Echinoderm microtubule-associated protein-like 4

Overview
NameEchinoderm microtubule-associated protein-like 4
Smed IDSMED30032885
Length (bp)2611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Echinoderm microtubule-associated protein-like 4 (SMED30032885) t-SNE clustered cells

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30032885) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Echinoderm microtubule-associated protein-like 4 (SMED30032885) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Echinoderm microtubule-associated protein-like 4 (SMED30032885) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032885

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30032885h1SMcG0015273 SmedASXL_008920SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032885h1SMcG0015273 Contig54972newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032885h1SMcG0015273 Contig54972uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30032885h1SMcG0015273 dd_Smed_v4_15932_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032885h1SMcG0015273 dd_Smed_v4_958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032885h1SMcG0015273 dd_Smed_v4_958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032885h1SMcG0015273 dd_Smed_v4_958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032885h1SMcG0015273 dd_Smed_v4_958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032885h1SMcG0015273 dd_Smed_v4_958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 346/779 (44.42%), Postives = 467/779 (59.95%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSP------------KAAKDVQLRKSMVSPRTPVKAT-----------RLSGTPTRRSTNDLVNH---------------------KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q ++I  LK+ L D + R+   EE + V   K       L  T P            K         S V   T V AT           R+S    R S  D   +                     KE  F   EG +++F+RGRP+ +Y+P    D +  +++++ P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE ++L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W  S   +  R  ++    G  RT+ E   D +++GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:   37 RIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISW--SGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 812          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 317/640 (49.53%), Postives = 428/640 (66.88%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ +Y+P    D +  +++++ P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE ++L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W  S   +  R  ++    G  RT+ E   D +++GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:  195 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISW--SGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 831          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 317/640 (49.53%), Postives = 428/640 (66.88%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ +Y+P    D +  +++++ P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE ++L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W  S   +  R  ++    G  RT+ E   D +++GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:  201 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISW--SGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 837          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML1 (EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 317/640 (49.53%), Postives = 428/640 (66.88%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ +Y+P    D +  +++++ P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE ++L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W  S   +  R  ++    G  RT+ E   D +++GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:  164 KEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISW--SGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 800          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Match: EML2 (EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 335/789 (42.46%), Postives = 478/789 (60.58%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTV---TPNSLKLTSP--KAAKDVQLRKSM-------------VSPRTPVKATRLSGTPTRR--------------------------STNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKP---HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-DDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            ME+++     ++  LE+    Q +E+  LK  L D L R+ A EE     + + T     P  L  T+   +  K +  R  +              SP +P K      +  RR                          S       KE  F   +G +++F+RGRP+ + +P+ LA  +   ++ + P   L++EWVYGYRG+DCR NLY LPTG+IVYFVA + +L+++  Q QRHY+ H DDIKC+A+HPD VT ATGQVAG +K EGKP   HVRIW S++L TLH +GLG F+RAV  VGFSKS+GG LL  VDE+NDH +++W+WA    +   K S E V+ A F+PTD  V+ TCGK+H+ FW LE  +L+K+  +FEK+EKPK+  CVTF   G+++TGDS GN+Y W +    IT A+  AH+G +F L     GTL+SGGG+D  +  W   +     + +++  D G  RT+ E   D L VGTT N+I++ + + GF  L+ GH +E+WG+ +HPS+ QFVT G D+ + LW + +H+ L S+ +E   +S    P+  ++A+G + G W +        +    DGNE I  + FSPDG+  AVGS DN +Y+Y +D    +V+R+GKCSGHSSFITHLDW+ D     +NSGDYE+L+W+   CKQ+T+A  + ++ W +A C L F V GIW EG+DGTDINAV ++H+  ++A+ADDFGKV+L+ YP C P+    KY GHSSHVT V FL +D    +TGG+DT+++QW
Sbjct:   13 MEVDD-----RVSALEQRLQLQEDELAVLKAALADALRRLRACEEQGAALRARGTPKGRAPPRLGTTASVCQLLKGLPTRTPLNGSGPPRRVGGYATSPSSPKKEATSGRSSVRRYLSPERLASVRREDPRSRTTSSSSNCSAKKEGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTK-EGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLW--GSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQW 793          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 321.627 bits (823), Expect = 4.522e-96
Identity = 206/669 (30.79%), Postives = 342/669 (51.12%), Query Frame = 3
Query:  396 NHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLN--NQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEG--KP-----------------------HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEK--NALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIV--EITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            N++   F  G G L IFI G+ + + VP    +  D       P   + ++ VY YRGKD R N+  LPTG++V+F A +V+L N+   +++QR Y  HT D+KC+ LHP+K+  A+GQ + HS VE   KP                       HVRIW ++ L TL  + L  FE+ +  V FSK+D G LL  VD++  H +++WNW   K     K+S + V E +++PT  N+I   GK H +F+  +     L K +A FE  +KPK    + F  N +++TGDS+G I  W       T      H G ++SL ++++G +LSGG KD  + EWDL    +  R I+L ++ GF R I++   +L++GT+SN ++   I  +    +L+ G    +  + +  S  Q +T      + +W+ +  KV  SK+   +++ + V      + +GF  G W +  +T+ + I + K+G  PI  ++F+P G+ FAV ++D  + IY+ID+ +  +  + +     + I  LD+SSD  +LR  S    LLFW   +  ++   +++ DV W S+   + FE A +    S+G  + AV +  +  I A   + G + +Y+ P  +      +  GH   +  V F     +L S    D ++ +W
Sbjct:  234 NNRTCQFSNGSGHLPIFIGGKTVQVPVPTGY-ENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHS-VEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTL--MVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGG-KDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDA-SKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWT--KAGEICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 321.627 bits (823), Expect = 4.522e-96
Identity = 206/669 (30.79%), Postives = 342/669 (51.12%), Query Frame = 3
Query:  396 NHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLN--NQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEG--KP-----------------------HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEK--NALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIV--EITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            N++   F  G G L IFI G+ + + VP    +  D       P   + ++ VY YRGKD R N+  LPTG++V+F A +V+L N+   +++QR Y  HT D+KC+ LHP+K+  A+GQ + HS VE   KP                       HVRIW ++ L TL  + L  FE+ +  V FSK+D G LL  VD++  H +++WNW   K     K+S + V E +++PT  N+I   GK H +F+  +     L K +A FE  +KPK    + F  N +++TGDS+G I  W       T      H G ++SL ++++G +LSGG KD  + EWDL    +  R I+L ++ GF R I++   +L++GT+SN ++   I  +    +L+ G    +  + +  S  Q +T      + +W+ +  KV  SK+   +++ + V      + +GF  G W +  +T+ + I + K+G  PI  ++F+P G+ FAV ++D  + IY+ID+ +  +  + +     + I  LD+SSD  +LR  S    LLFW   +  ++   +++ DV W S+   + FE A +    S+G  + AV +  +  I A   + G + +Y+ P  +      +  GH   +  V F     +L S    D ++ +W
Sbjct:  234 NNRTCQFSNGSGHLPIFIGGKTVQVPVPTGY-ENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHS-VEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTL--MVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGG-KDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDA-SKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWT--KAGEICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 888          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 320.857 bits (821), Expect = 6.832e-96
Identity = 206/669 (30.79%), Postives = 342/669 (51.12%), Query Frame = 3
Query:  396 NHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLN--NQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEG--KP-----------------------HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEK--NALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIV--EITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            N++   F  G G L IFI G+ + + VP    +  D       P   + ++ VY YRGKD R N+  LPTG++V+F A +V+L N+   +++QR Y  HT D+KC+ LHP+K+  A+GQ + HS VE   KP                       HVRIW ++ L TL  + L  FE+ +  V FSK+D G LL  VD++  H +++WNW   K     K+S + V E +++PT  N+I   GK H +F+  +     L K +A FE  +KPK    + F  N +++TGDS+G I  W       T      H G ++SL ++++G +LSGG KD  + EWDL    +  R I+L ++ GF R I++   +L++GT+SN ++   I  +    +L+ G    +  + +  S  Q +T      + +W+ +  KV  SK+   +++ + V      + +GF  G W +  +T+ + I + K+G  PI  ++F+P G+ FAV ++D  + IY+ID+ +  +  + +     + I  LD+SSD  +LR  S    LLFW   +  ++   +++ DV W S+   + FE A +    S+G  + AV +  +  I A   + G + +Y+ P  +      +  GH   +  V F     +L S    D ++ +W
Sbjct:  231 NNRTCQFSNGSGHLPIFIGGKTVQVPVPTGY-ENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHS-VEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTL--MVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGG-KDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDA-SKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWT--KAGEICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: elp-1 (Echinoderm microtubule-associated protein-like elp-1 [Source:UniProtKB/Swiss-Prot;Acc:O45487])

HSP 1 Score: 320.857 bits (821), Expect = 6.832e-96
Identity = 206/669 (30.79%), Postives = 342/669 (51.12%), Query Frame = 3
Query:  396 NHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLN--NQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEG--KP-----------------------HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEK--NALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIV--EITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            N++   F  G G L IFI G+ + + VP    +  D       P   + ++ VY YRGKD R N+  LPTG++V+F A +V+L N+   +++QR Y  HT D+KC+ LHP+K+  A+GQ + HS VE   KP                       HVRIW ++ L TL  + L  FE+ +  V FSK+D G LL  VD++  H +++WNW   K     K+S + V E +++PT  N+I   GK H +F+  +     L K +A FE  +KPK    + F  N +++TGDS+G I  W       T      H G ++SL ++++G +LSGG KD  + EWDL    +  R I+L ++ GF R I++   +L++GT+SN ++   I  +    +L+ G    +  + +  S  Q +T      + +W+ +  KV  SK+   +++ + V      + +GF  G W +  +T+ + I + K+G  PI  ++F+P G+ FAV ++D  + IY+ID+ +  +  + +     + I  LD+SSD  +LR  S    LLFW   +  ++   +++ DV W S+   + FE A +    S+G  + AV +  +  I A   + G + +Y+ P  +      +  GH   +  V F     +L S    D ++ +W
Sbjct:  231 NNRTCQFSNGSGHLPIFIGGKTVQVPVPTGY-ENMDPTMDQDPPTMKVTLKHVYSYRGKDVRSNIEMLPTGELVFFSANLVVLMNITGEDRSQRIYHGHTCDVKCITLHPNKILVASGQSSCHS-VEKFQKPEHTSPIDSPEDLVRQLEMEHTEAHVRIWDTIKLTTL--MVLNGFEKGICHVAFSKTDSGSLLAVVDDSLKHLMSVWNWQKGKREGEVKASNDVVFECKWHPTIRNLIVLYGKGHFSFFNYDPATGVLVKTVATFEGRDKPKTVLSMCFGENDQVVTGDSNGTISIWDPRTCKTTKQAHSVHPGGVYSLTLAKSGKILSGG-KDRMVSEWDLQDLVRTRRPIELPDEKGFPRVILQNGSELIIGTSSNTLLFGNIENSTNLTSLIEGDPGNLTFLLTC-SSNQLITSSQCGTLRIWNHIDKKVEFSKKFIDSVECVDVDVTNTHIILGFAAGLWIVMNITKQQTIQEKKEGTAPITAVKFAPSGATFAVATKDPHLTIYRIDA-SKNLLVIARIHHIPAPIVALDFSSDSQYLRGQSIGAHLLFWT--KAGEICDGTSVKDVKWGSSRVKIGFETA-LVAHSSNG-QVTAVAQCED--ISACGMENGTIRIYKNPVTSVTAGFVELLGHGRIIKSVAF-SNKIQLFSCSPTDNSVFEW 885          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Match: prp-19 (Pre-mRNA-processing factor 19 [Source:UniProtKB/Swiss-Prot;Acc:Q10051])

