
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSV 596          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Match: sp|O43143|DHX15_HUMAN (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 440/676 (65.09%), Postives = 541/676 (80.03%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR L+RI
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRI 783          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Match: sp|Q5RAZ4|DHX15_PONAB (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii OX=9601 GN=DHX15 PE=2 SV=2)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 440/676 (65.09%), Postives = 541/676 (80.03%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR L+RI
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRI 783          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Match: sp|O35286|DHX15_MOUSE (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus OX=10090 GN=Dhx15 PE=1 SV=2)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 440/676 (65.09%), Postives = 541/676 (80.03%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            TS  +C IN   N P++ +YYDILKKR++LPVW+YK+ F  IL  +Q  VLVGETGSGKTTQIPQWCVE++       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASCD+NCS++VL+I +MLSVP CFVRP E++ AAD AKMR +  +GDHLTLLNVY+ F  N +S +WC +NFINYRSL +A+ VR QLSRI+D+F L + S D TS +Y  NI+K+LV G+FMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR L+RI
Sbjct:  109 TSLPQC-INPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRI 783          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Match: sp|Q20875|DHX15_CAEEL (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans OX=6239 GN=ddx-15 PE=3 SV=1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 419/681 (61.53%), Postives = 532/681 (78.12%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEF-----KCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIART 2099
            ++  IN  NN+P+S +Y+ I +KR +LPVW+YKE+FM++L +NQ I LVGETGSGKTTQIPQW VE++            + V CTQPRRVAAMSVA RVA+E+DV LG+EVGY IRFED  S  T+LKY TDGMLLREAM+ P L  Y+V++LDEAHERTL TDILMGL+KEI  NR+D+K+++MSATLDA KFQ YF + PL+ +PGRTFPVEIFFT    +DY++AA+  +  IH +E+ EGDILLFLTGQEEI+EAC+RI+ EI  LG   G +SCIPLYS+LPP  QQRIFE APPN  +G ISRK V++TNIAETS+TIDGV FVIDPGF+K+KV+NPR RVESL V  +S+ASA QRAGRAGRT PGKCFRLY+E +Y +E+ + TYPEILRSNL +V+L LKKLG  D+V FDF+DPP P+ +MRA +LL YL AI+ DG LT+LG +MAEFPLDPQL+K LI S + NCS+++L+I +MLSVP C+VRP E +  AD AK R +  +GDHLTLLNVY+ F  N++  +WC +NFINYR++KTA+ VR QLSR++DK+ L+++S D  S +Y  NI+K+LVAGFFMQ AH ++ G Y+TVKD Q+  LHPST L  KP+W +YNEFV+TT NF+R VT++ P WL+  AP+YY+  +FPDG  KR L  + +T
Sbjct:   50 MKIQINPYNNQPFSNRYWAIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDHKPEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDLDNFPDGDTKRKLTTVMQT 730          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Match: sp|Q9LZQ9|DEAH2_ARATH (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana OX=3702 GN=At3g62310 PE=2 SV=1)

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 417/684 (60.96%), Postives = 537/684 (78.51%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFK---CVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAP-PNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            I   IN  N KPYSQ+YYDIL+KR  LPVW  KEEF++ L++NQ ++LVGETGSGKTTQIPQ+ ++ V   +S+ +    VGCTQPRRVAAMSV++RVA+E+DV +GEEVGY IRFED +SP T+LKYLTDGMLLREAM+DP L+ Y+VI+LDEAHERTL TD+L GLLKE+ +NR DLKL+VMSATL+AEKFQ+YF  APLMK+PGR  PVEIF+T EP  DY++AA+  +  IH  E  GDIL+FLTG+EEI++ACR+I  E+ NLGDQVG +  +PLYS+LPP +QQ+IF+ AP P T  G   RKIVV+TNIAETS+TIDG+ +VIDPGFAK+KV+NPR RVESL V+ +S+ASA QR+GRAGRT PGKCFRLY+E S++N+L   TYPEILRSNL+N +L+LKKLG+ D+V FDF+DPP P+ +MRA ++L YLGA+D DG LT  G +M+EFPLDPQ++K LI S +FNCS+++L++ +MLSVP CF+RP E+Q AAD AK R    EGDHLTLLNVY+ F  N +   WC  NFIN R++K+A+ VR QL RI+ +F LK  S D  S +Y  NI+K+++AG+FMQ AH ++ G YLTVKD Q+  LHPS  L  KP+WVIYNE+V+T+ NF+R VT+I   WLV+ A  YY+ ++FP+  AKR++E++ +    EK
Sbjct:   35 INSLINKWNGKPYSQRYYDILEKRRTLPVWLQKEEFLKTLNNNQTLILVGETGSGKTTQIPQFVIDAVDAETSDKRRKWLVGCTQPRRVAAMSVSRRVAEEMDVTIGEEVGYSIRFEDCSSPRTVLKYLTDGMLLREAMADPLLERYKVIILDEAHERTLATDVLFGLLKEVLKNRPDLKLVVMSATLEAEKFQDYFSGAPLMKVPGRLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPPGDILVFLTGEEEIEDACRKINKEVGNLGDQVGPIKVVPLYSTLPPAMQQKIFDPAPEPVTEGGPPGRKIVVSTNIAETSLTIDGIVYVIDPGFAKQKVYNPRIRVESLLVSPISKASAHQRSGRAGRTRPGKCFRLYTEKSFNNDLQPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPETLMRALEVLNYLGALDDDGNLTKTGEIMSEFPLDPQMAKMLIVSPEFNCSNEILSVSAMLSVPNCFIRPREAQKAADEAKARFGHIEGDHLTLLNVYHAFKQNNEDPNWCYENFINNRAMKSADNVRQQLVRIMSRFNLKMCSTDFNSRDYYINIRKAMLAGYFMQVAHLERTGHYLTVKDNQVVHLHPSNCLDHKPEWVIYNEYVLTSRNFIRTVTDIRGEWLVDVASHYYDLSNFPNCEAKRVIEKLYKKREREK 718          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Match: C1LEB1 (Putative pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 447/683 (65.45%), Postives = 553/683 (80.97%), Query Frame = 3
Query:   72 SPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            SP     N  N K +S KY+++L+KRV+LPVW+YKE F Q LS+NQ+ VLVGETGSGKTTQIPQWC+EWV+      K V CTQPRRVAAMSVA+RV++E+DVELG+EVGY IRFED TS  T++KY+TDGMLLRE MSDP L+ Y VILLDEAHERTL TDILMGLLKEIT+ R DLK++VMSATLDA KFQ+YF  APLM +PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDILLFLTGQEEI+EAC+RI+ E+  LG  VG++ CIPLYS+LPPN+QQRIFE  PP  ++G + RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCD+NCS+++L+I SMLSVP CFVRP +S+  AD AKMR +  +GDHLT+LNVY+ F  N +  +WC +NFIN+RSLK+A+ VR+QLSRI+D+F L+++S D TS +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD Q+ +LHPST +  KP+WV+YNEFV+TT N++R VTE+ P WLV  AP+YY+ ++FPD  A+RILERI       K
Sbjct:   48 SPFAAKTNPYNGKSFSTKYFELLRKRVKLPVWEYKENFFQTLSENQVTVLVGETGSGKTTQIPQWCLEWVTGRYPTKKAVACTQPRRVAAMSVAQRVSEEMDVELGQEVGYSIRFEDCTSSRTVMKYMTDGMLLREGMSDPLLETYGVILLDEAHERTLATDILMGLLKEITKQRLDLKIVVMSATLDAGKFQDYFHKAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILLFLTGQEEIEEACKRIQREVDGLGPDVGELRCIPLYSTLPPNLQQRIFEPPPPKRSNGAVGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYTNEMQENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITSMLSVPQCFVRPADSKKTADEAKMRFAHIDGDHLTMLNVYHAFKQNHEDPQWCYDNFINFRSLKSADNVRVQLSRIMDRFSLRRLSTDFTSRDYYINIRKALVSGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVMDHKPEWVLYNEFVLTTKNYIRTVTEVKPDWLVRIAPQYYDMSNFPDCDARRILERIVHRIQNRK 730          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Match: G4VJG1 (Putative atp-dependent RNA helicase OS=Schistosoma mansoni OX=6183 GN=Smp_087270 PE=4 SV=1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 447/683 (65.45%), Postives = 552/683 (80.82%), Query Frame = 3
Query:   72 SPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            SP     N  N K +S KY+++L+KR++LPVW+YKE F Q LS+NQ+ VLVGETGSGKTTQIPQWC+EWV+      K V CTQPRRVAAMSVA+RV++E+DVELG+EVGY IRFED TS  T++KY+TDGMLLRE MSDP L+ Y VILLDEAHERTL TDILMGLLKEIT+ R DLK++VMSATLDA KFQ+YF  APLM +PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDILLFLTGQEEI+EAC+RI+ E+  LG  VG++ CIPLYS+LPPN+QQRIFE  PP  A+G + RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCD+NCS+++L+I SMLSVP CFVRP +S+  AD AKMR +  +GDHLT+LNVY+ F  N +  +WC +NFIN+RSLK+A+ VR+QLSRI+D+F L++ S D TS +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD Q+ +LHPST +  KP+WV+YNEFV+TT N++R VTE+ P WLV  AP+YY+ ++FPD  A+RILERI       K