HSP 1 Score: 59.3066 bits (142), Expect = 8.768e-9
Identity = 54/241 (22.41%), Postives = 107/241 (44.40%), Query Frame = 3
Query: 1488 LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDAL--THKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKD----GNEP-----IQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRY 2177
              GH+ ++  V  HP     ++   D  I +W A   + K ++    +  +  IS++ + D +     + +W+      F +I  GK       EP     +  IEF PDG +F  G+ D  + I+ + ++T+         GH++ +  + +S +G +L + S D E+  W++ + K L    T A+      N +L+F++ G +  G  G  +  +       +++ +D  G V   R+
Sbjct:  247 FKGHNKKINAVVLHPDNITAISASADSHIRVWSATDSSSKAIIDVH-QAPVTDISLNASGDYILSASDDSYWA------FSDIRSGKSLCKVSVEPGSQIAVHSIEFHPDGLIFGTGAADAVVKIWDLKNQTV----AAAFPGHTAAVRSIAFSENGYYLATGSEDGEVKLWDLRKLKNL---KTFANEEKQPIN-SLSFDMTGTFL-GIGGQKVQVLHVKSWSEVVSLSDHSGPVTGVRF 471          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299510)

HSP 1 Score: 368.622 bits (945), Expect = 3.494e-114
Identity = 213/682 (31.23%), Postives = 352/682 (51.61%), Query Frame = 3
Query:  327 PRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEG-----------ILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAIT--QAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIV-----EIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPE---GSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            P+ P++  R    P  +S   ++   E+  ++  G             ++ IRG     Y P   A      +    PD+ L+++WV+GYRG D R+NL+ LP+G+++Y+VA + +L + +   QRHY  HT+DI CM +HP +   A+GQ AG  + + + HVRIWS+ +LQTL+  G+G  +  V AV FS+ +GG  ++ VD   +  +++W W     +    +  E +  A F+P D N+I T G+ HLAFW   K+   ++  I ++  +   T+ V F  +G++IT DS G I  +S +        T  +AHN  I  L++   GTLLSGG KD  I  WD     K   + +L    G  RTI        D  + VGTT N I+E +    F  ++ GH  ++WG+ +HP  E + T GHD+ + LW    +K++ + Q      +++  P   L A G  EGH  +        +   +    P+ C+ ++  G + A+GS++  IY++++  +     +V K  G S  +THLDWS DG F+++ + D++LLFW+        +   + DV W + NCT+ F VAG W      +  T +   +++    ++A+ D  G + L+RYP  +P+    + K +S  +  V+FL  DH L + GG D +++ W
Sbjct:  148 PKVPLRGAR----PRSKSRPRILYAPESEILRPNGEYTMLDIMKEEPTKVTIRGLRRTFYPPVHHA-----PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDR-KSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTS-VQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWR--KNKLIWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 814          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0330139)

HSP 1 Score: 367.851 bits (943), Expect = 1.058e-113
Identity = 213/682 (31.23%), Postives = 352/682 (51.61%), Query Frame = 3
Query:  327 PRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEG-----------ILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAIT--QAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-----DDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPE---GSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            P+ P++  R    P  +S   ++   E+  ++  G             ++ IRG     Y P   A      +    PD+ L+++WV+GYRG D R+NL+ LP+G+++Y+VA + +L + +   QRHY  HT+DI CM +HP +   A+GQ AG  + + + HVRIWS+ +LQTL+  G+G  +  V AV FS+ +GG  ++ VD   +  +++W W     +    +  E +  A F+P D N+I T G+ HLAFW   K+   ++  I ++  +   T+ V F  +G++IT DS G I  +S +        T  +AHN  I  L++   GTLLSGG KD  I  WD     K   + +L    G  RTI        D  + VGTT N I+E +    F  ++ GH  ++WG+ +HP  E + T GHD+ + LW    +K++ + Q      +++  P   L A G  EGH  +        +   +    P+ C+ ++  G + A+GS++  IY++++  +     +V K  G S  +THLDWS DG F+++ + D++LLFW+        +   + DV W + NCT+ F VAG W      +  T +   +++    ++A+ D  G + L+RYP  +P+    + K +S  +  V+FL  DH L + GG D +++ W
Sbjct:  180 PKVPLRGAR----PRSKSRPRILYAPESEILRPNGEYTMLDIMKEEPTKVTIRGLRRTFYPPVHHA-----PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDR-KSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSRSHVTS-VQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWR--KNKLIWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 846          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 367.466 bits (942), Expect = 1.919e-111
Identity = 213/682 (31.23%), Postives = 351/682 (51.47%), Query Frame = 3
Query:  327 PRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEG-----------ILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAIT--QAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-----DDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPE---GSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            P+ P++  R    P  +S   ++   E+  ++  G             ++ IRG     Y P   A      +    PD+ L+++WV+GYRG D R+NL+ LP+G+++Y+VA + +L + +   QRHY  HT+DI CM +HP +   A+GQ AG  + + + HVRIWS+ +LQTL+  G+G  +  V AV FS+ +GG  ++ VD   +  +++W W     +    +  E +  A F+P D N+I T G+ HLAFW   K+   ++  I ++  +    T V F  +G++IT DS G I  +S +        T  +AHN  I  L++   GTLLSGG KD  I  WD     K   + +L    G  RTI        D  + VGTT N I+E +    F  ++ GH  ++WG+ +HP  E + T GHD+ + LW    +K++ + Q      +++  P   L A G  EGH  +        +   +    P+ C+ ++  G + A+GS++  IY++++  +     +V K  G S  +THLDWS DG F+++ + D++LLFW+        +   + DV W + NCT+ F VAG W      +  T +   +++    ++A+ D  G + L+RYP  +P+    + K +S  +  V+FL  DH L + GG D +++ W
Sbjct:  405 PKVPLRGAR----PRSKSRPRILYAPESEILRPNGEYTMLDIMKEEPTKVTIRGLRRTFYPPVHHA-----PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDR-KSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSR-SHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWR--KNKLIWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 367.081 bits (941), Expect = 4.512e-111
Identity = 213/682 (31.23%), Postives = 351/682 (51.47%), Query Frame = 3
Query:  327 PRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEG-----------ILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAIT--QAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEI-----DDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPE---GSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            P+ P++  R    P  +S   ++   E+  ++  G             ++ IRG     Y P   A      +    PD+ L+++WV+GYRG D R+NL+ LP+G+++Y+VA + +L + +   QRHY  HT+DI CM +HP +   A+GQ AG  + + + HVRIWS+ +LQTL+  G+G  +  V AV FS+ +GG  ++ VD   +  +++W W     +    +  E +  A F+P D N+I T G+ HLAFW   K+   ++  I ++  +    T V F  +G++IT DS G I  +S +        T  +AHN  I  L++   GTLLSGG KD  I  WD     K   + +L    G  RTI        D  + VGTT N I+E +    F  ++ GH  ++WG+ +HP  E + T GHD+ + LW    +K++ + Q      +++  P   L A G  EGH  +        +   +    P+ C+ ++  G + A+GS++  IY++++  +     +V K  G S  +THLDWS DG F+++ + D++LLFW+        +   + DV W + NCT+ F VAG W      +  T +   +++    ++A+ D  G + L+RYP  +P+    + K +S  +  V+FL  DH L + GG D +++ W
Sbjct:  405 PKVPLRGAR----PRSKSRPRILYAPESEILRPNGEYTMLDIMKEEPTKVTIRGLRRTFYPPVHHA-----PADNSPPDKKLQLQWVHGYRGIDARRNLWVLPSGELLYYVAAVAVLFDRDEDAQRHYTGHTEDIMCMDVHPSRELVASGQKAGRDR-KSQAHVRIWSTESLQTLYVFGMGELDSGVTAVAFSQLNGGSYILAVDSGRESILSVWQWQWGHLLGKVATLQEGLSGAAFHPLDDNLIITHGRGHLAFWHRRKDGFFERTDIVKQPSR-SHVTSVQFEPDGDVITADSDGFITIYSVDSDGAYFVRTEFEAHNKGIGCLIMLGEGTLLSGGEKDRKIAAWDSLQNYKKIADTKLPEAAGGVRTIYPQRPGRNDGNIYVGTTRNNILEGSLQRRFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWR--KNKLIWTIQTGYECVALAFHPFGTLAA-GSTEGHLLVINCENGAVMLTLRVCGSPLNCVAYNQVGDMIAMGSQNGSIYLFRVSRDGFSYKKVNKIRG-SQPLTHLDWSMDGNFVQTVTIDFDLLFWDAKSLSPERSPIAMKDVKWLTNNCTVGFLVAGQWSNRYYSTTNTIVATCSRSAAHDMLASGDAEGYLRLFRYPCISPRAEFHESKVYSGMLACVRFLCGDHTLITVGGTDASLMVW 1071          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Match: CG3909 (gene:FBgn0027524 transcript:FBtr0082172)