Sbjct:   48 SPFAAQTNPYNGKSFSAKYFELLRKRIKLPVWEYKENFFQTLSENQVTVLVGETGSGKTTQIPQWCLEWVTGRYPTKKAVACTQPRRVAAMSVAQRVSEEMDVELGQEVGYSIRFEDCTSSRTVMKYMTDGMLLREGMSDPLLEAYGVILLDEAHERTLATDILMGLLKEITKQRLDLKIVVMSATLDAGKFQDYFHKAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILLFLTGQEEIEEACKRIQREVDGLGPDVGELRCIPLYSTLPPNLQQRIFESPPPKRANGAVGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYTNEMQENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITSMLSVPQCFVRPADSKKTADEAKMRFAHIDGDHLTMLNVYHAFKQNHEDPQWCYDNFINFRSLKSADNVRVQLSRIMDRFSLRRSSTDFTSRDYYINIRKALVSGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVMDHKPEWVLYNEFVLTTKNYIRTVTEVKPDWLVRIAPQYYDMSNFPDCDARRILERIVHRIQNRK 730          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Match: A0A1S8WT71 (Helicase protein OS=Opisthorchis viverrini OX=6198 GN=X801_06494 PE=4 SV=1)

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 437/671 (65.13%), Postives = 552/671 (82.27%), Query Frame = 3
Query:   90 INYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIAR 2096
            +N  N KP+S +Y+D+ +KR++LPVW+YKE F +++S+NQ+ VLVGETGSGKTTQIPQWC+EW++      K V CTQPRRVAAMSVA+RV++E+DVELG+EVGY IRFED TS  T++KY+TDGMLLRE MSDP L+ Y V+LLDEAHERTL TDILMGLLKEI + R DLK++VMSATLDA KFQ+YF  APLM +PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDILLFLTGQEEI+EAC+RI+ E+  LG  VG++ CIPLYS+LPPN+QQRIF+  PP  A+G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCDFNCS++VL+I +MLSVP CFVRP +++ +AD AKMR +  +GDHLT+LNVY+ F  N +  +WC +NF+N+RSLK+A+ VR+QLSRI+D+F L++ S D +S +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R VTE+ P WLV  AP+YY+ ++FP+  AKR+LERI +
Sbjct:   54 VNPYNGKPFSARYFDLFRKRIQLPVWEYKENFFKVISENQVTVLVGETGSGKTTQIPQWCLEWITGRYPTKKAVACTQPRRVAAMSVAQRVSEEMDVELGQEVGYSIRFEDCTSSRTVMKYMTDGMLLREGMSDPLLEAYGVVLLDEAHERTLATDILMGLLKEIIKQRLDLKIVVMSATLDAGKFQDYFLKAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEVEGDILLFLTGQEEIEEACKRIQREVEGLGPDVGELRCIPLYSTLPPNLQQRIFDPPPPKRANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTKPGKCFRLYTEKAYANEMQENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGSMMAEFPLDPQLAKMVIASCDFNCSNEVLSITAMLSVPQCFVRPADAKKSADEAKMRFAHIDGDHLTMLNVYHAFKQNHEDPQWCYDNFVNFRSLKSADNVRVQLSRIMDRFCLRRSSTDFSSRDYYLNIRKALVSGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTVTEVKPDWLVRIAPQYYDMSNFPECEAKRLLERIVQ 724          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Match: A0A075A8U5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12857 PE=4 SV=1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 437/672 (65.03%), Postives = 552/672 (82.14%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIAR 2096
             +N  N KP+S +Y+D+ +KR++LPVW+YKE F +++S+NQ+ VLVGETGSGKTTQIPQWC+EW++      K V CTQPRRVAAMSVA+RV++E+DVELG+EVGY IRFED TS  T++KY+TDGMLLRE MSDP L+ Y V+LLDEAHERTL TDILMGLLKEI + R DLK++VMSATLDA KFQ+YF  APLM +PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDILLFLTGQEEI+EAC+RI+ E+  LG  VG++ CIPLYS+LPPN+QQRIF+  PP  A+G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCDFNCS++VL+I +MLSVP CFVRP +++ +AD AKMR +  +GDHLT+LNVY+ F  N +  +WC +NF+N+RSLK+A+ VR+QLSRI+D+F L++ S D +S +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R VTE+ P WLV  AP+YY+ ++FP+  AKR+LERI +
Sbjct:   71 QVNPYNGKPFSARYFDLFRKRIQLPVWEYKENFFKVISENQVTVLVGETGSGKTTQIPQWCLEWITGRYPTKKAVACTQPRRVAAMSVAQRVSEEMDVELGQEVGYSIRFEDCTSSRTVMKYMTDGMLLREGMSDPLLEAYGVVLLDEAHERTLATDILMGLLKEIIKQRLDLKIVVMSATLDAGKFQDYFLKAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEVEGDILLFLTGQEEIEEACKRIQREVEGLGPDVGELRCIPLYSTLPPNLQQRIFDPPPPKRANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTKPGKCFRLYTEKAYANEMQENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGSMMAEFPLDPQLAKMVIASCDFNCSNEVLSITAMLSVPQCFVRPADAKKSADEAKMRFAHIDGDHLTMLNVYHAFKQNHEDPQWCYDNFVNFRSLKSADNVRVQLSRIMDRFCLRRSSTDFSSRDYYLNIRKALVSGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTVTEVKPDWLVRIAPQYYDMSNFPECEAKRLLERIVQ 742          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Match: A0A4S2MDB1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000875 PE=4 SV=1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 437/672 (65.03%), Postives = 552/672 (82.14%), Query Frame = 3
Query:   87 SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIAR 2096
             +N  N KP+S +Y+D+ +KR++LPVW+YKE F +++S+NQ+ VLVGETGSGKTTQIPQWC+EW++      K V CTQPRRVAAMSVA+RV++E+DVELG+EVGY IRFED TS  T++KY+TDGMLLRE MSDP L+ Y V+LLDEAHERTL TDILMGLLKEI + R DLK++VMSATLDA KFQ+YF  APLM +PGRT PVEIF+T EP  DY++AA+  +  IH  E+ EGDILLFLTGQEEI+EAC+RI+ E+  LG  VG++ CIPLYS+LPPN+QQRIF+  PP  A+G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCDFNCS++VL+I +MLSVP CFVRP +++ +AD AKMR +  +GDHLT+LNVY+ F  N +  +WC +NF+N+RSLK+A+ VR+QLSRI+D+F L++ S D +S +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R VTE+ P WLV  AP+YY+ ++FP+  AKR+LERI +
Sbjct:   10 QVNPYNGKPFSARYFDLFRKRIQLPVWEYKENFFKVISENQVTVLVGETGSGKTTQIPQWCLEWITGRYPTKKAVACTQPRRVAAMSVAQRVSEEMDVELGQEVGYSIRFEDCTSSRTVMKYMTDGMLLREGMSDPLLEAYGVVLLDEAHERTLATDILMGLLKEIIKQRLDLKIVVMSATLDAGKFQDYFLKAPLMTVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEVEGDILLFLTGQEEIEEACKRIQREVEGLGPDVGELRCIPLYSTLPPNLQQRIFDPPPPKRANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTKPGKCFRLYTEKAYANEMQENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGSMMAEFPLDPQLAKMVIASCDFNCSNEVLSITAMLSVPQCFVRPADAKKSADEAKMRFAHIDGDHLTMLNVYHAFKQNHEDPQWCYDNFVNFRSLKSADNVRVQLSRIMDRFCLRRSSTDFSSRDYYLNIRKALVSGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTVTEVKPDWLVRIAPQYYDMSNFPECEAKRLLERIVQ 681          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Match: dhx15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:103038591])

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 434/673 (64.49%), Postives = 535/673 (79.49%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE-DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            +   +N   N P++ +YY+ILKKR++LPVW+YKE F  IL+ +Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E DEGD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLTLLNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+D+F L + S + TS +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY  ++FP   AKR LERI
Sbjct:   79 VHQQVNPFTNLPHTPRYYEILKKRLQLPVWEYKERFNDILTRHQSFVLVGETGSGKTTQIPQWCVDMVRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEDEGDVLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYEMSNFPQCEAKRQLERI 751          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Match: dhx15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:103038591])

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 419/647 (64.76%), Postives = 517/647 (79.91%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE-DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSW 2012
            +   +N   N P++ +YY+ILKKR++LPVW+YKE F  IL+ +Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E DEGD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLTLLNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+D+F L + S + TS +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P W
Sbjct:   59 VHQQVNPFTNLPHTPRYYEILKKRLQLPVWEYKERFNDILTRHQSFVLVGETGSGKTTQIPQWCVDMVRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEDEGDVLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEW 705          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Match: dhx15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:103038591])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 419/647 (64.76%), Postives = 517/647 (79.91%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE-DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSW 2012