HSP 1 Score: 65.855 bits (159), Expect = 4.173e-11
Identity = 65/272 (23.90%), Postives = 113/272 (41.54%), Query Frame = 3
Query: 1230 AITQAHNGPI-FSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDN-GFCRTIVEIDDKLVVGTTSNAIVEITGNDGFD--NLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKV--LLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSW 2027
            A+ +    P  F    +     L  GG D  +  WDL          +L     G     V  D + +  ++ ++ + +      D  +LL+    ++W V   P  +  ++G +D KI ++   T K    L  Q  K   SI+ SP+   +A G I+G  +I  +   K +   +    P++ + FSP+  L    S D  + +Y +    +    VG  SGH+S++  + +S DG    S+S D  +  W+  E K L   +   D  W
Sbjct:   33 AVVEPEENPFDFDKKEARPKDFLVTGGLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDV----VGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVW 300          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml2 (EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 307/641 (47.89%), Postives = 437/641 (68.17%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            KE +F   EG +R+F+RGRPI +++P+ L   +  +S++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N+  Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH IG G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+H+ FW +E + LTK+  +FEK+EKPK+  C+ F  NG+ ITGDSSGNIY W++    I+  ++ AH G IFSL + + GTL+SGGGKD  +  WD   ++K+   +++    G  RT+ E   D+L VGTT NA++  + +     ++ GH+DE+WG+D HPS EQFVT G D+++ LWD  +H  L +K +E   +S+   P+  +VA+G +   W +        +    DGNE I  +++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS+D  F+ +NSGDYE+L+W     K +T    + ++ W ++ C L F V GIWP+G+DGTDINAV ++H+K ++A+ADDFGKV+L+  P   P+     Y GHSSHVT V FL +D  L STGG+DT+I+QWV
Sbjct:  166 KECSFNADEGYVRMFLRGRPITMHIPDQLRYSYSLESKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVEEQQQRHYLGHNDDVKCLAIHPDMVTIATGQVAGTSK-DGKALPPHVRVWDSVSLNTLHVIGAGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLAEVKCSNDSVLGAVFHPMEANLIVTCGKSHINFWTVEGSTLTKRQGLFEKHEKPKYVLCIAFAENGDAITGDSSGNIYIWAKGGNRISKVVSGAHEGGIFSLCVLKDGTLVSGGGKDRKVLLWDHDYRKKS--EMEVPEAFGPVRTLAEGKQDELFVGTTKNAVLRGSFSGSLTPIVQGHTDELWGLDVHPSTEQFVTCGQDKQVCLWDTCSHLPLWTKAIEDPARSVGFHPSGTVVAVGTMTAKWLVLDTDTRDLVSMHTDGNEIISVVKYSPDGAYLAVGSHDNFVYIYSVTENGKKYSRVGKCTGHSSFVTHLDWSTDSQFIVTNSGDYEILYWEASSGKHITNNDIVRNLEWATSTCVLGFSVFGIWPDGADGTDINAVCRSHDKNLLASADDFGKVHLFSNPCSQPRAPSHIYGGHSSHVTNVAFLHDDSHLISTGGKDTSILQWV 803          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml2 (EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 307/641 (47.89%), Postives = 437/641 (68.17%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            KE +F   EG +R+F+RGRPI +++P+ L   +  +S++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N+  Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH IG G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+H+ FW +E + LTK+  +FEK+EKPK+  C+ F  NG+ ITGDSSGNIY W++    I+  ++ AH G IFSL + + GTL+SGGGKD  +  WD   ++K+   +++    G  RT+ E   D+L VGTT NA++  + +     ++ GH+DE+WG+D HPS EQFVT G D+++ LWD  +H  L +K +E   +S+   P+  +VA+G +   W +        +    DGNE I  +++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS+D  F+ +NSGDYE+L+W     K +T    + ++ W ++ C L F V GIWP+G+DGTDINAV ++H+K ++A+ADDFGKV+L+  P   P+     Y GHSSHVT V FL +D  L STGG+DT+I+QWV
Sbjct:  165 KECSFNADEGYVRMFLRGRPITMHIPDQLRYSYSLESKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVEEQQQRHYLGHNDDVKCLAIHPDMVTIATGQVAGTSK-DGKALPPHVRVWDSVSLNTLHVIGAGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLAEVKCSNDSVLGAVFHPMEANLIVTCGKSHINFWTVEGSTLTKRQGLFEKHEKPKYVLCIAFAENGDAITGDSSGNIYIWAKGGNRISKVVSGAHEGGIFSLCVLKDGTLVSGGGKDRKVLLWDHDYRKKS--EMEVPEAFGPVRTLAEGKQDELFVGTTKNAVLRGSFSGSLTPIVQGHTDELWGLDVHPSTEQFVTCGQDKQVCLWDTCSHLPLWTKAIEDPARSVGFHPSGTVVAVGTMTAKWLVLDTDTRDLVSMHTDGNEIISVVKYSPDGAYLAVGSHDNFVYIYSVTENGKKYSRVGKCTGHSSFVTHLDWSTDSQFIVTNSGDYEILYWEASSGKHITNNDIVRNLEWATSTCVLGFSVFGIWPDGADGTDINAVCRSHDKNLLASADDFGKVHLFSNPCSQPRAPSHIYGGHSSHVTNVAFLHDDSHLISTGGKDTSILQWV 802          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml2 (EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 307/641 (47.89%), Postives = 437/641 (68.17%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            KE +F   EG +R+F+RGRPI +++P+ L   +  +S++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N+  Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH IG G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+H+ FW +E + LTK+  +FEK+EKPK+  C+ F  NG+ ITGDSSGNIY W++    I+  ++ AH G IFSL + + GTL+SGGGKD  +  WD   ++K+   +++    G  RT+ E   D+L VGTT NA++  + +     ++ GH+DE+WG+D HPS EQFVT G D+++ LWD  +H  L +K +E   +S+   P+  +VA+G +   W +        +    DGNE I  +++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS+D  F+ +NSGDYE+L+W     K +T    + ++ W ++ C L F V GIWP+G+DGTDINAV ++H+K ++A+ADDFGKV+L+  P   P+     Y GHSSHVT V FL +D  L STGG+DT+I+QWV
Sbjct:  194 KECSFNADEGYVRMFLRGRPITMHIPDQLRYSYSLESKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVEEQQQRHYLGHNDDVKCLAIHPDMVTIATGQVAGTSK-DGKALPPHVRVWDSVSLNTLHVIGAGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLAEVKCSNDSVLGAVFHPMEANLIVTCGKSHINFWTVEGSTLTKRQGLFEKHEKPKYVLCIAFAENGDAITGDSSGNIYIWAKGGNRISKVVSGAHEGGIFSLCVLKDGTLVSGGGKDRKVLLWDHDYRKKS--EMEVPEAFGPVRTLAEGKQDELFVGTTKNAVLRGSFSGSLTPIVQGHTDELWGLDVHPSTEQFVTCGQDKQVCLWDTCSHLPLWTKAIEDPARSVGFHPSGTVVAVGTMTAKWLVLDTDTRDLVSMHTDGNEIISVVKYSPDGAYLAVGSHDNFVYIYSVTENGKKYSRVGKCTGHSSFVTHLDWSTDSQFIVTNSGDYEILYWEASSGKHITNNDIVRNLEWATSTCVLGFSVFGIWPDGADGTDINAVCRSHDKNLLASADDFGKVHLFSNPCSQPRAPSHIYGGHSSHVTNVAFLHDDSHLISTGGKDTSILQWV 831          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 337/783 (43.04%), Postives = 469/783 (59.90%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLAR----------------------IAALEESKKVN-------------------KDKNT-VTPNSLKLTS------PKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R                      IAAL     VN                   KD N+  T +++K TS      P   KD  +       R     +  SG  T  +       +E  F   EG ++++++GRPI +Y+P  L D +  +++   P + L+++WVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RA+  + FSKS+GG  L  VD++NDH +++W+W     +   K S E V  A+F+PTD+N+I TCGK+HL FW LEK +L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ AI  AH   +F+L +   GTL+SGG KD  +  WD + ++   + +++    G  RT+ E   + +++GTT N +++ + N  F  +  GH+DE+WG+  HP K QF+T GHD+ I LWD+ +H+ + +K LE + QS    P+   VA+G   G W +        +    DGNE +  I FSPDG+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WP+GSDGTDINAV  ++ K ++ T DDFGKV+L+ +P    +     Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:   37 RIASLEQRVQMQEDEIQLLKSALADVVRRLNISEEQQAMLNKKGPTKARPMIAALPLRPTVNNGTVLPKKGGTLPSPSNCKKDNNSPATRSTVKRTSSSEHVGPNNRKDSGVDSKNNRTRAGSTGSNSSGKKTTET-----KQREPVFSADEGYVKMYLKGRPITMYMPKDLVDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKI--QTVEVPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNGEFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQW 810          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 306/640 (47.81%), Postives = 426/640 (66.56%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  T  K EG ++++++GRPI +Y+P  L D +  +++   P + L+++WVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RA+  + FSKS+GG  L  VD++NDH +++W+W     +   K S E V  A+F+PTD+N+I TCGK+HL FW LEK +L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ AI  AH   +F+L +   GTL+SGG KD  +  WD + ++   + +++    G  RT+ E   + +++GTT N +++ + N  F  +  GH+DE+WG+  HP K QF+T GHD+ I LWD+ +H+ + +K LE + QS    P+   VA+G   G W +        +    DGNE +  I FSPDG+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WP+GSDGTDINAV  ++ K ++ T DDFGKV+L+ +P    +     Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:  202 RRVTHCKDEGYVKMYLKGRPITMYMPKDLVDTYCLETKADLPPKKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHILGNGFFDRALVCLSFSKSNGGSWLCVVDDSNDHMLSVWDWQREDRLAEVKCSNESVFAADFHPTDANIIVTCGKSHLCFWSLEKGSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAIQGAHEASVFALCMLRNGTLVSGG-KDRKLISWDENFQKI--QTVEVPELYGPVRTVAEGRGETVLIGTTKNYVLQGSLNGEFIPITQGHTDELWGLTIHPLKHQFLTCGHDKHIYLWDSDSHQPIWTKTLEDSAQSAGFHPSGATVAVGMQTGRWLVLDTESKDLVTVHTDGNEQLSVIRFSPDGNFLAIGSHDNYIYIYAVAENGKKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATFTCTLGFHVFGLWPDGSDGTDINAVCSSYAKRLLVTGDDFGKVHLFSFPCSQSRAPSHIYSGHSSHVTNVNFLFDDSHLVSTGGKDMSIMQW 837          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 334/739 (45.20%), Postives = 475/739 (64.28%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSPKA----AKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE   +   K       L  T P      ++ +  +K   S  +P   T+    PT  S   L+      F+  EG +++F+RGRP+ +Y+P    + +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  HTDD+KC+A+HPDK+T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  V FSKS+GG  L +VD++NDH +++W+W   + +   K S E V  A+F+PTD+NVI TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGN+  W +    IT A+  AH+G IF+L +   GTL+SGG KD  +  WD + ++     +++    G  RT+ E   D +++GTT N +++ T +  F+ +  GH+DE+WG+ +H  K QF+T G D++I LWDA +H+ + +K +E   QS    PN  +VAIG + G W +        +    DGNE +  + +SPDG+  A+GS DN+IYIY ++    + +R+GKCSGHSSFITHLDWS +  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WPEGSDGTD+NA+ ++ +K ++AT DDFGKV+L+ +P    + +   Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:    6 RIASLEQRVQIQEDEIQLLKSALADVVRRLNLSEEQHALQNRKGPTKARPLVQTLPLRNAVNSESILPKKPSGSLPSP-SGTKKDIVPTIVSCIYLI----FLFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQL--NKVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTLSGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQW 735          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 339/779 (43.52%), Postives = 478/779 (61.36%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDK---------------NTVTPNSL-------KLTSPKAAK-DVQLRKSMVSPRTPVKATRLSGTPTRRSTND---------------------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE   +   K               N V   S+        L SP   K D+    S  + +      R+S    R S+ D                         KE  F   EG +++F+RGRP+ +Y+P    + +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  HTDD+KC+A+HPDK+T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  V FSKS+GG  L +VD++NDH +++W+W   + +   K S E V  A+F+PTD+NVI TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGN+  W +    IT A+  AH+G IF+L +   GTL+SGG KD  +  WD + ++     +++    G  RT+ E   D +++GTT N +++ T +  F+ +  GH+DE+WG+ +H  K QF+T G D++I LWDA +H+ + +K +E   QS    PN  +VAIG + G W +        +    DGNE +  + +SPDG+  A+GS DN+IYIY ++    + +R+GKCSGHSSFITHLDWS +  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WPEGSDGTD+NA+ ++ +K ++AT DDFGKV+L+ +P    + +   Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:   38 RIASLEQRVQIQEDEIQLLKSALADVVRRLNLSEEQHALQNRKGPTKARPLVQTLPLRNAVNSESILPKKPSGSLPSPSGTKKDIVPLASKSNVKRTNSTERISSGVRRESSGDAKGGRNRAGSTSSSSSGKKNSESKPKEPMFSAEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQL--NKVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTLSGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQW 812          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 311/640 (48.59%), Postives = 437/640 (68.28%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ +Y+P    + +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  HTDD+KC+A+HPDK+T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  V FSKS+GG  L +VD++NDH +++W+W   + +   K S E V  A+F+PTD+NVI TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGN+  W +    IT A+  AH+G IF+L +   GTL+SGG KD  +  WD + ++     +++    G  RT+ E   D +++GTT N +++ T +  F+ +  GH+DE+WG+ +H  K QF+T G D++I LWDA +H+ + +K +E   QS    PN  +VAIG + G W +        +    DGNE +  + +SPDG+  A+GS DN+IYIY ++    + +R+GKCSGHSSFITHLDWS +  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WPEGSDGTD+NA+ ++ +K ++AT DDFGKV+L+ +P    + +   Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:  156 KEPMFSAEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQL--NKVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTLSGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQW 791          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 337/779 (43.26%), Postives = 479/779 (61.49%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSPKA----AKDVQLRKSMVSPRTP----------VKAT----RLSGTPTRRSTNDLVNHKEAT--------------------------FIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE   +   K       L  T P      ++ +  +K   S  +P          VK T    R+S    R S+ D    +                             F+  EG +++F+RGRP+ +Y+P    + +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  HTDD+KC+A+HPDK+T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  V FSKS+GG  L +VD++NDH +++W+W   + +   K S E V  A+F+PTD+NVI TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGN+  W +    IT A+  AH+G IF+L +   GTL+SGG KD  +  WD + ++     +++    G  RT+ E   D +++GTT N +++ T +  F+ +  GH+DE+WG+ +H  K QF+T G D++I LWDA +H+ + +K +E   QS    PN  +VAIG + G W +        +    DGNE +  + +SPDG+  A+GS DN+IYIY ++    + +R+GKCSGHSSFITHLDWS +  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WPEGSDGTD+NA+ ++ +K ++AT DDFGKV+L+ +P    + +   Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:    6 RIASLEQRVQIQEDEIQLLKSALADVVRRLNLSEEQHALQNRKGPTKARPLVQTLPLRNAVNSESILPKKPSGSLPSPSGTKKDIVPNVKRTNSTERISSGVRRESSGDAKGGRNRAGSTSSSSSGKKNSERTIVSCIYLIFLFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQL--NKVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTLSGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQW 780          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Match: ccdc81 (coiled-coil domain containing 81 [Source:Xenbase;Acc:XB-GENE-967044])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 337/784 (42.98%), Postives = 478/784 (60.97%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDK---------------NTVTPNSL-------KLTSPKAAK-DVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEAT--------------------------FIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE   +   K               N V   S+        L SP   K D+    S  + +      R+S    R S+ D    +                             F+  EG +++F+RGRP+ +Y+P    + +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  HTDD+KC+A+HPDK+T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  V FSKS+GG  L +VD++NDH +++W+W   + +   K S E V  A+F+PTD+NVI TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGN+  W +    IT A+  AH+G IF+L +   GTL+SGG KD  +  WD + ++     +++    G  RT+ E   D +++GTT N +++ T +  F+ +  GH+DE+WG+ +H  K QF+T G D++I LWDA +H+ + +K +E   QS    PN  +VAIG + G W +        +    DGNE +  + +SPDG+  A+GS DN+IYIY ++    + +R+GKCSGHSSFITHLDWS +  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WPEGSDGTD+NA+ ++ +K ++AT DDFGKV+L+ +P    + +   Y GHSSHVT V FL +D  L STGG+D +I+QW
Sbjct:   30 RIASLEQRVQIQEDEIQLLKSALADVVRRLNLSEEQHALQNRKGPTKARPLVQTLPLRNAVNSESILPKKPSGSLPSPSGTKKDIVPLASKSNVKRTNSTERISSGVRRESSGDAKGGRNRAGSTSSSSSGKKNSERTIVSCIYLIFLFVLEEGYVKMFLRGRPVTMYMPKEQVETYSLEAKGELPAKKLKLEWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGHTDDVKCLAVHPDKITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGMGFFDRAVTCVAFSKSNGGGNLCSVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFVADFHPTDTNVIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNLLVWGKGTNRITHAVQGAHDGGIFALCMQRDGTLVSGG-KDRKLVSWDGNYQQL--NKVEIPEQFGPVRTVAEGRGDVVLIGTTRNFVLQGTLSGEFNTITQGHTDELWGLAAHSLKPQFLTCGQDKQITLWDATSHRPIWTKIIEDPAQSSGFHPNGSVVAIGTLTGRWFVLDTETKDLVTVHTDGNEQLSVMCYSPDGNFLAIGSHDNYIYIYAVNENGRKYSRIGKCSGHSSFITHLDWSINSQYLMSNSGDYEILYWIPSACKQVVSVETTRDIEWVTHTCTLGFQVFGVWPEGSDGTDLNAICRSTDKKLLATGDDFGKVHLFSFPCSQFRASGHAYGGHSSHVTNVSFLYDDRHLISTGGKDMSIMQW 809          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 345/786 (43.89%), Postives = 471/786 (59.92%), Query Frame = 3
Query:  108 MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKN--------------------TVTPN--SLKLTSPKAAKDVQLRKSMVSPRTPV-----KATRLSGTPTRRSTND---------------------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  +I  LE+    Q ++I  LK+ L D + R+   EE + V   K                     TV P   S  L +P  A     RK +V P T        + R+S    R S+ D                         KE  F   EG +++F+RGRP+ +Y+P    D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W+ + ++      ++    G  RT+ E    ++ +GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH + ++ T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:   34 VSDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTLPLRTTVNNGTVLPKKPSASLPAPSGA-----RKEVVVPVTKSINRTSSSERVSPGGRRESSGDSKGSRNRTGSTSSSSSGKKNSESKPKEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKL--HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 811          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 345/786 (43.89%), Postives = 471/786 (59.92%), Query Frame = 3