            +   +N   N P++ +YY+ILKKR++LPVW+YKE F  IL+ +Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E DEGD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLTLLNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+D+F L + S + TS +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P W
Sbjct:   79 VHQQVNPFTNLPHTPRYYEILKKRLQLPVWEYKERFNDILTRHQSFVLVGETGSGKTTQIPQWCVDMVRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEDEGDVLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEW 725          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Match: dhx15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:103038591])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 326/485 (67.22%), Postives = 394/485 (81.24%), Query Frame = 3
Query:   78 IECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE-DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLS 1529
            +   +N   N P++ +YY+ILKKR++LPVW+YKE F  IL+ +Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF + PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E DEGD+LLFLTGQEEIDEAC+RI+ EI +LG  VGD+  IPLYS+LPP  QQRIFE  PP    G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLS
Sbjct:   79 VHQQVNPFTNLPHTPRYYEILKKRLQLPVWEYKERFNDILTRHQSFVLVGETGSGKTTQIPQWCVDMVRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDSCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEDEGDVLLFLTGQEEIDEACKRIKREIDDLGPDVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPSGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLS 563          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 334/652 (51.23%), Postives = 456/652 (69.94%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    I+++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E       +   +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L GLLK+  + R+D+KLIV SATLDA KF  YF  AP+  IPGRT+PVE+ +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL   S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  527 NKASYGKKTQLSIIEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGK---IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1166          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 334/652 (51.23%), Postives = 460/652 (70.55%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    I+++R  LP++  KE+ +Q ++DNQI++++GETGSGKTTQI Q+  E  +  ++  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T +KY+TDGMLLRE + D  L  Y V++LDEAHERT+ TD+L GLLK+  + R D+KLIV SATLDA KF  YF  AP+  IPGRT+PVEI +T EP  DY+DA++  +  IH  E  GDILLFLTGQEEID AC  +   + +LG +V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGK +RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K + ++ EGDHLTLL VYN + NNK S  WC  NF+  R+L+ A +VR Q+  I+D+ KL  +S    +     ++K++++GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:   83 NKASYGKKTAMSIIEQRESLPIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAE--AGYTTRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQARTLRRAQDVRKQMLGIMDRHKLDVVSCAKATV---RVQKAVLSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPAFFKVSD 722          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 385.956 bits (990), Expect = 1.689e-123
Identity = 244/670 (36.42%), Postives = 366/670 (54.63%), Query Frame = 3
Query:  132 DILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPN-TILKYLTDGMLLREAMSDPALKNYQVILL---DEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEIS-----NLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTD-LGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTAL------------LRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKR 2075
             I ++R  LP++ ++   + ++   + +V+VGETG GK+TQIPQ+  E  +  ++E   V  TQPRRVAA +VA RVA+E    LG EVGYCIRF+D + P  T +K+LTDGML+RE M+DP LK Y  +LL   D               L E+T +       + S+   A + Q    +  L ++ G+      +    PV DYV   V  I  IH    +GDIL FLTGQEE++     +  E+      + G     V  +P+Y+ LP   Q ++FE        G+  RK+VVATN+AETS+T+ G+AFV+D GF K + ++PR  V++L VT  SRASA+QRAGRAGR+ PGKC+RLY E+ +  +L E T PE+ RS+++ VIL LK LG+ +++ F F+ PP  ++M++A +LLY LG    D   +  LG  MAEFP+ P  +K L+ S  F CS +++ I +M+ +   F+ P   +  A   + + +  EGDH+T+LNV+  F+ + KS+ WC  +F+NY+ L  A  ++ QL ++L +F +      + SSN  + K  L+    + SA     G+    K       HP   L            L+K   +I+     TT +         P+WL   AP ++  +  P GR  R
Sbjct:   44 SIQQQRQRLPIFMHRNHVLYLVEKYRTVVIVGETGCGKSTQIPQYLAE--AGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDDCSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLLRFGDTTAPYPTACSSFNRSLVEVTSS------TIPSSFSRAFECQCCLADYILWRV-GQCTNARSYILMYPVPDYVKTTVETIMKIHNDAADGDILAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPYVDQMKVFERV------GRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEF-AKLPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSSSPLGVRMAEFPMGPMYAKMLLESGTFGCSKEIITIAAMMQIQNVFLSPPNQKIKAARQQRKFAVEEGDHMTMLNVFEAFVKHNKSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRFHI-----PSNSSNGTDPKLPLLTWCILTSAKATGFGT--ATKSNTANPPHPLCTLPALIGTYQQHLNLQKIFSIIHQRICETTRS---ATIYSGPAWLTELAPHFFQQSTHPSGRDHR 687          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 373.629 bits (958), Expect = 7.393e-121
Identity = 197/488 (40.37%), Postives = 296/488 (60.66%), Query Frame = 3
Query:   93 NYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVE--DYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGP-GKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPP-CF 1544
            N  +  P+S +YY +LK R  LPVW  +E F + ++   +I++ GE G GK+TQIPQWC E+      E   V C QP  +AA S+A RVADE+D+ +G EVGY + FED  + +TIL++ TD MLLRE  SDP L  Y  I+LDE  ER+L TD+LMGLL+++   R  L++++++    AE    Y+G+ P  ++ G+    ++ +T    E  D V AAV ++  IH     GD+L+FL   ++   A  +   E   L   +G++  +PL    P              TA G+  R++V+++ IAE++ + +GV FVID G   + V+NPR R +S  V  +SR+ A+Q +  A R GP GKCFRLY E+ +  E+ E   P +L SNL+ ++L LK+L + D+   DF+D P P N  +A + L YL A+D DG L+++G +M+E PLDPQL+K L+ASC+F+C  ++L + +ML+V P CF
Sbjct:   40 NPFDGLPFSSRYYALLKARRALPVWGAREMFRERIASYPVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVVCAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPGLRVVLVATPCAAEALHRYYGDVPWREVVGQQG--QLVYTGVETEQRDVVRAAVKLVLEIHRAAQPGDVLVFLPSDKDASTAYEQARREARQLSPALGELRLVPLLPGHPGGAGALYDAGGAAATAKGRGGRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAEQTSCCAVRAGPAGKCFRLYPESVF-KEMPELPPPRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDNDGNLSEVGIIMSEIPLDPQLAKALLASCEFDCVTEMLTLAAMLTVVPLCF 524          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 337.806 bits (865), Expect = 2.145e-107
Identity = 185/505 (36.63%), Postives = 283/505 (56.04%), Query Frame = 3
Query:   93 NYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMK----IPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNV---------------------QQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGP-GKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLS 1529
            N  +  P+S +YY +LK R  LPVW  +E F + ++   +I++ GE G GK+TQIPQWC E+      E   V C QP  +AA S+A RVADE+D+ +G EVGY + FED  + +TIL++ TD MLLRE  SDP L  Y  I+LDE  ER+L TD+LMGLL+++   R  L++++++    AE    Y+G+ P ++    +P  T       +    +D+  +A  ++  IH     GD+L+FL   ++   A  +   E   L   +G++  +PL    P                                          R++V+++ IAE++ + +GV FVID G   + V+NPR R +S  V  +SR+ A+     A R GP GKCFRLY E+ +  E+ E   P +L SNL+ ++L LK+L + D+   DF+D P P N  +A + L YL A+D DG L+++G +M+E PLDPQL+K L+ASC+F+C  ++L + +ML+
Sbjct:    4 NPFDGLPFSSRYYALLKARRALPVWGAREMFRERIASYPVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVVCAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPGLRVVLVATPCAAEALHRYYGDVPWIRLDPPVPSSTSCSSADRSGGGGDDHACSAEHLVLEIHRAAQPGDVLVFLPSDKDASTAYEQARREARQLSPALGELRLVPLLPGHPGGAGALYDAGGAAATAKGRGGGGGGGGGASGGGGFLGVRGRRRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAETSCC-AVRAGPAGKCFRLYPESVF-KEMPELPPPRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDNDGNLSEVGIIMSEIPLDPQLAKALLASCEFDCVTEMLTLAAMLT 506          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 346.665 bits (888), Expect = 5.869e-105
Identity = 198/569 (34.80%), Postives = 326/569 (57.29%), Query Frame = 3
Query:  156 LPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTV-----------ITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKK-----SAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKK 1814
            LP+ +Y+++ ++++  +Q++V+ G+TG GK+TQ+PQ+ +      S+    V CTQPRR+A MS+AKRV+ E   E G ++GY IRFE   +  T + +LT+G+LLR+  ++  +  Y V++LDE HER L  D+L+G+L+E+   R DL+L++MSAT++ + F  Y G+AP++++PGR +P+++ +   P E+    +  +           I   +  ++ GD+L+FL+G  +I     R+     +   +      + L+S+L    Q ++F+ AP         RK +V+TNIAETS+TIDGV F++D G  KE  ++P+ +++ L    +SRASA+QR GRAGRTGPG CFRLY+E+ Y + L     PE+ R  L +V+L +K +G+GD   F F++PP   ++  +   L   GA+D    LT +GR++A  PLD    K L+  C     + VL I + +SV   F R   +      A+  L    GD LTLLNV+NE++  K      S KWC  + +  + L     ++ Q   +L +F L     +    + + +++
Sbjct:  105 LPIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLL------SAGMSRVACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYLRIMQSIDHKYPADERGDLLVFLSGMADIA----RVAEAAQSYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGV------RKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEY-DALEPYAVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSVQSPFHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKELLVQFGLLGGGEEPVRDSVQRVRQ 656          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 376/680 (55.29%), Postives = 501/680 (73.68%), Query Frame = 3
Query:   90 INYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQV------GDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSA----KWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNY-ENIKKSLVAGFFMQSAHFDKKGS--YLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            IN    + ++ KY DILK R ELPV   ++EF+++  +NQI+V VGETGSGKTTQIPQ+ + +      E   V CTQPRRVAAMSVA+RVA+E+DV+LGEEVGY IRFE+ TS  TILKY+TDGMLLREAM D  L  Y  I+LDEAHERTL TDILMGLLK++ + R DLK+I+MSATLDAEKFQ YF +APL+ +PGRT+PVE+++T E   DY+D+A+  +  IH  E+ GDILLFLTG++EI++A R+I +E    GDQ+      G +S  PLY SLPP+ QQRIFE AP  + +G+  RK+V++TNIAETS+TIDG+ +V+DPGF+K+KV+NPR RVESL V+ +S+ASA+QRAGRAGRT PGKCFRLY+E ++  ELIE +YPEILRSNLS+ +L LKKLG+ D+V FDF+DPP P+ MMRA + L YL  +D +G LT LGR+ ++FPLDP L+  LI S +F CS ++L IV+MLSVP  F+RP + +  AD AK   +  +GDH+TLLNVY+ F +++       KWC ++++NYRSL  A+ +R QL R+++++ L+  + D  S  Y +NI+K+L +GFFMQ A   + G+  Y+TVKD Q   +HPST L    +WVIYNEFV+T+ N++R VT + P WL+  AP YY+ ++F  G  K  LERI
Sbjct:   71 INPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVL-FDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLE----GDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAP-ESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAK-KRSGAKGYITVKDNQDVLIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDLSNFQKGDVKLSLERI 743          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 439/640 (68.59%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKP-DWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            I  +R  LPV+  + E +Q + DNQ +V+VGETGSGKTTQI Q+  E   +  S +  +GCTQPRRVAA+SVAKRVA+E+  ++G +VGY IRFED T P+T +KY+TDGML REA+ DP +  Y VI+LDEAHERT+ TD+L  LLK+    R +LK+IV SATL++ KF  YF N P++ IPG+TFPVE+ ++  P  DY++AA+  +  IH  E  GDIL+FLTGQEEID  C  +   +  LGD +G++  +P+YS+LP  +Q +IFE  P      K SRK+V ATNIAETSITIDG+ +V+DPGFAK  ++N R  +E L V+ +S+A A QR GRAGRTGPGKC+RLY+E++++NE++ENT PEI R NLS+ IL LK +G+ D++ FDF+DPP  + M+ A   LY+L ++D +G LT+LG+ M+ FP+DP LS++L++S D  CSD+++ I+SMLSV   F RP + Q  AD+ K +     GDHLTLLNVY  +     S ++C  NF+++R LK A +V+ Q+S I  K  LK IS     S+ + I+K+ V+GFFM +A  D +  Y T+       +HPS++L  K  ++V+Y+  V+T+  ++  VT I P WL+  AP +Y   D
Sbjct:  476 ISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDE---EGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTP------KGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLIS---CHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGD 1103          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 530.02 bits (1364), Expect = 1.367e-174
Identity = 291/655 (44.43%), Postives = 424/655 (64.73%), Query Frame = 3
Query:  132 DILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVE--WVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYT-SPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED--EGDILLFLTGQEEIDEAC-----RRIEIEISNLG----DQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGD-IVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL---RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYN 2042
            DI   + +LPV+  + + + ++ +NQ++V++GETGSGKTTQ+ Q+  E  + +D     K +  TQPRRVAA+SVAKRVA E+ V LG+EVGY IRFED T S  T LK++TDG+LLRE + D  L  Y  +++DEAHER+L TDIL+G  K +   R DLKLI+ SAT++A+KF  +FGNAP   IPGRTFPV+  +TS PV+DYV+AAV+    IH   D   GDIL+F+TGQE+I+        + +++     G    +++ D+  +P+YS+LP ++Q +IF+D           RKI++ATNIAETS+TI G+ +VID G++K KV+NP+  ++SL +T +S+A+A QR+GRAGRT PG  +RLY+E ++  ++   T PEI R+NLSN +L LK L V D +  F FID P     + +   L+++GAID  G LT LG  MA+FPL P LSK L+ +    CSD++L IVSMLSVP  F RP E Q  AD A+ +    + DHLTLLNV+ ++  N  S+ WC+ +F+ Y+SL  A ++R QL  IL   K+  IS   +  +++ IKK + +GF  Q+A      +Y+ +K     +LHP++AL      P +V+Y+E +MT+  ++  VT ++P WL+      Y+
Sbjct:  342 DIKHTKEQLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRG---KSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDL------HGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVIS---SGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEYGGLLYD 984          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 512.301 bits (1318), Expect = 3.940e-170
Identity = 284/673 (42.20%), Postives = 410/673 (60.92%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPN-TILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTL-IASCDFNCS---DDVLNIVSML-SVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATS-----SNYEN--IKKSLVAGFFMQSAHFDKKGSYLTVKDTQIA---RLHPSTALL--------RKPDWVIYNEFVMTTNNFLRIVTEI-NPSWLVNAAPEYYNPADFPDGRAKR 2075
            I + R  LPV  YK+E +Q +  NQ+++++GETGSGKTTQ+PQ+ VE    +  + + +  TQPRRVAA SVA RVADE++V LG+EVGY IRFED T+PN T+LKY+TDGMLLRE ++D  L  Y  I++DEAHERTL TDIL+GLLK+I   R  LKL++ SAT++A+KF  +F N P+  +PGR +PV+I +T +P  +Y+ AA+T I  IHT +   GDIL+FLTGQEEI+    ++E  +S LG +   +   P+Y++LP   Q +IF+  P N       RK+V+ATNIAETS+TIDG+ +VIDPGF KE  + P T +  L     SRAS  QRAGRAGR GPGKCFR++++ SY +EL     PEI R+NLSN +L L  LGV D++ F  +D P    + ++ + LY LGA++  G +T LG+MM EFP +P+ +K L  A+    C    ++ L IVSML   P  F+         DAA   LS+ E DH+  L ++N++ N+K S  WC ++ I ++++     +R QL R  +K  L + ++ A       + Y N  I +  ++GF M        G Y T+  +       +HP++ L         R   +V+Y + ++T+  F+R    I    WL++  P+ +   D  D +  R
Sbjct:  216 IQEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQ-IAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQPEANYIHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIFQPTPEN------CRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFI-----GQKRDAAASVLSEVESDHILYLEIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKNDQARMKIGNIAGYINARITRCFISGFPMNIVQLGPTG-YQTMGRSSGGLNVSVHPTSILFVNHKEKAQRPSKYVLYQQLMLTSKEFIRDCLVIPKEEWLIDMVPQIFK--DLIDDKTNR 873          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 427.557 bits (1098), Expect = 3.431e-139