Query:  108 MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKN--------------------TVTPN--SLKLTSPKAAKDVQLRKSMVSPRTPV-----KATRLSGTPTRRSTND---------------------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  +I  LE+    Q ++I  LK+ L D + R+   EE + V   K                     TV P   S  L +P  A     RK +V P T        + R+S    R S+ D                         KE  F   EG +++F+RGRP+ +Y+P    D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W+ + ++      ++    G  RT+ E    ++ +GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH + ++ T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:    3 VSDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTLPLRTTVNNGTVLPKKPSASLPAPSGA-----RKEVVVPVTKSINRTSSSERVSPGGRRESSGDSKGSRNRTGSTSSSSSGKKNSESKPKEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKL--HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 780          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 335/789 (42.46%), Postives = 482/789 (61.09%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTV---TPNSLKLTSP--KAAKDVQLRKSM-------------VSPRTPVKATRLSGTPTRR--------------------------STNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKP---HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            ME+++     ++  LE+    Q +E+  LK  L D L R+ A EE     + ++T     P  L  T+   +  K +  R  +              SP +P K    SG  +RR                          S       KE  F   EG +++F+RGRP+ + +P+ LA  +   ++ + P   L+++WVYGYRG+DCR NLY LPTG++VYFVA + +L+++  Q QRHY+ H DDIKC+A+HPD VT ATGQVAG +K EGKP   HVR+W S++L TLH +GLG F+RAV  V FSKS+GG LL  VDE+NDH +++W+WA    +  SK S E V+ A F+PTD +++ TCGK+H+ FW LE  +L+K+  +FEK+EKPK+  CVTF   G+++TGDS GN+Y W +    IT  +  AH+G +F+L     GTL+SGGG+D  +  W   +     + +++  D G  RT+ E   D L VGTT N+I+  + + GF  L+ GH +E+WG+ +HPS+ QFVT G D+ + LW + TH+ + S+ +E   +S    P+  ++A+G + G W +        +    DGNE I  + FSPDG+  AVGS DN +Y+Y +D    +V+R+GKCSGHSSFITHLDW+ D     +NSGDYE+L+W+   CKQ+T+A T+ +V W +A C L F V GIWPEG+DGTDINAV ++H+  ++ +ADDFGKV+L+ YP C P+    KY GHSSHVT V FL +D    +TGG+DT+++QW
Sbjct:   59 MEVDD-----RVSALEQRLQLQEDELAVLKAALADALRRLRACEEQGAALRARSTPKGRAPPRLGTTASVCQLLKGLPTRTPLNGSGPPRRVGGYATSPSSPKKEAS-SGRSSRRYLSPERLASVRREDPRSRTTSSSSNCSAKKEGKTKEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLW--GSDYSKVQEVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQW 838          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml1 (echinoderm microtubule associated protein like 1 [Source:MGI Symbol;Acc:MGI:1915769])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 426/640 (66.56%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  T  K EG +++F+RGRP+ +Y+P    D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W+ + ++      ++    G  RT+ E    ++ +GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH + ++ T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:  161 RRVTHCKEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKL--HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 797          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Match: Eml2 (echinoderm microtubule associated protein like 2 [Source:MGI Symbol;Acc:MGI:1919455])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 305/640 (47.66%), Postives = 434/640 (67.81%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKP---HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ + +P+ LA  +   ++ + P   L+++WVYGYRG+DCR NLY LPTG++VYFVA + +L+++  Q QRHY+ H DDIKC+A+HPD VT ATGQVAG +K EGKP   HVR+W S++L TLH +GLG F+RAV  V FSKS+GG LL  VDE+NDH +++W+WA    +  SK S E V+ A F+PTD +++ TCGK+H+ FW LE  +L+K+  +FEK+EKPK+  CVTF   G+++TGDS GN+Y W +    IT  +  AH+G +F+L     GTL+SGGG+D  +  W   +     + +++  D G  RT+ E   D L VGTT N+I+  + + GF  L+ GH +E+WG+ +HPS+ QFVT G D+ + LW + TH+ + S+ +E   +S    P+  ++A+G + G W +        +    DGNE I  + FSPDG+  AVGS DN +Y+Y +D    +V+R+GKCSGHSSFITHLDW+ D     +NSGDYE+L+W+   CKQ+T+A T+ +V W +A C L F V GIWPEG+DGTDINAV ++H+  ++ +ADDFGKV+L+ YP C P+    KY GHSSHVT V FL +D    +TGG+DT+++QW
Sbjct:   10 KEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPSLLITCGKSHIYFWSLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVQGAHDGGVFALCALRDGTLVSGGGRDRRVVLW--GSDYSKVQEVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDPVTCKQITSADTVRNVEWATATCVLGFGVFGIWPEGADGTDINAVARSHDGKLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQW 646          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q4V8C3|EMAL1_RAT (Echinoderm microtubule-associated protein-like 1 OS=Rattus norvegicus OX=10116 GN=Eml1 PE=1 SV=2)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 351/793 (44.26%), Postives = 475/793 (59.90%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKN--------------------TVTPN--SLKLTSPKAAKDVQLRKSMVSPRTPV-----KATRLSGTPTRRSTND---------------------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            MEI +     +I  LE+    Q ++I  LK+ L D + R+   EE + V   K                     TV P   S  L SP  +     RK MV P T        + R+S    R S+ D                         KE TF   EG +++F+RGRP+ +Y+P    D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W+ + ++      ++    G  RT+ E    ++ +GTT N +++ T    F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:   32 MEISD-----RIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTLPLRTTVNNGTVLPKKPSASLPSPSGS-----RKEMVVPVTKSINRTSSSERVSPGGRRESSGDSKGSRNRTGSTSSSSSGKKNSESKPKEPTFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGSHLCAVDDSNDHVLSVWDWQREERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKL--HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLTGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 811          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|O00423|EMAL1_HUMAN (Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 346/779 (44.42%), Postives = 467/779 (59.95%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSP------------KAAKDVQLRKSMVSPRTPVKAT-----------RLSGTPTRRSTNDLVNH---------------------KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q ++I  LK+ L D + R+   EE + V   K       L  T P            K         S V   T V AT           R+S    R S  D   +                     KE  F   EG +++F+RGRP+ +Y+P    D +  +++++ P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE ++L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W  S   +  R  ++    G  RT+ E   D +++GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH K +++T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:   37 RIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISW--SGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 812          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q05BC3|EMAL1_MOUSE (Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 345/786 (43.89%), Postives = 471/786 (59.92%), Query Frame = 3
Query:  108 MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKN--------------------TVTPN--SLKLTSPKAAKDVQLRKSMVSPRTPV-----KATRLSGTPTRRSTND---------------------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  +I  LE+    Q ++I  LK+ L D + R+   EE + V   K                     TV P   S  L +P  A     RK +V P T        + R+S    R S+ D                         KE  F   EG +++F+RGRP+ +Y+P    D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ VYF+A +V+L+N+  Q QRHY  H DD+KC+A+HPD++T ATGQVAG SK +GK   PHVRIW S+TL TLH IG+GFF+RAV  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V  A+F+PTD+N+I TCGK+HL FW LE N+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH G IF+L +   GTL+SGGGKD  +  W+ + ++      ++    G  RT+ E    ++ +GTT N +++ T +  F  +  GH+DE+WG+  H SK QF+T GHD+   LWDA+ H+ +  K +E   QS    P+  +VA+G + G W +        +    DGNE +  + +SPDG+  A+GS DN IYIY +     + TRVGKCSGHSSFITHLDWS +  FL SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F V G+WPEGSDGTDINAV +AH + ++ T DDFGKV+L+ YP    +     Y GHSSHVT V FL ED  L STGG+DT+I+QW
Sbjct:   34 VSDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTLPLRTTVNNGTVLPKKPSASLPAPSGA-----RKEVVVPVTKSINRTSSSERVSPGGRRESSGDSKGSRNRTGSTSSSSSGKKNSESKPKEPAFSPEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKAELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSK-DGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGGHLCAVDDSNDHVLSVWDWQKEERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGNSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRRLISWNGNYQKL--HKAEIPEQFGPIRTVAEGKGNVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVTDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHERKLLCTGDDFGKVHLFSYPCSQFRAPSHIYSGHSSHVTNVDFLCEDSHLISTGGKDTSIMQW 811          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|Q6P6T4|EMAL2_RAT (Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 305/640 (47.66%), Postives = 434/640 (67.81%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKP---HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   EG +++F+RGRP+ + +P+ LA  +   ++ + P   L+++WVYGYRG+DCR NLY LPTG++VYFVA + +L+++  Q QRHY+ H DDIKC+A+HPD VT ATGQVAG +K EGKP   HVR+W S++L TLH +GLG F+RAV  V FSKS+GG LL  VDE+NDH +++W+WA    +  SK S E V+ A F+PTD N++ TCGK+H+ FW LE   L+K+  +FEK+EKPK+  CVTF   G+++TGDS GN+Y W +    IT  +  AH+G +F+L     GTL+SGGG+D  +  W   +     + +++  D G  RT+ E   D L VGTT N+I+  + + GF  L+ GH +E+WG+ +HPS+ QFV+ G D+ + LW + TH+ + S+ +E   +S    P+  ++A+G + G W +        +    DGNE I  + FSPDG+  AVGS DN +Y+Y +D    +V+R+GKCSGHSSFITHLDW+ D     +NSGDYE+L+W+   CKQ+T+A T+ +V W +A C L F V GIWPEG+DGTDINAV ++H+  ++ +ADDFGKV+L+ YP C P+    KY GHSSHVT V FL +D  + +TGG+DT+++QW
Sbjct:   10 KEVIFSMEEGSVKMFLRGRPVPMLIPDELAPTYSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAVHPDMVTIATGQVAGTTK-EGKPLPPHVRVWDSVSLSTLHVLGLGVFDRAVCCVAFSKSNGGNLLCAVDESNDHVLSVWDWAKESKVVDSKCSNEAVLVATFHPTDPNLLITCGKSHIYFWSLEGGNLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQEVLGAHDGGVFALCALRDGTLVSGGGRDRRVVLW--GSDYSKVQEVEVPEDFGPVRTVAEGRGDTLYVGTTRNSILLGSVHTGFSLLVQGHVEELWGLATHPSRAQFVSCGQDKLVHLWSSETHQPVWSRSIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTDTRDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSTCFVTNSGDYEILYWDAATCKQITSADTVRNVQWATATCVLGFGVFGIWPEGADGTDINAVARSHDGNLLVSADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMVLTTGGKDTSVLQW 646          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Match: sp|O95834|EMAL2_HUMAN (Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 307/640 (47.97%), Postives = 433/640 (67.66%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKP---HVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE  F   +G +++F+RGRP+ + +P+ LA  +   ++ + P   L++EWVYGYRG+DCR NLY LPTG+IVYFVA + +L+++  Q QRHY+ H DDIKC+A+HPD VT ATGQVAG +K EGKP   HVRIW S++L TLH +GLG F+RAV  VGFSKS+GG LL  VDE+NDH +++W+WA    +   K S E V+ A F+PTD  V+ TCGK+H+ FW LE  +L+K+  +FEK+EKPK+  CVTF   G+++TGDS GN+Y W +    IT A+  AH+G +F L     GTL+SGGG+D  +  W   +     + +++  D G  RT+ E   D L VGTT N+I++ + + GF  L+ GH +E+WG+ +HPS+ QFVT G D+ + LW + +H+ L S+ +E   +S    P+  ++A+G + G W +        +    DGNE I  + FSPDG+  AVGS DN +Y+Y +D    +V+R+GKCSGHSSFITHLDW+ D     +NSGDYE+L+W+   CKQ+T+A  + ++ W +A C L F V GIW EG+DGTDINAV ++H+  ++A+ADDFGKV+L+ YP C P+    KY GHSSHVT V FL +D    +TGG+DT+++QW
Sbjct:   10 KEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTK-EGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLW--GSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSHDNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLFSYPCCQPRALSHKYGGHSSHVTNVAFLWDDSMALTTGGKDTSVLQW 646          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IDM8 (echinoderm microtubule-associated protein-like 2 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 357/800 (44.62%), Postives = 513/800 (64.12%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVT-----PNSLKLTS-PKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRST-----------------------------NDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGH---------SKVEGK----------PHVRIWSSLTLQTLHTIGLGF-FERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXX---XXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            ++ EN+ +++++  LEK   +  +E+  LK+ L D L RIA+LE  +      N +      P   +++S P +A D + +++    +  V  TR +  P +R+                              N  ++ KE TF K EG LR+++RGRP+ LY P    + +D   +  +P +SL++EWVYGYRG+DCR N++ LPTG+ VYFVAG+V+L+N+  Q QRHY+ HTDD+KC+A+HPDK+T ATGQVAGH         S   GK          PHVR+W+S++LQTLH +GLG  F+RAV ++GFSK+DGG+LL  VDE N+H +++W W   +       +KSSTEPV+ +EF+P D+N I TCGKN + FW LE   L KK+ +FEK+EKPKF  C+   +NG++ TGDS+GNI+ W R    I+ A+T  H G IFSLL ++ G LLSGGGKD  I +WD +   + G  +++    G  RT+ +   + +VVG+T N I++ T    F+ ++ GH DE+WG+  HP++ QF+T  +D+K+ LWDAL+H  + SK+LE         P+A +VAIG     W +  +T  + ++   DGNE I+C E+SPDG   A+GSRDN IY+Y +D E  + +RVGKC GHSSF+THLDWS+D  +++SNSGDYELLFWN   CKQ+TA+S++ DV W ++ CT++F   GIWPEG+DGTD+N  ++AH   ++A+ADD+GKVNLYRYP+   +  H+ Y GHSSHVT V+FL +D RL STGG+D  I+QW
Sbjct:   39 LDHENEELRERVSALEKKVHQNEDEMLCLKSALADALRRIASLESGRTAGLTNNVLPSKPFKPQPRRVSSAPVSAADSRSKRAGSVEQAFV--TRDTAPPQKRAPTPTPKAPPSPSPTSLKKWSSLSSAEFQGGNLQMSSKETTFNKEEGYLRMYLRGRPVTLYAPT--LEEYDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTGE-VEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELNFNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQW 833          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IBB1 (echinoderm microtubule-associated protein-like 2 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 330/655 (50.38%), Postives = 461/655 (70.38%), Query Frame = 3
Query:  369 TRRSTNDLVNH--KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGH-SKVEGKPHVRIWSSLTLQTLHTIGLGF-FERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXX---XXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            TR +    + H  KE TF K EG LR+++RGRP+ LY P    + +D   +  +P +SL++EWVYGYRG+DCR N++ LPTG+ VYFVAG+V+L+N+  Q QRHY+ HTDD+KC+A+HPDK+T ATGQVAGH +K   +PHVR+W+S++LQTLH +GLG  F+RAV ++GFSK+DGG+LL  VDE N+H +++W W   +       +KSSTEPV+ +EF+P D+N I TCGKN + FW LE   L KK+ +FEK+EKPKF  C+   +NG++ TGDS+GNI+ W R    I+ A+T  H G IFSLL ++ G LLSGGGKD  I +WD +   + G  +++    G  RT+ +   + +VVG+T N I++ T    F+ ++ GH DE+WG+  HP++ QF+T  +D+K+ LWDAL+H  + SK+LE         P+A +VAIG     W +  +T  + ++   DGNE I+C E+SPDG   A+GSRDN IY+Y +D E  + +RVGKC GHSSF+THLDWS+D  +++SNSGDYELLFWN   CKQ+TA+S++ DV W ++ CT++F   GIWPEG+DGTD+N  ++AH   ++A+ADD+GKVNLYRYP+   +  H+ Y GHSSHVT V+FL +D RL STGG+D  I+QW
Sbjct:  188 TRATDRKAMAHRRKETTFNKEEGYLRMYLRGRPVTLYAPT--LEEYDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTG-EVEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELNFNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQW 839          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A564YMH5 (WD_REPEATS_REGION domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7649 PE=4 SV=1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 350/808 (43.32%), Postives = 495/808 (61.26%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNS------------------LKLTSPKAAKDVQLRKSMV------SPRTPVKATRLSGTPTRRS---------------------TNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSP---------------------NADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            M  E D + +++  LEK +  QA E+T LK+ L DCL R+  LE S+  +     + P +                  + L+     + V    S V      S R P +A+  SG PT  S                     +N     +E T+++ EGIL++++RGR +NLY P  +A  +DF + + EP+E L++EWVYGYRGKDCR N+Y LPTG+I+YF+A +V+L+NL   +QRHY+EH DDIKC+A+HPD++T ATGQ AGH K +GKPHVRIW+S++L+TLH IGLG FE +VA + FSK+DGG +L  +DEA +H IT+W+W  ++ I  +K+ST+PVI  +FNP D+N + T GKNHLAFW +E N+L KK  I++KYEKPKF   + F  NG+LITGDS+GNI+ W+R    I+ A+   H G IF+L  ++ G LLSGGGKD  I + D +  +  G  ++LS+  G  RT++    D ++VGTT   I+     + F  L+ GHSDE W + +HP    F+T G D  + LWD+LT +++ ++ L + +   +  P                     +  +VA+G   G W +      + I    + +EPIQCI +SP+G   A+G RDN IY+Y +     +  R GKC GHSSF+ HLDWS D  ++RS SGDYELLFW+    KQ+T+ S++ DV W + +C L FEVAGI+P  SDGTDINAV ++H+  ++A+ADDFG+V L+RYP C  K   + Y+GHSSHVT V FL +D R+ S GG DTAI+QW
Sbjct:   12 MNTERDELLERVAYLEKRTSDQAEELTCLKSALADCLRRVQLLESSRGTHSPTRRIAPRTASESRAIRAGTAIGGSRQMALSGSGGGRHVPRLPSNVNAGVPISQRPPSQASLRSGNPTSPSSTATAPPGFKGSSGTIGRPPTSNSKGGTREPTYLRDEGILKMYLRGRCLNLYAPTDIASDYDFSATLPEPEEQLKLEWVYGYRGKDCRNNVYLLPTGEIIYFIAAVVVLYNLEQHSQRHYLEHNDDIKCLAVHPDRITIATGQTAGHGKCDGKPHVRIWNSVSLETLHVIGLGIFESSVACLAFSKTDGGSVLAVIDEAANHTITVWDWQKSRRIAETKTSTDPVIAVDFNPIDANSLVTIGKNHLAFWTIESNSLNKKQGIYDKYEKPKFVLSMVFAENGDLITGDSNGNIFLWTRGSNKISHAVLGVHVGGIFALTFTKDGHLLSGGGKDCRIVQLD-TNLDPTGVVVELSSWYGPVRTLISGPGDMIIVGTTQGDILLGRLGEDFSALVQGHSDEFWALSAHPQSHHFLTAGRDGNVYLWDSLTRRLVWAENLSEELICAAFYPPIAPSSPTTNHNGRNDHDLADSVPVVAVGTASGRWIVLDALLHQVIAAHHESDEPIQCIAYSPNGQYIAIGGRDNSIYVYSVSGRGTKYVRSGKCLGHSSFVLHLDWSEDSQYIRSVSGDYELLFWSASNSKQITSPSSMRDVRWVTQSCHLGFEVAGIFPPDSDGTDINAVCRSHSTSVLASADDFGQVKLFRYPTCQLKNKSRSYRGHSSHVTNVDFLFDDSRVISAGGADTAILQW 818          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IBB6 (echinoderm microtubule-associated protein-like 2 isoform X7 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 332/673 (49.33%), Postives = 461/673 (68.50%), Query Frame = 3
Query:  369 TRRSTNDLVNH--KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGH---------SKVEGK----------PHVRIWSSLTLQTLHTIGLGF-FERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXX---XXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            TR +    + H  KE TF K EG LR+++RGRP+ LY P    + +D   +  +P +SL++EWVYGYRG+DCR N++ LPTG+ VYFVAG+V+L+N+  Q QRHY+ HTDD+KC+A+HPDK+T ATGQVAGH         S   GK          PHVR+W+S++LQTLH +GLG  F+RAV ++GFSK+DGG+LL  VDE N+H +++W W   +       +KSSTEPV+ +EF+P D+N I TCGKN + FW LE   L KK+ +FEK+EKPKF  C+   +NG++ TGDS+GNI+ W R    I+ A+T  H G IFSLL ++ G LLSGGGKD  I +WD +   + G  +++    G  RT+ +   + +VVG+T N I++ T    F+ ++ GH DE+WG+  HP++ QF+T  +D+K+ LWDAL+H  + SK+LE         P+A +VAIG     W +  +T  + ++   DGNE I+C E+SPDG   A+GSRDN IY+Y +D E  + +RVGKC GHSSF+THLDWS+D  +++SNSGDYELLFWN   CKQ+TA+S++ DV W ++ CT++F   GIWPEG+DGTD+N  ++AH   ++A+ADD+GKVNLYRYP+   +  H+ Y GHSSHVT V+FL +D RL STGG+D  I+QW
Sbjct:  160 TRATDRKAMAHRRKETTFNKEEGYLRMYLRGRPVTLYAPT--LEEYDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTGE-VEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELNFNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQW 829          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Match: A0A1S3IBK7 (echinoderm microtubule-associated protein-like 2 isoform X8 OS=Lingula unguis OX=7574 GN=LOC106162713 PE=4 SV=1)

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 332/673 (49.33%), Postives = 461/673 (68.50%), Query Frame = 3
Query:  369 TRRSTNDLVNH--KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGH---------SKVEGK----------PHVRIWSSLTLQTLHTIGLGF-FERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXX---XXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            TR +    + H  KE TF K EG LR+++RGRP+ LY P    + +D   +  +P +SL++EWVYGYRG+DCR N++ LPTG+ VYFVAG+V+L+N+  Q QRHY+ HTDD+KC+A+HPDK+T ATGQVAGH         S   GK          PHVR+W+S++LQTLH +GLG  F+RAV ++GFSK+DGG+LL  VDE N+H +++W W   +       +KSSTEPV+ +EF+P D+N I TCGKN + FW LE   L KK+ +FEK+EKPKF  C+   +NG++ TGDS+GNI+ W R    I+ A+T  H G IFSLL ++ G LLSGGGKD  I +WD +   + G  +++    G  RT+ +   + +VVG+T N I++ T    F+ ++ GH DE+WG+  HP++ QF+T  +D+K+ LWDAL+H  + SK+LE         P+A +VAIG     W +  +T  + ++   DGNE I+C E+SPDG   A+GSRDN IY+Y +D E  + +RVGKC GHSSF+THLDWS+D  +++SNSGDYELLFWN   CKQ+TA+S++ DV W ++ CT++F   GIWPEG+DGTD+N  ++AH   ++A+ADD+GKVNLYRYP+   +  H+ Y GHSSHVT V+FL +D RL STGG+D  I+QW
Sbjct:  151 TRATDRKAMAHRRKETTFNKEEGYLRMYLRGRPVTLYAPT--LEEYDLAKKEDQPPQSLKLEWVYGYRGRDCRSNVHLLPTGETVYFVAGVVVLYNVEEQIQRHYLGHTDDVKCLAVHPDKITIATGQVAGHDNKKSSRPKSAQHGKGDPSTAPDHLPHVRVWNSVSLQTLHILGLGGDFDRAVCSIGFSKADGGQLLCAVDEGNEHTLSVWEWQKGEKGHKITETKSSTEPVVASEFHPLDANTIITCGKNQITFWTLEGGTLGKKLGLFEKHEKPKFVLCLAIADNGDVFTGDSNGNIFIWPRGTNKISKALTGVHEGGIFSLLFTKDGHLLSGGGKDRRIVQWDATGLTQTG-EVEIPEHYGAVRTLTQGKGNMIVVGSTRNVILQGTLELNFNPIVQGHVDELWGLAVHPNQHQFLTCAYDKKVFLWDALSHSAVWSKELEVPAHCACFHPDAQVVAIGTQTAKWLVLDLTSREPVYSHTDGNEQIECAEYSPDGKYLALGSRDNHIYVYSVDEEGKKYSRVGKCQGHSSFVTHLDWSADSQYIQSNSGDYELLFWNASSCKQITASSSMRDVQWATSYCTISFNTCGIWPEGADGTDVNGSSRAHKADLLASADDYGKVNLYRYPSTHIEAGHRAYGGHSSHVTAVRFLHDDSRLLSTGGKDAGILQW 820          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 299/640 (46.72%), Postives = 440/640 (68.75%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE T    +G +R+F+RGRP+ +++P+ L DG++  +++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N++ Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH+IG+G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+HL FW +E + LTK+  +FEK+EKPK+  CV F  NG+ ITGDSSGNIY W++    I+  +  AH G IFS+ + + G L+SGGGKD  +  WD    +++   +++   +G  RT+ E   ++L VGTT NA+++ + +     ++ GH+DE+WG+D HP  +QFVT G D+++ LWD  +H+ L SK +E   +S+   P+  ++A+G +   W +        I    DGNE I  I++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS++  ++ +NSGDYE+L+W     K +T+A  + ++ W ++ C L F V GIWP+G+DGTDINAV +++++ ++A  DDFGKV+L+ YP   P+     Y GHSSHVT V FL ++  L STGG+DT+I+QW
Sbjct:  167 KECTLNAEDGYVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSK-DGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQS--EMEVPEAHGPVRTLAEGKQEELFVGTTRNAVLQGSFSGTLKPIVQGHTDELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 803          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 299/640 (46.72%), Postives = 440/640 (68.75%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE T    +G +R+F+RGRP+ +++P+ L DG++  +++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N++ Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH+IG+G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+HL FW +E + LTK+  +FEK+EKPK+  CV F  NG+ ITGDSSGNIY W++    I+  +  AH G IFS+ + + G L+SGGGKD  +  WD    +++   +++   +G  RT+ E   ++L VGTT NA+++ + +     ++ GH+DE+WG+D HP  +QFVT G D+++ LWD  +H+ L SK +E   +S+   P+  ++A+G +   W +        I    DGNE I  I++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS++  ++ +NSGDYE+L+W     K +T+A  + ++ W ++ C L F V GIWP+G+DGTDINAV +++++ ++A  DDFGKV+L+ YP   P+     Y GHSSHVT V FL ++  L STGG+DT+I+QW
Sbjct:  145 KECTLNAEDGYVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSK-DGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQS--EMEVPEAHGPVRTLAEGKQEELFVGTTRNAVLQGSFSGTLKPIVQGHTDELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 781          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 333/776 (42.91%), Postives = 467/776 (60.18%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPN----SLKLTSPKAAKDVQLRKSMVSP-------RTPVKATRLSGT-------PTRR--STNDLVN---------------------HKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE + +   K          +L L        V  +K++ SP        TP   + +  T       PT R  S  D  N                      +E  F   EG ++++++GRPI +Y+P  L D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ +YF+A +V+L+N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RA+  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V   +F+PTD+N I TCGK+HL FW LEKN+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH   + +L +   GTLLSGG KD  I  WD + ++   + +++    G  RT+ E   + +++GTT N +++ + +  F  +  GH+DE+WG+  HP K QF+T GHD+ + LWD   H+ L +K +E   QS    P+   VAIG   G W +        +    DGNE I  + FSPDG+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W S  CTL+F V G+WP+GSDGTD+NAV +++   ++AT DDFGKV+L+ +P    +     Y GHSSHVT V FL  D  L STGG+D +++QW
Sbjct:  130 RIASLEQRVQMQEDEIQLLKSALADVVRRLNISEEQQALLNRKGPTKARPMIAALPLRPTVNNGTVLPKKTLPSPSGSKKDNNTPATKSTVKRTSSSEQVGPTSRKDSAGDAKNNRTRTGSTGSNSSSKRSSESKQREPVFSAEEGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKI--QTVEIPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDGEFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQW 901          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml1 (EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 317/707 (44.84%), Postives = 454/707 (64.21%), Query Frame = 3
Query:  201 RIAALEESKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            RIA+LE+  ++ +D+  +  ++L         DV +R+  +S        R    PT+ +   ++  K    ++ EG ++++++GRPI +Y+P  L D +  +++ + P + L++EWVYGYRG+DCR NLY LPTG+ +YF+A +V+L+N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RA+  + FSKS+GG  L  VD++NDH +++W+W   + +   K S E V   +F+PTD+N I TCGK+HL FW LEKN+L KK  +FEK EKPKF  CVTF+ NG+ ITGDSSGNI  W +    I+ A+  AH   + +L +   GTLLSGG KD  I  WD + ++   + +++    G  RT+ E   + +++GTT N +++ + +  F  +  GH+DE+WG+  HP K QF+T GHD+ + LWD   H+ L +K +E   QS    P+   VAIG   G W +        +    DGNE I  + FSPDG+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W S  CTL+F V G+WP+GSDGTD+NAV +++   ++AT DDFGKV+L+ +P    +     Y GHSSHVT V FL  D  L STGG+D +++QW
Sbjct:   39 RIASLEQRVQMQEDEIQLLKSALA--------DV-VRRLNISEEQQALLNRKG--PTKVTLKSVLLCKSVALVE-EGYVKMYLKGRPITMYLPKDLVDSYCLEAKAELPVKKLKLEWVYGYRGRDCRSNLYLLPTGETLYFIASVVVLYNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHVLGSGFFDRALVCLSFSKSNGGSWLCVVDDSNDHVLSVWDWQREERLAEVKCSNESVFATDFHPTDANTIVTCGKSHLYFWSLEKNSLVKKQGLFEKQEKPKFVLCVTFSENGDAITGDSSGNILVWGKGSNRISLAVQAAHESSVLALCMLRNGTLLSGG-KDRRITAWDGNYQKI--QTVEIPEVYGPIRTVAEGRGETVLIGTTKNYVLQGSLDGEFTPITQGHTDELWGLAVHPLKHQFLTCGHDKLVCLWDCDQHQPLWTKTMEDAAQSAGFHPSGATVAIGTQTGRWLVLDTETKDLVTMHTDGNEQISVMSFSPDGNFLAIGSHDNYIYIYAVSENGRKYSRVGKCSGHSSFITHLDWSVDSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIPWSSFTCTLSFHVFGLWPDGSDGTDVNAVCRSNETRLLATGDDFGKVHLFSFPCSQSRAPSHMYGGHSSHVTNVHFLFNDSHLVSTGGKDMSVMQW 729          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Match: eml2 (echinoderm microtubule-associated protein-like 2 [Source:NCBI gene;Acc:103040481])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 297/634 (46.85%), Postives = 438/634 (69.09%), Query Frame = 3
Query:  420 KGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            K +G +R+F+RGRP+ +++P+ L DG++  +++  P+  L+++WVYGYRG+DCR NLY LPTG+IVYF A +V+L+N++ Q QRHY+ H DD+KC+A+HPD VT ATGQVAG SK +GK   PHVR+W S++L TLH+IG+G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P ++N+I TCGK+HL FW +E + LTK+  +FEK+EKPK+  CV F  NG+ ITGDSSGNIY W++    I+  +  AH G IFS+ + + G L+SGGGKD  +  WD    +++   +++   +G  RT+ E   ++L VGTT NA+++ + +     ++ GH+DE+WG+D HP  +QFVT G D+++ LWD  +H+ L SK +E   +S+   P+  ++A+G +   W +        I    DGNE I  I++SPDG+  AVGS DNF+YIY +     + +RVGKC+GHSSF+THLDWS++  ++ +NSGDYE+L+W     K +T+A  + ++ W ++ C L F V GIWP+G+DGTDINAV +++++ ++A  DDFGKV+L+ YP   P+     Y GHSSHVT V FL ++  L STGG+DT+I+QW
Sbjct:   14 KCDGYVRMFLRGRPVTMHIPDQLRDGYNLDNKVALPERKLKLQWVYGYRGRDCRSNLYLLPTGEIVYFNASVVVLYNVDEQQQRHYLGHNDDVKCLAVHPDMVTIATGQVAGTSK-DGKLLAPHVRVWDSVSLNTLHSIGMGVFDRAVTCVAFSKSNGGAHLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLGAVFHPMEANLIVTCGKSHLNFWTVEGSTLTKRQGLFEKHEKPKYVLCVAFAENGDAITGDSSGNIYIWAKGGNKISQVVAGAHEGGIFSVCVLKDGRLVSGGGKDRKVVLWDHEYHKQS--EMEVPEAHGPVRTLAEGKQEELFVGTTRNAVLQGSFSGTLKPIVQGHTDELWGLDVHPGADQFVTCGQDKQVHLWDTDSHQPLWSKTIEDPGRSVGFHPSGTVLAVGTMTARWLVLDTDTRDLISMHTDGNEIISVIKYSPDGAYLAVGSHDNFVYIYSVTENGRKYSRVGKCTGHSSFVTHLDWSTNSQYIVTNSGDYEILYWEASSGKHVTSADVVRNLEWATSTCVLGFNVFGIWPDGADGTDINAVCRSNDRGVLAAGDDFGKVHLFSYPCSQPRAPSHVYGGHSSHVTNVAFLHDNSHLISTGGKDTSILQW 644          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001632.1 (pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-1 gene:ENSPMAG00000001473.1 transcript:ENSPMAT00000001632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 290/641 (45.24%), Postives = 409/641 (63.81%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREK-RSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            KE TF K +G +R+++RGRPI +++P    +G+   ++++ P E L +EW YGYRGKDCR N+  LP+G++V+FVA + +L ++ +  QRHY+ H DDIKCMA+HPDKV  ATGQV G SK +GK    HVR+WSS +L+TLH IG G F+R V  + FS++ GG LL  VD+ N+  I++WNW     +  SK S E V  A+F+P + NVI TCGKN++ FW L+   L+KK  IFEK+EKPK   C+ + +NG+ ++GDSSGNIY W +     IT AIT  H   + +L     GT +SGG   H +F WD S  EK G + ++  D G  R++ +  D    VGTT N I++ + +  F  ++ GH+DE+WG+  H +++ F+T   D++ ILW++ TH+    K L+  +QS    P+  +VAIG     W +  +   KE+H    GNE I  + +SPDGS  AVGS DNFIY+Y +  E  +   VGKC+GHSSF+THLDWS++G FL SNSGDYE L+W    CKQ+TA +T+ DV W +  C L F   G+W EG+DGTDINA+ ++ +  +    DDFGKV L+R  A  P+     Y GH SHVT V F  +D  + +TGG+D  ++QW
Sbjct:    9 KEPTFNKEDGYVRMYLRGRPITMFMPQDAVEGYKIGAKLELPAEKLSLEWAYGYRGKDCRANVELLPSGELVFFVAAVGVLQHVESGVQRHYLGHDDDIKCMAVHPDKVIVATGQVVGKSK-DGKVLPAHVRVWSSASLETLHLIGGGVFDRGVLCISFSRAGGGGLLCAVDDGNEKMISVWNWKKETKVTDSKCSNEVVYSADFHPKEENVIVTCGKNNINFWALDGRNLSKKQGIFEKHEKPKHVLCLIYLDNGDAVSGDSSGNIYVWGKAGGYRITRAITGVHASGVMALCERADGTFISGGRDGHVVF-WD-SKMEKTGES-RIPKDLGTVRSLADGADGSFWVGTTENGILQGSAHGEFSPVVQGHTDELWGLAVHQNQDAFLTCAQDKQAILWNSATHRPTWIKTLKDPLQSADFHPSGKVVAIGTQAASWLVLDLKTQKELHHESAGNEQIAVMRYSPDGSHLAVGSNDNFIYVYSVSEEGHKYNAVGKCTGHSSFVTHLDWSTNGEFLMSNSGDYETLYWTPANCKQVTAMATVRDVEWATMTCVLGFSTFGVWSEGADGTDINALCRSGSGKLCVLGDDFGKVRLFRSSAFQPRSPSHAYGGHCSHVTNVAFSSDDSFVFTTGGKDMGVLQW 645          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006636.1 (pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1 gene:ENSPMAG00000005975.1 transcript:ENSPMAT00000006636.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.138 bits (775), Expect = 1.747e-94
Identity = 134/273 (49.08%), Postives = 192/273 (70.33%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVY-GYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSR 1208
            K+  +   EG +++++RGRPI +Y+P  + + +   ++++ P E L++ WVY GYRGKDCR NLY LPTG++VYF+A +V+L++     QRHY+EH DD+KC+A+HPD++T ATGQV G  K +GK    HVR+W S++L+TLH IG G FER +  + FSK++ G LL  VD+ N+H +++W+W     +   K S E V  A+F+P D   I TCGK+H+ FW LE N+L+KK  IFEK++KPK+  CVTF  NG+ ITGDSSGNI+ W R
Sbjct:  169 KDPVYNYEEGYVKMYLRGRPITMYLPQDMVEDYRLDTKLEPPAEKLKLNWVYYGYRGKDCRNNLYLLPTGEMVYFIASVVVLYSPEEGNQRHYLEHNDDVKCLAIHPDRITIATGQVVGTGK-DGKTLPAHVRVWDSVSLKTLHVIGTGVFERGILCLAFSKTNCG-LLCAVDDGNEHVLSVWDWQQGNKLADIKCSNEAVFAADFHPMDPRAIVTCGKSHVHFWTLEGNSLSKKQGIFEKHDKPKYVLCVTFAENGDAITGDSSGNIFVWGR 439          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002683.1 (pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene:ENSPMAG00000002451.1 transcript:ENSPMAT00000002683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 274.248 bits (700), Expect = 2.378e-85
Identity = 132/316 (41.77%), Postives = 190/316 (60.13%), Query Frame = 3
Query: 1494 GHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLE----------------------------KNIQ-------------SISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEV---AGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            GH+DE+WG++ HPS+++F T  +D+++ +WD  +H+++ SK +E                            KNIQ             S    P   +VA+G  +G W++        +    DG E +  + +SPDGS+ A+GS +NFI+++ +  +    TR+GKC+GHSSFITHLDWS DG FL SNSGDYE+L+WN   C+Q   A T+ D+ W +  C L F +    G+WP+GSDGTDINAV +AHN+ ++A ADDFGKV+++ YP   PK+  + Y GHSSHVT V FL +D  L STGG DT+++QW
Sbjct:    1 GHTDELWGLECHPSRDRFFTCSYDKRVSMWDVHSHRLIWSKSVEAVHLSALSPTSLHSSTCYNAAAHTLTCDKNIQTTHQREPPVEAAQSADFHPTGTVVAVGMQKGKWAVLDAETSDLVTLHTDGAELLSVMRYSPDGSMLAIGSHENFIFLHAVSEDGRRYTRLGKCTGHSSFITHLDWSVDGEFLVSNSGDYEILYWN-RNCRQQLMADTIRDIEWATYTCVLGFHIYVHVGVWPDGSDGTDINAVCRAHNRAVVAVADDFGKVHIFVYPCSQPKVPSRIYSGHSSHVTNVAFLHDDSYLLSTGGSDTSVMQW 315          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006396.1 (pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene:ENSPMAG00000005778.1 transcript:ENSPMAT00000006396.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 1.167e-42
Identity = 91/280 (32.50%), Postives = 142/280 (50.71%), Query Frame = 3
Query: 1491 NGH-SDEVWGVDSHPSKEQFVTGGHDRKIILWD-ALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPD-GSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLT----AASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
             GH   EVWG+ +HP      +   D+ + +WD +  H +L  ++L  + +    S +   +A+G  +G + +      +++   +   E I  I+FSPD G   AV S D F+ +Y++    +   RVG C G S  +THLDW + G  ++ N+   E LF+  P  K+       A  L   SW    C L     G+W   SDG D+NA + + ++ I+ATADDFG + L++YP        K+Y GHS  V  V++  +D  L S GG DTA++ W
Sbjct:    7 QGHMQSEVWGLAAHPHLPICASVSDDKTLRVWDLSDNHCMLAVRKLNDSGRCCCFSSDGKALAVGLNDGSFLVVNANTLEDMLSFQHRREMITDIKFSPDPGKYLAVASHDGFVDVYRV----LSSKRVGTCKGASGCVTHLDWDTKGKLIQVNTSAREQLFYEAPRGKRQNIHPHEAERLEFASW---TCVLGPTCEGVWAAHSDGADVNAASLSRDRSILATADDFGFIKLFQYPVKGAYARCKQYVGHSGQVANVRWAYDDSLLLSVGGADTALVLW 279          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Match: wdr90 (WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-070424-67])