Identity = 259/667 (38.83%), Postives = 376/667 (56.37%), Query Frame = 3
Query:   93 NYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITEN-RSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQ--VGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPI-ESQGAADAAKMRL---SKTEGDHLTLLNVYNEFINNKKSAK--------WCSNNFINYRSLKTANEVRLQLSRILDKF---------KLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL--RKPDWVIYNEFVMTTNNFLRIVTEINPSWL 2015
            N L  K    +  D+LK R  LPV+ +K E M  +  N + VL+GETGSGK+TQIPQ+ +E + D + +   +  TQPRRVAA+++A RVA E   +LGE+VGY +RF++ T+  T LKYLTDGMLLRE M +  L+ Y VI++DEAHERT+ TD+++G LK + +  R DL++IVMSATL AEKF  +F NAP++ + GR F V+ ++   P +D VDA +     I+  E+ GDIL FL GQEEID+A   +E     + D+  V  +   PLY++LP   Q  +F  AP         RK+V +TNIAETS+TI GV FV+D G  K KV+  +  + +L    +S+ASA QR+GRAGR   GK FRLY E+ Y  +L + + PEI RS++++ +L LK+ GV D++ + + + P  + ++     LY LGA+D  G +T  G+ MA  PL P LS  LI + +  C   V++IVS LSV    + P  E +   +  ++ L    K  GD + L  +++ +      ++        WC    I+ R  K    VR QL     +          + K+I  D        I K  + GF   +A      SY TV   +   +HPS+ L   +    ++Y E+V TT  + R V+ I  SWL
Sbjct:   60 NVLTYKSLKSRASDLLKMRETLPVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEKLYD-TKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVF--APIKG----FKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDY-VKLPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGEDGEL--ISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISIHPSSMLFMNKSCPGIMYTEYVFTTKGYARNVSRIELSWL 716          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 302/467 (64.67%), Postives = 383/467 (82.01%), Query Frame = 3
Query:  447 KYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQ 1841
            +Y+TDGMLLREAM+DP L  Y VILLDEAHERTL TDILMGLLKE+ + R DLK+I+MSATLDA KFQ+YF + PLM IPGRT PVEIF+T EP  DY++AA+  +  IH +E+ +GDILLFLTGQEEI+EAC+RI+ E+ NLG ++G++ CIPLYS+LPP  QQRIFE APP+  +G I RK VVATNIAETS+TIDGV FVIDPGF+K+KV+NPR RVESL V+ +SRASA+QRAGRAGRT PGKCFRLY+E ++  E+  NTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YLGA+D +G LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I SMLSVP  F+RP E++ AAD +KM+ +  +GDHLTLLNVY+ +  N +  +WC +NFI +RS+K+A+ VR QL+RI+D+F L++ S D  S +Y  NI+K+LV+GFFMQ
Sbjct:    1 RYMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDDLKIIIMSATLDAGKFQDYFDHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMVEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGELKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITSMLSVPQVFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNHEDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNLQRRSTDFNSRDYYLNIRKALVSGFFMQ 467          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Match: EDO49560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM4])

HSP 1 Score: 517.309 bits (1331), Expect = 2.493e-176
Identity = 251/502 (50.00%), Postives = 344/502 (68.53%), Query Frame = 3
Query:  573 LKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKR 2075
            +K+  + R DLKLIV SATLDA KF  +F  AP+  IPGRTFPVEI +T E   DY+DAA+  +  IH  E  GDIL+FLTGQEEID AC  +     +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK V+ATNIAETS+TIDG+ +V+DPGF K+ V+N ++ +++L VT +S+A AKQR+GRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ ILSLK +G+ D++ FDF+DPP  + M+ A + L+ L A+D +G+LT LGR MAEFPL+PQLSK LI S    CSD++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NF+  RSL+ A ++R Q+  ++D+ KL  +S      +   ++K++ +GFF  +A  D +  Y TV D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  AD P   +KR
Sbjct:    1 MKKAVQRRPDLKLIVTSATLDAVKFSTFFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERTKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKCVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLATAVPEIQRTNLASTILSLKAMGINDLLSFDFMDPPPMETMISAMEALHSLSALDNEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQMLGLMDRHKLDVVS---CGKHTARVQKAITSGFFRNAARKDPQEGYRTVVDNQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPSFFRVAD-PTKLSKR 492          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 518.464 bits (1334), Expect = 2.300e-174
Identity = 270/647 (41.73%), Postives = 408/647 (63.06%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEW-VSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSD-----LKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNM---MRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTAL-LRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYN 2042
            I ++++ LP++  ++  +  + + Q +++VGETGSGKTTQIPQ+  E  V+ NS     + CTQPRRVAA+S+A+RV+ E+ V+LGEEVGY +RFED TS  T +KY+TDGMLLRE++ D  LK Y VI+LDEAHERT+ TD+L G++K    +R D     LK++VMSATL+A +F  YFG+A ++ I GR  PVE+ +  EP  DY+ AA+  I  +H  +   GDIL+FLTGQ+EI+   + +     +       +   P++++LP + Q ++F  A P       +RK++++TNIAETS+TI GV +VID G+ K K F+P+T ++ L V  VS+A A+QR GRAGR   G C+RLY+E  +  +L E T PEI R NLS+VIL L  LG+ DI  FDF+D P  D +   ++   +L  L  I+ D  LT LG+ MA+FPL+P+L+K ++AS    CS+++L +V++LSV      P   +  A   + +   +EGD +TLLN+Y  +     +  WC+ +FIN R +K   ++R QL  I  + ++K  S    S+    +++ L  G FM SA     G+Y T+   +   +HPS++L + KP +V+YNE V T+  ++R V+ ++  WL+ AAP ++ 
Sbjct:   51 IQRQKLSLPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNS----VIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFGSAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIMQLHQEKPLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQLLVCPMFAALPSSQQMQVFRPAIPG------ARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQF-EQLAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEINGDYKLTSLGQKMAQFPLEPRLAKVILASETLGCSEEILTVVALLSVDSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGMNKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDSA---TLRQCLCRGLFMNSAELQLDGTYQTLNHRETVAIHPSSSLFMSKPAYVVYNELVHTSKCYMRDVSVVSCDWLLEAAPGFFQ 683          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 483.797 bits (1244), Expect = 4.306e-162
Identity = 260/601 (43.26%), Postives = 387/601 (64.39%), Query Frame = 3
Query:  111 PYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVE--WVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPN-TILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGN----------APLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTD-LGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSY 1871
            P S    DI ++R  LP++ ++   + +L   + +++VGETG GK+TQ+ ++ +E  W +D     K +G TQPRRVAA++VA RVA+E D   G+EVGYC+RF D   P  T +K++TDG+LLRE M DP L +Y VI++DEAHERTL TD+L+GLLK+I + R DL++IV SATLDAE F+++F            A ++ + GR++PV I +   PV +Y+ +AV     IH  E  GDIL+FLTGQEE++ A  ++      +      +  +P+YS LP   Q  +F+  PPNT      RK++VATN+AE SITIDG+ +V+D GF K + ++P T +ESL VT++S+ASA+QRAGRAGR   GK +RLY+E + H EL   T PE+ R  +    + LK +G+ +++ FDF   P   +M+R  +LLY L A+D +G L D LG  MAEFPL+P ++K L+ S +F CS+++L I +ML +   FV P   + A++ A+ + S  EGDHLT LNV+  F+ +KKS++WC +NF+NY+ L  + ++R QL ++L  FK+  +S D    + + + + +VAGFF  +A +   G Y
Sbjct:   26 PNSSLSIDIQRQR--LPIFKHRTNILYLLEKYETVIIVGETGCGKSTQV-KYLLESGWTADG----KKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPDLRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPVNIEYAISPVANYLQSAVETAMGIHLEEGPGDILVFLTGQEEVESAVSKLIERARGMPKGSSYLKVLPMYSGLPYEEQMLVFKRPPPNT------RKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDALH-ELKPVTVPEMQRYFIG---ILLKSMGIDNVLRFDFPARPPAQSMVRGLELLYALDALDDNGKLVDPLGVQMAEFPLEPMIAKMLLISGEFKCSEEILTIAAMLQIKNVFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHKKSSRWCHDNFVNYKGLMHSVKIREQLKKLLQHFKIPIVSCDG---DVDQVCRCIVAGFFSNAARYHPSGCY 606          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 386.341 bits (991), Expect = 1.426e-121