HSP 1 Score: 93.2041 bits (230), Expect = 1.427e-19
Identity = 101/480 (21.04%), Postives = 197/480 (41.04%), Query Frame = 3
Query:  507 KSQIQEPDES-----LRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAG-IVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKF----TTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-------------IDDKL---VVGTTSNAIVEITGNDGFD-NLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQ-LEKNIQSIS-------VSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAV-GSRDNFIYIYKI 1838
            K Q Q+P  +     LR++ V GY G   R NL + P   ++ + +G +V++  L +  QRH + H  +I  +A+  D  T  +              + +W       +   G       V A+ FS+ D  + L+++ +  D ++ LW      S+  S     P     F P  +         H+AF ++E+      +++      P+      TCV +   G +  G SSG +  W  E++S    +T   +     +L     +L++ G     +  W +++ + A   +Q     G    ++E              DD L   VVGT    +  I   +     L++GH+++V G+   P +  F +   D  + +WDA + ++ +  Q L++  + ++        S  + LVA G+ +G   + ++   + + + +     +  + FS D   F V G+RD  + +  +
Sbjct: 1183 KQQQQQPTTAGELPGLRLKAVVGYNGNG-RGNLVWRPDNGLLAYSSGCVVVVEELRSGDQRHLLGHQREISTLAISHDAQTLVSASCG---------QMCMWD--VASGVCRSGPSHHRGDVQALAFSRDD--RFLLSLGDGRDGSLALWAVQQDVSLLASVRCPVPAHALAFRPGRAGEFVCAASGHIAFGLVEQRGREFGLSLDMVAVPPELGGAEVTCVCYGAGGVVFAGTSSGLVSAWDSERKSCF--LTWEADSLALGVLECRGHSLVTAGAGRR-LRRWSVASVDAA--RVQERGTRGADCVVLEAELRLDASAVSAAFDDDLDMGVVGTAVGTVWFIGWAECSSMRLVSGHAEQVTGLAFSPDEALFASSAADGSLRVWDARSLELSVQFQVLQQTCECVAWSRVPARRSRFSRLVAAGYGDGAVRLFSLRSVEMVLKMRSHGSAVTALAFSTDAGEFLVSGARDGLVVVSSL 1643          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 60.077 bits (144), Expect = 1.084e-9
Identity = 44/183 (24.04%), Postives = 85/183 (46.45%), Query Frame = 3
Query: 1485 LLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSP-NADLVAIGFIEGHWSI-CTMTEF------KEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKI------------DSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWN 1973
            +L GH  +++ +D  PS ++ V+G  DR + +WD  T +  L+  +E  + +++VSP +   +A G ++    +  + T F       E   G    + +  + F+ DG     GS D  + ++ +            +S T EVT +    GH  F+  +  + +  ++ S S D  +LFW+
Sbjct:  480 ILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYI----GHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: LST8 (Protein required for the transport of Gap1p; required for the transport of amino acid permease Gap1p from the Golgi to the cell surface; component of the TOR signaling pathway; associates with both Tor1p and Tor2p; contains a WD-repeat [Source:SGD;Acc:S000004951])