Identity = 187/349 (53.58%), Postives = 261/349 (74.79%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPG 1181
            ++++R  LP++  ++E + I+ DNQ++++VGETGSGKTTQ+ Q+  E   D  + +  +GCTQPRRVAAMSVAKRV++E+D  LGEEVGY IRFED TS  T++KY+TDG+LLRE++ +  L +Y VI++DEAHER+L TD+L GLL+++   R DLKLIV SAT+DA+KF ++FGN P  KIPGRTFPVEIFFT   +EDYVD+AV     IH    +GDIL+F+ GQE+I+  C  I   ++ + ++   ++ +P+YS LP ++Q +IF+ AP    DG   RK VVATNIAETS+T+DG+ FVID G+ K KV+NP+  +++L V  +S+A+A QR+GRAGRTGPG
Sbjct:  520 LVQQRQYLPIFAVRQELLSIVRDNQVVIIVGETGSGKTTQLTQYMHE---DGYTNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRDLKLIVTSATMDAQKFADFFGNVPTYKIPGRTFPVEIFFTRTVMEDYVDSAVKQALQIHLTPSKGDILVFMPGQEDIEVTCELISERLAEV-EEAPPLAVLPIYSQLPSDLQAKIFQKAP----DG--VRKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 431/675 (63.85%), Postives = 540/675 (80.00%), Query Frame = 3
Query:   72 SPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAV-TVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            SPI+  IN   N P++ +YY+ILKKR++LPVW+Y+E F +IL  NQ  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  T+LKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKEI   R+DLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+ TVI L    E+EGD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE +PPN  +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT VS+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL +L A++ DG LT+LG MMAEFPLDPQL+K +IASC++NCS+++L I +MLSVP CFVRP E++  AD +K+R +  +GDHLTLLNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+++F L + S + +S +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T++ P WL+  AP+YY+  +FP   A+R LERI
Sbjct:   48 SPIQQQINPFTNLPHTPRYYEILKKRLQLPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDVKPEWLMRIAPQYYDLGNFPQCEARRQLERI 722          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 431/675 (63.85%), Postives = 540/675 (80.00%), Query Frame = 3
Query:   72 SPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAV-TVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            SPI+  IN   N P++ +YY+ILKKR++LPVW+Y+E F +IL  NQ  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  T+LKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKEI   R+DLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+ TVI L    E+EGD+LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE +PPN  +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT VS+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL +L A++ DG LT+LG MMAEFPLDPQL+K +IASC++NCS+++L I +MLSVP CFVRP E++  AD +K+R +  +GDHLTLLNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+++F L + S + +S +Y  NI+++LV GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T++ P WL+  AP+YY+  +FP   A+R LERI
Sbjct:   21 SPIQQQINPFTNLPHTPRYYEILKKRLQLPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDVKPEWLMRIAPQYYDLGNFPQCEARRQLERI 695          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Match: DHX15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:105357480])

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 431/674 (63.95%), Postives = 536/674 (79.53%), Query Frame = 3
Query:   75 PIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDE-GDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            P+   IN   N P++ ++Y+ILKKR++LPVW+YKE F  I++  Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH  E+E GD LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSNL +V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLT+LNVY+ F  N +S +WC +NF+NYRSL +A+ VR QLSRI+D+F L + S + TS +Y  NI+++L  GFFMQ AH ++ G YLTVKD Q+ +LHPST L  KP+WV+YNEFV+TT N++R  T+I P WLV  AP+YY+ ++FP   AKR LERI
Sbjct:   71 PMHQQINPFTNLPHTPRFYEILKKRLQLPVWEYKESFTNIITRQQSFVLVGETGSGKTTQIPQWCVDMVRGLPGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDCLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTMLNVYHAFKQNHESNQWCYDNFVNYRSLMSADNVRQQLSRIMDRFNLPRRSTEFTSRDYYINIRRALCTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLERI 744          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Match: DHX15 (DEAH-box helicase 15 [Source:NCBI gene;Acc:105357480])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 341/539 (63.27%), Postives = 416/539 (77.18%), Query Frame = 3
Query:   75 PIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTL-EDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNF 1688
            P+   IN   N P++ ++Y+ILKKR++LPVW+YKE F  I++  Q  VLVGETGSGKTTQIPQWCV+ V       + V CTQPRRVAAMSVA+RVADE+DV LG+EVGY IRFED +S  TILKY+TDGMLLREAM+DP L+ Y VI+LDEAHERTL TDILMG+LKE+   RSDLK+IVMSATLDA KFQ YF N PL+ IPGRT PVEIF+T EP  DY++AA+  +  IH   E+EGD LLFLTGQEEIDEAC+RI+ E+ +LG +VGD+  IPLYS+LPP  QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KV+NPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E +Y  E+ +NTYPEILRSN                    F+DPP P+ +MRA +LL YL A++ DG LT+LG MMAEFPLDPQL+K +IASC+FNCS+++L+I +MLSVP CFVRP E++ AAD +KMR +  +GDHLT+LNVY+ F  +K     C N+F
Sbjct:   71 PMHQQINPFTNLPHTPRFYEILKKRLQLPVWEYKESFTNIITRQQSFVLVGETGSGKTTQIPQWCVDMVRGLPGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDCLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPRKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSN--------------------FMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITAMLSVPQCFVRPTEAKKAADESKMRFAHIDGDHLTMLNVYHAFKQSK-----CQNSF 584          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:101162325])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 335/652 (51.38%), Postives = 459/652 (70.40%), Query Frame = 3
Query:  102 NNKPYSQK-YYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            N   Y +K    IL++R  LP++  KE+ +Q + DNQI++++GETGSGKTTQI Q+  E  +  ++  K +GCTQPRRVAAMSVAKRV++E    LG+EVGY IRFED TSP T++KY+TDGMLLRE + D  L  Y +I+LDEAHERT+ TD+L GLLK+  + R+D+KLIV SATLDA KF  YF  AP+  IPGRT+PVE+ +T EP  DY+DA++  +  IH  E  GDIL+FLTGQEEID AC  +   + +LG  V ++  +P+YS+LP  +Q RIF+ APP       SRK+V+ATNIAETS+TIDG+ +V+DPGF K+KV+N +T ++ L VT +S+A AKQRAGRAGRTGPGKC+RLY+E +Y +E++    PEI R+NL++ +LSLK +G+ D++ FDF+D P  + ++ A + LY LGA+D +G+LT LGR MAEFPL+P L K LI S    CS+++L IVSMLSV   F RP + Q  AD  K +  + EGDHLTLL VYN + NNK S  WC  NFI  RSL+ A ++R Q+  I+D+ KL  +S    +     ++K++ +GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+P+WV+Y+E V+TT  ++R VT I+P WLV  AP ++  +D
Sbjct:  542 NKASYGKKTQLSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAE--AGYTARGK-IGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPG------SRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATV---RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSD 1181          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Match: SMESG000009126.1 (SMESG000009126.1)

HSP 1 Score: 1407.51 bits (3642), Expect = 0.000e+0
Identity = 677/682 (99.27%), Postives = 680/682 (99.71%), Query Frame = 3
Query:   69 TSPIECSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK 2114
            TSPIE SINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEI+ENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFE+APPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDI+GFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI RTTGTEK
Sbjct:   18 TSPIEYSINYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEISENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEEAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIIGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERITRTTGTEK 699          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Match: SMESG000065130.1 (SMESG000065130.1)

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 447/669 (66.82%), Postives = 550/669 (82.21%), Query Frame = 3
Query:   90 INYLNNKPYSQKYYDILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLED-EGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYE-NIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFPDGRAKRILERI 2090
            IN     PY+QKY+DI K+R++LPVW+YK+ F  +L+ NQ +VLVGETGSGKTTQIPQWC+EWV +N S  K VGCTQPRRVAAMSVA+RVA+E+DV LG+EVGY IRFED TS  T++KYLTDGMLLREAMSD  L+ Y VILLDEAHERTL TDILMGLLKE+ + R+DLK+++MSATLDA KFQ YFGNAPLMK+PGRT PVEIF+T EP +DY++AA+  +  IH  E+ EGDIL+FLTGQEEIDEAC+RI+ E+ NLG  VG++ CIPLYS+LPPN+QQRIFE  PP   +G I RK+VV+TNIAETS+TIDGV FVIDPGFAK+KVFNPR RVESL VT +S+ASA+QRAGRAGRT PGKCFRLY+E  Y+NE+ ENTYPEILRSNL  V+L LKKLG+ D+V FDF+DPP P+ +MRA +LL YL A+D DG LTDLG MMAEFPLDPQL+K +IASCDFNCS+++L+I +MLSVP CFVRP E++ AAD AKM  +  +GDHLT+LNVY+ F  N++ ++WC ++F+NYRSLK A+ VR+QLSRI+D+F L++ S D +S +Y  NI+K+LV+GFFMQ AH ++ G YLTVKD QI  LHPST L  KP+WV+YNEFV+TT NF+R V E+ P WLV  AP+YY+ ++FP   AK I+ERI
Sbjct:   49 INPYTGMPYTQKYHDIYKRRIQLPVWEYKDYFFDVLTKNQAVVLVGETGSGKTTQIPQWCLEWVRENFSTRKEVGCTQPRRVAAMSVAQRVAEEMDVTLGQEVGYSIRFEDCTSNKTLMKYLTDGMLLREAMSDALLEKYGVILLDEAHERTLATDILMGLLKEVIKVRTDLKIVIMSATLDAGKFQEYFGNAPLMKVPGRTHPVEIFYTPEPEKDYLEAAIRTVIQIHMCEETEGDILVFLTGQEEIDEACKRIQREVENLGPDVGELKCIPLYSTLPPNLQQRIFEPPPPKKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVFNPRIRVESLLVTPISKASAQQRAGRAGRTRPGKCFRLYTEKGYNNEMHENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGGMMAEFPLDPQLAKMVIASCDFNCSNEILSITAMLSVPQCFVRPTEARTAADEAKMGFAHIDGDHLTMLNVYHAFKQNREDSQWCYDHFVNYRSLKAADNVRIQLSRIMDRFNLRRSSTDFSSKDYYVNIRKALVSGFFMQVAHLERSGHYLTVKDNQIVHLHPSTCLDHKPEWVLYNEFVLTTKNFIRTVCEVKPEWLVKVAPQYYDMSNFPPCAAKEIIERI 717          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Match: SMESG000006773.1 (SMESG000006773.1)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 322/640 (50.31%), Postives = 447/640 (69.84%), Query Frame = 3
Query:  135 ILKKRVELPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVPPCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTALL-RKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPAD 2051
            IL++R  LP++  K E +Q ++DNQ++V++GETGSGKTTQ+ Q+  E       + K + CTQPRRVAA SVAKRVA E    LG+EVGY IRFED T+  T +KY+TDGMLLRE + DP L  Y VI+LDEAHERT+ TD+L GLLK+    R DLKLIV SATL++ KF  YF  +P+ +IPGRTF VE+ ++ EP +DY++A++  +  IH  E  GD+LLFLTGQEEID  C  I   I  LG    ++  +P+YS++P + Q RIF+ APPN      +RK+V+ATNIAETS+TI+G+ +VIDPGF K+KV+N ++ ++ L VT +S+A A QR GRAGRTGPGKC+RLY+E ++  E++ N  PEI R+N+++ +L+LK +G+ D++ FDF+D P    +++A   L+ L A+D +G+LT LGR MAEFPL+P L+K LI S    CS+++L IVSMLSV P F RP +   AAD  K + ++ EGDH+TLL V+N + N+K S  WC +NFI  RSLK A +VR QL  I+D++ LK  S      N   I+K++V+GFF  +A  D +  Y T+ D Q+  +HPS+AL  R+PDWVI++E V+TT  ++R VT I+  WLV  AP+++  +D
Sbjct:  460 ILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAE---AGLIKNKKIACTQPRRVAAKSVAKRVAQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPN------ARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVEPAFYRPKDKADAADQKKAKFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRS---CGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSALFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 1087          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 303/646 (46.90%), Postives = 425/646 (65.79%), Query Frame = 3
Query:  156 LPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVP-PCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTA---LLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFP-DGRAKRI 2078
            LP++  K E ++++++NQI+V+ GETGSGKTTQIPQ+  E  +    E K +GCTQPRRVAAMSVA RVA E++V+LG++VGY +RFE   S  T +KY+TDGMLLRE ++DP +  Y V+++DEAHERTL TDIL GLL  +TE R DLK+I+ SAT D EKF  +F  AP  KIPGR +PVE F+T +   D+V+AAV  I  IH  + +GDIL+FLTGQE+I+EA   ++  I  LG ++ ++  +P+YS+LP   Q +IF   PP       +RK+V+ATNIAETS+TIDG+ FVID G+ K K ++PR+R++SL V  +++A+A QR+GRAGR  PGKCFRLY + ++  E  +   PEI R+NL NV+L LK LG+ DI+ FD++DPP   +++ A + LYYL AID  G L+ +GR M E P DP +S  ++ S  + CS++++ I +MLS+    F  P   +  A  A     + EGDHLTLL VYNE+ NN  S+ WC +N+I  RS+K A  +R QL  + D+ +LK ISN   S +   I K++ AGFF+ +A F+   SY  +K      +  ++    L   P +V++N  V TT  ++R  T I P WL + AP  Y   DF  D + KR+
Sbjct:  234 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYE--AGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPG------ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISN---SEDTVGICKAITAGFFLNTARFN-GDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRM 866          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 303/646 (46.90%), Postives = 425/646 (65.79%), Query Frame = 3
Query:  156 LPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVP-PCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTA---LLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFP-DGRAKRI 2078
            LP++  K E ++++++NQI+V+ GETGSGKTTQIPQ+  E  +    E K +GCTQPRRVAAMSVA RVA E++V+LG++VGY +RFE   S  T +KY+TDGMLLRE ++DP +  Y V+++DEAHERTL TDIL GLL  +TE R DLK+I+ SAT D EKF  +F  AP  KIPGR +PVE F+T +   D+V+AAV  I  IH  + +GDIL+FLTGQE+I+EA   ++  I  LG ++ ++  +P+YS+LP   Q +IF   PP       +RK+V+ATNIAETS+TIDG+ FVID G+ K K ++PR+R++SL V  +++A+A QR+GRAGR  PGKCFRLY + ++  E  +   PEI R+NL NV+L LK LG+ DI+ FD++DPP   +++ A + LYYL AID  G L+ +GR M E P DP +S  ++ S  + CS++++ I +MLS+    F  P   +  A  A     + EGDHLTLL VYNE+ NN  S+ WC +N+I  RS+K A  +R QL  + D+ +LK ISN   S +   I K++ AGFF+ +A F+   SY  +K      +  ++    L   P +V++N  V TT  ++R  T I P WL + AP  Y   DF  D + KR+
Sbjct:  178 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYE--AGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPG------ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISN---SEDTVGICKAITAGFFLNTARFN-GDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRM 810          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX150.000e+065.09DEAH-box helicase 15 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX80.000e+051.99DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX80.000e+051.99DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX80.000e+052.28DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX160.000e+047.06DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-150.000e+061.53Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
ddx-150.000e+062.31Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
mog-50.000e+050.47Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+048.49Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+048.49Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx150.000e+064.31gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx150.000e+064.31gene:FBgn0033160 transcript:FBtr0088966[more]
pea0.000e+051.88gene:FBgn0086895 transcript:FBtr0087518[more]
l(2)37Cb0.000e+048.30gene:FBgn0086444 transcript:FBtr0081163[more]
l(1)G00070.000e+045.85gene:FBgn0026713 transcript:FBtr0073900[more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx150.000e+064.90DEAH (Asp-Glu-Ala-His) box helicase 15 [Source:ZFI... [more]
dhx80.000e+051.38DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
AL833789.30.000e+051.38DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx80.000e+049.26DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx160.000e+049.38DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2c10.000e+064.16ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