HSP 1 Score: 55.4546 bits (132), Expect = 1.207e-8
Identity = 58/237 (24.47%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 1290 LLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVV--GTTSNAIVEI-TGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQ-GKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSET--MEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPE 1982
            +L   G DH I  W+  T     R IQ S D+   R  +  D KL+   G  +  + +I T N        GH   V  V         VT   D  I +WD  +  +  + +    +  + + PN   +     +G+  I  + E +  HQ   + +  +Q +  + DGS+ A  +     Y++++ + T    +  V K   HS++IT +  SSD   L + S D+    W+I +
Sbjct:    4 ILVSAGYDHTIRFWEALTG-VCSRTIQHS-DSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDD 238          

HSP 2 Score: 47.3654 bits (111), Expect = 5.657e-6
Identity = 36/163 (22.09%), Postives = 67/163 (41.10%), Query Frame = 3
Query: 1140 VTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLS----NDNGFCRTIVEIDDKLVVGTTSNAIVEI-TGNDGF--DNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVL 1607
            V   N GELI+ D  GNI  W   +   T  +T   +  + SL ++  G++L+        + W++     A     ++    +     R ++  D K +   +++    + + +D F  +  L+GH   VW           VT   D  + LWD  T +++
Sbjct:  123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 51.9878 bits (123), Expect = 2.638e-7
Identity = 68/307 (22.15%), Postives = 137/307 (44.63%), Query Frame = 3
Query:  687 TDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVI-EAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELI-TGDSSGNIYFWSREKRSITSAITQA-HNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDD--KLVVGTTSNAIVEITGNDGFDNL--LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWD 1586
            T  I  ++L  D +  ATG  AG         +++ +S TLQ L T  L      + A+ +      +++   ++    N    N      +       E  I + +++P+   + +    +H   W L   +  +++ + E ++K  F+  ++F  +G L+ +G        W  + RS +  +T A H+ PI+++  S  G  ++ GG D  I  WD+  +++   N  L++ N   +     +D  K +V    + ++ +  +D +  +  L GH+D++  +D   +    V+GG DR I LW+
Sbjct:  175 TKPISAVSLSTDDMVVATGSWAGD--------LQVLNSQTLQPL-TQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSA---SHDMTWRLWDASTHQELLLQEGHDKGVFS--LSFQCDGSLVCSGGMDSLSMLW--DIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465          