atp2c10.000e+062.63ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
atp2c10.000e+063.20ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
rps15a0.000e+051.53ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a0.000e+051.53ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx150.000e+065.09DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
Dhx150.000e+066.27DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
Dhx80.000e+051.99DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx80.000e+051.99DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx150.000e+067.69DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43143|DHX15_HUMAN0.000e+065.09Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|Q5RAZ4|DHX15_PONAB0.000e+065.09Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|O35286|DHX15_MOUSE0.000e+065.09Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|Q20875|DHX15_CAEEL0.000e+061.53Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|Q9LZQ9|DEAH2_ARATH0.000e+060.96Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LEB10.000e+065.45Putative pre-mRNA-splicing factor ATP-dependent RN... [more]
G4VJG10.000e+065.45Putative atp-dependent RNA helicase OS=Schistosoma... [more]
A0A1S8WT710.000e+065.13Helicase protein OS=Opisthorchis viverrini OX=6198... [more]
A0A075A8U50.000e+065.03Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2MDB10.000e+065.03Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx150.000e+064.49DEAH-box helicase 15 [Source:NCBI gene;Acc:1030385... [more]
dhx150.000e+064.76DEAH-box helicase 15 [Source:NCBI gene;Acc:1030385... [more]
dhx150.000e+064.76DEAH-box helicase 15 [Source:NCBI gene;Acc:1030385... [more]
dhx150.000e+067.22DEAH-box helicase 15 [Source:NCBI gene;Acc:1030385... [more]
dhx80.000e+051.23DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx80.000e+051.23DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
zgc:1588281.689e-12336.42DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dqx17.393e-12140.37DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
dqx12.145e-10736.63DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
dhx345.869e-10534.80DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP430.000e+055.29RNA helicase in the DEAH-box family; functions in ... [more]
PRP220.000e+048.91DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP161.367e-17444.43DEAH-box RNA helicase involved in second catalytic... [more]
PRP23.940e-17042.20RNA-dependent DExD/H-box ATPase; required for acti... [more]
DHR23.431e-13938.83Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326290.000e+064.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495602.493e-17650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325312.300e-17441.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458614.306e-16243.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356221.426e-12153.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx150.000e+063.85pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
dhx150.000e+063.85pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
DHX150.000e+063.95DEAH-box helicase 15 [Source:NCBI gene;Acc:1053574... [more]
DHX150.000e+063.27DEAH-box helicase 15 [Source:NCBI gene;Acc:1053574... [more]
dhx80.000e+051.38DEAH-box helicase 8 [Source:NCBI gene;Acc:10116232... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009126.10.000e+099.27SMESG000009126.1[more]
SMESG000065130.10.000e+066.82SMESG000065130.1[more]
SMESG000006773.10.000e+050.31SMESG000006773.1[more]
SMESG000030778.10.000e+046.90SMESG000030778.1[more]
SMESG000030778.10.000e+046.90SMESG000030778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032886 ID=SMED30032886|Name=Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15|organism=Schmidtea mediterranea sexual|type=transcript|length=2448bp
TTTTATTAATTTGATAATGCGTAATTCAGAAAGTCAAACCAAAAGCGGCA
AAAAAAAAAAAATCAGCAACATCCCCAATCGAATGTTCTATTAATTATTT
AAATAACAAACCCTACTCTCAAAAATATTATGATATTTTGAAAAAACGAG
TTGAATTGCCAGTTTGGGACTATAAAGAAGAATTTATGCAAATTCTTTCA
GATAATCAAATAATTGTGTTAGTTGGTGAAACGGGTTCAGGAAAAACCAC
TCAAATACCTCAATGGTGCGTGGAATGGGTTAGTGATAATTCTTCCGAAT
TCAAATGTGTTGGTTGTACCCAACCAAGGCGAGTAGCAGCTATGTCTGTA
GCAAAACGTGTTGCTGATGAACTGGATGTAGAATTAGGTGAAGAAGTAGG
ATATTGCATTCGTTTCGAAGATTATACCTCACCCAATACAATTTTAAAGT
ATCTCACAGATGGAATGCTTCTACGTGAAGCTATGTCTGATCCTGCTTTA
AAAAATTACCAAGTTATCCTTCTTGATGAAGCCCATGAAAGAACATTGGG
TACGGATATTTTAATGGGATTACTGAAAGAAATCACTGAAAATCGTTCTG
ATTTAAAATTGATTGTTATGAGTGCAACTTTGGACGCAGAAAAATTTCAG
AATTATTTCGGAAATGCTCCTTTAATGAAAATTCCCGGCCGTACATTTCC
AGTGGAAATATTTTTTACCTCAGAACCCGTTGAAGATTATGTAGACGCCG
CTGTGACTGTTATCACATTGATTCATACGTTGGAAGACGAAGGCGACATA
CTTTTATTTTTAACCGGCCAAGAAGAAATCGATGAAGCCTGCAGGCGAAT
TGAAATCGAAATTTCCAATTTAGGCGATCAAGTCGGAGATGTTTCCTGCA
TTCCACTGTATTCCTCTCTTCCTCCGAATGTCCAACAACGGATCTTTGAA
GATGCTCCACCGAACACAGCCGATGGGAAAATCAGCCGAAAGATTGTTGT
TGCCACAAATATAGCTGAAACCTCAATAACAATCGATGGGGTAGCATTTG
TAATCGATCCAGGATTTGCAAAGGAGAAAGTTTTTAATCCCAGAACGAGA
GTAGAATCATTGACAGTAACAAAAGTCAGCAGAGCCTCAGCGAAACAACG
CGCCGGGCGTGCTGGGAGAACCGGACCCGGCAAATGTTTCCGACTCTATT
CCGAAGCCAGTTACCATAACGAACTTATCGAGAACACTTATCCGGAAATT
TTGCGCTCGAATTTGTCCAATGTGATTCTCAGCTTGAAAAAGCTAGGAGT
CGGTGATATTGTCGGCTTTGATTTTATTGATCCTCCACATCCAGATAACA
TGATGAGAGCGTTCGATTTGCTATATTACTTGGGTGCTATCGACTGTGAT
GGGGTGCTCACAGATCTTGGACGGATGATGGCAGAATTCCCGCTGGATCC
ACAACTGTCGAAAACGCTGATTGCATCTTGTGATTTCAATTGCTCAGACG
ATGTGTTGAACATCGTGTCAATGCTATCGGTACCACCATGCTTCGTAAGG
CCGATTGAATCTCAGGGCGCAGCGGATGCTGCTAAAATGAGGCTGTCAAA
AACTGAAGGGGACCATTTGACCTTACTCAATGTTTATAACGAATTTATTA
ACAACAAAAAGAGTGCGAAATGGTGCTCGAATAACTTCATAAATTATCGA
TCTCTGAAAACCGCAAATGAAGTGAGATTACAGCTGTCGAGAATTTTGGA
TAAATTCAAACTGAAACAAATTTCAAATGATGCTACATCTAGTAATTACG
AAAACATCAAAAAGTCCTTGGTCGCCGGTTTCTTTATGCAATCCGCCCAT
TTTGATAAGAAAGGTAGTTATTTGACTGTGAAAGATACTCAGATTGCTCG
GCTCCATCCATCTACTGCGTTATTGAGGAAACCTGATTGGGTGATTTACA
ATGAATTTGTAATGACCACAAATAATTTCTTGAGAATTGTAACAGAGATA
AATCCATCCTGGTTGGTGAATGCGGCTCCAGAATATTACAATCCTGCTGA
TTTTCCTGATGGTCGCGCTAAACGGATTCTTGAGCGAATAGCCAGAACGA
CTGGAACTGAAAAATGATTTACAAATAAAGATTTTCTTGTATTTTTCCAC
AAATTTTTTTTCTGGTTTAATGAGGGTTTTTCTCAAATAAAATTTGACAT
TGATTTTATATTTTCTTACTTTTGGTTGTGCATACAGGTTGTCTTGTTTA
GCGTACAAGTAACAATTTCTTACAGAACACCAATGCAATTATTATGCTAC
AAATTTATAAGAGGCGCTTAACAAATTAGGAAACAATCGAATTTCGCATC
ACGAATATTTCACGCAAATCTATGCTAAACCAGTAGCAAAAAGTATTCAA
ATAAAATTTGAAACCATTTCTATGTTTTGCTATTTTAAGAAATTTGAA
back to top

protein sequence of SMED30032886-orf-1

>SMED30032886-orf-1 ID=SMED30032886-orf-1|Name=SMED30032886-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRV
AAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAM
SDPALKNYQVILLDEAHERTLGTDILMGLLKEITENRSDLKLIVMSATLD
AEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLE
DEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQ
QRIFEDAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVF
NPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIEN
TYPEILRSNLSNVILSLKKLGVGDIVGFDFIDPPHPDNMMRAFDLLYYLG
AIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVP
PCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNN
FINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFF
MQSAHFDKKGSYLTVKDTQIARLHPSTALLRKPDWVIYNEFVMTTNNFLR
IVTEINPSWLVNAAPEYYNPADFPDGRAKRILERIARTTGTEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0017111nucleoside-triphosphatase activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR007502Helicase-assoc_dom
IPR027417P-loop_NTPase
IPR011709DUF1605
IPR011545DEAD/DEAH_box_helicase_dom
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30