HSP 2 Score: 50.0618 bits (118), Expect = 1.208e-6
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query: 1488 LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHK-VLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSD 1922
            L GH   +  V  HPS +   +  HD    LWDA TH+ +LL +  +K + S+S   +  LV  G ++    +  +    ++      ++PI  + +SP+G   A G  D  I ++ I     +  ++ +   H + +T + +S +
Sbjct:  261 LVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDI--RKRDEGQLNQILAHRNIVTQVRFSKE 404          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: HIR1 (Subunit of the HIR complex; HIR is a nucleosome assembly complex involved in regulation of histone gene transcription; contributes to nucleosome formation, heterochromatic gene silencing, and formation of functional kinetochores [Source:SGD;Acc:S000000104])

HSP 1 Score: 51.9878 bits (123), Expect = 3.946e-7
Identity = 43/168 (25.60%), Postives = 68/168 (40.48%), Query Frame = 3
Query: 1506 EVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVG------------KCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWN 1973
            E++ VD     ++  TGG D KI +W      +L   +LE      S++P   L      +    +C+M+     H G      I C++FSPDG   A GS D  + I+ +D E       G            +   H + I  + W+ D   L +   D  ++ WN
Sbjct:   19 EIYTVDVSHDGKRLATGGLDGKIRIWS--IDSILRCMELE------SLTPEIPLPQ----DLQMPLCSMSR----HTGS-----ITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN 165          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Match: RRP9 (Protein involved in pre-rRNA processing; associated with U3 snRNP; component of small ribosomal subunit (SSU) processosome; ortholog of the human U3-55k protein [Source:SGD;Acc:S000006341])

HSP 1 Score: 50.8322 bits (120), Expect = 7.752e-7
Identity = 39/138 (28.26%), Postives = 66/138 (47.83%), Query Frame = 3
Query: 1476 FDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILW--DALTH-KVLLSKQLEKNIQSISVSPNADLV---AIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVG 1871
            ++N   GH DE+  V + P  +  VTGG DRK+I+W  ++L+  KV+ +K     + S++   N+D +      F    +SI   ++ + ++   D  E I  +          VG+RD    ++KI  ET    R G
Sbjct:  228 YENTTEGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSDQLYASCADFKIRTYSINQFSQLEILYGHHDIVEDISALAME---RCVTVGARDRTAMLWKIPDETRLTFRGG 362          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO42394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N5])

HSP 1 Score: 452.595 bits (1163), Expect = 1.465e-149
Identity = 232/586 (39.59%), Postives = 355/586 (60.58%), Query Frame = 3
Query:  441 IFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYL-PTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSN----VIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEID-DKLVVGTTSNAIVEITGNDGFDNL----LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQ------SISVSPNADLVAIGFIEGHWSICTMTEFKEI-HQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATAD 2147
            I +RGR I +Y P    D     +   +PD+ L +EWVYGYRGKDCR NL  +  TG++ YF A IV+L+NL   TQRHY +HTDD+K +A+HPD  T A+GQVAGH +V+G+PH RIW  + L+T+  IGLG F RAV ++ FSK D G+ +V+VD+ + H IT+W+W   K + +++   + V+ A F P + N     + +CGK H++FW +E+  L      F+ + KP + +C+TF  NG++ITGD++G IY W      I+S++T AH GP+++LL+   G LLSGGGKD  +  W+ + KE +   ++L       RT+   D + L +GTT N I  +       +L      GHSD + G+ +HPS+ +F T G D  + +W++  H V L +    N        ++SVS  AD +A+G+ +G + I  +   + I  + +   E I  +++SPDG   AV S DN IY+Y +++    +   GKC GH+S++TH DWS    F++S SGDYELLFW+  +C+Q+  A  + +  W + NC L +    IWP+ +DGTDIN+V ++H++ ++AT +
Sbjct:   10 IKLRGRRIPVYPP----DNAQPNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGEPHFRIWDVVRLETIAVIGLGHFGRAVNSLAFSKKDHGRYIVSVDDDDYHTITVWDWERNKIVASARGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWN-NMKELSPTGVELRYGVTGIRTLAFDDSNTLYIGTTDNCIWTVRPIPFTLHLKSLSFQGHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDGSFGIFNVKSGEPIFFKKRCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGRSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPX--IWPKKADGTDINSVDRSHSRTLLATGE 588          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO49877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY9])

HSP 1 Score: 390.578 bits (1002), Expect = 1.215e-125
Identity = 216/596 (36.24%), Postives = 327/596 (54.87%), Query Frame = 3
Query:  555 YGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK-PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEAND-HNITLWNWAXXXXXXXXXXXXE-PVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWD----LSTKEKAGRNIQLSNDNGFCRTIVEIDD-KLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAH---NKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            YGY+G   ++NL+ LP+G+I+YF++ IV+++N  +  QRHY  H DDIKCMA+HP++   ATGQ +G S  + +  H+R+W + TL TL  + L  +  +V  + FS  D GK LV +D  +D   + LW W     +  SK   + PV++  F+P DS  I +CGK H+ FW      L +K   FEKY  P++ TC+ F  NG++ TGDSSG +  W +  + I   +  AH   IF L +   GTLL+ GG D  +  WD     +T     +  QL+      R     DD  L+VGTT+N I+E +    F  L+ GHSDEV  +  HPSK+ F++   D+   LW A  HK   S  +  +I+  +      +VA+G  +G W +        +   +DG EP+  IE+SP+G   A+ S+D  IY++ +  + M   RVG CS H++ +  LDWS DG F++S S +YE + W I   ++  + + + D  W++ N  L ++VAG+W   S  T+ N VT +    +  ++A  D+ G + L+RYP C     + + + HS  V  V FL  D  L ST GQD A++QW
Sbjct:    1 YGYQGT--QRNLHVLPSGEILYFISRIVVIYNKKSNIQRHYTGHADDIKCMAVHPNQWYIATGQASGLSLDQNEMSHIRLWDAETLITLVVLPLDDYSLSVETLAFSVEDNGKQLVCIDSNDDSFRLNLWEWEDRSLLTQSKVGIQTPVLDIAFDPDDSKTIVSCGKEHIYFWRWHNGKLERKNGYFEKYPVPQYLTCMDFAPNGDICTGDSSGTVTVWGKVSKKIKFVVRNAHEKSIFCLRVLPNGTLLTAGGVDGRVCAWDSNKYFTTPLHEAQVRQLTQQ---IRLKFHSDDVTLLVGTTANKILEGSFTSDFIPLVKGHSDEVPALAVHPSKDLFISASMDKFAYLWSAKDHKTAWSTDVGFSIKCAAFYNTGSVVALGSTKGRWIVLDGQTGMHVCSFQDGTEPLTDIEYSPEGEHVAIASKDGNIYVHSVYDDGMTYRRVGCCSNHTAPVMFLDWSVDGCFIQSISTEYEHITWEIGAFQREESQNVIRDTEWNTRNVVLGYDVAGVWR--STPTEENLVTSSDLSWSHDLLAVGDELGYIRLFRYPCCIEGAQYHQVRAHSMSVARVLFLASDKFLLSTAGQDRAVLQW 589          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO48487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIZ6])

HSP 1 Score: 389.037 bits (998), Expect = 3.359e-124
Identity = 206/601 (34.28%), Postives = 334/601 (55.57%), Query Frame = 3
Query:  525 PDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGR---NIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEI--TGNDGFDNLLNGHSD-EVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            P   +R+EWVYGYRG  CR NLYY  + +IVYFVAG+ +++N    TQR ++ H DDI  +ALHP+KV  ATGQV         P++ +W S + +T+ +I     +R +  + F+ S  G  LV+V   + H + +W+W   K + +++  T+ + + +FNP   NV+ +CG  H+ FW L  N+L  K  IF K  + +   C+ F ++    +G  SG IY W  + +++  AI  AH G +FS+     G   + G KD  +  WD   K  A     N ++  +    R++  + +K++VGT +  + E+  T  D    ++ GH++ E+W + +HP K  F TG  D+ + LW      +L    +++ ++S++ + +   +A+G  +G + I    +  E+ +  D  E +  +++SPDG   AVGS DNF+ IY +     +  +VG+C G SSFITHLDWS D  +L++NSG  E LF+ +P  K++T    +  + W +  C +  EV GIW + SD  D+NA+       ++ T DDFG V L+++P+       +KY GHS+HVT V+F  + +R+ S GG D A+ QW
Sbjct:    7 PSSQIRLEWVYGYRGHQCRNNLYYTASKEIVYFVAGVGVVYNTRENTQRFFLGHDDDIISLALHPEKVLVATGQVGK------DPYICVWDSHSTETV-SILKDAHQRGITCLAFNPS--GNYLVSVGLEDYHMVVVWDWKRGKQLASTRGHTDRIFDMQFNPYKENVLVSCGVKHIIFWTLRGNSLNPKKGIFGKTGEIQTNLCLAFGSDDVTYSGTLSGEIYKW--KGQNLAGAIPNAHTGAVFSIFGGADG--FASGSKDGTVVLWDAEFKPIAKLDLINTRVGYEGLSIRSVCWLGEKILVGTNAGEVFEVMATDKDKPRTIVQGHAEGELWALAAHPKKGIFATGSDDKSVRLWSMADKSLLARTDVDQKVRSVAFNADGTHLAVGLSDGSFMILKARDLSEVTRINDRKEVLHEMKYSPDGQFLAVGSNDNFVDIYAV---AQKYKKVGECKGSSSFITHLDWSEDSKYLQTNSGAAERLFYRMPTGKRITNKEEIKSIHWATWTCVVGTEVNGIWGKYSDTNDVNALDACFQHNVMVTGDDFGLVKLFKFPSVRKGSKFRKYVGHSAHVTNVRFSNDFNRVISVGGGDHAVFQW 591          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO31013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ48])

HSP 1 Score: 377.096 bits (967), Expect = 7.639e-121
Identity = 211/591 (35.70%), Postives = 326/591 (55.16%), Query Frame = 3
Query:  441 IFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYL-PTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTL---HTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSN----VIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEID-DKLVVGTTSNAIVEITGNDGFDNLLN----GHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQ------SISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATAD 2147
            I +RGR I +Y P    D     +   +PD+ L +EWVYGYRGKDCR NL  +  TG++ YF A IV+L+NL   TQRHY +HTDD+K +A+HPD  T A+GQVAGH +V+G+    H  +      Q +   H +  G  ++ +    +     G +        D  +   ++ T   +       + V+ A F P + N     + +CGK H++FW +E+  L      F+ + KP + +C+TF  NG++ITGD++G IY W      I+S++T AH GP+++LL+   G LLSGGGKD  +  W+ + KE +   ++L       RT+   D + L +GTT N I  +       +L +    GHSD + G+ +HPS+ +F T G D  + +W++  H V L +    N        ++SVS  AD +A+G+ +G                +   E I  +++SPDG   AV S DN IY+Y +++    +   GKC GH+S++TH DWS    F++S SGDYELLFW+  +C+Q+  A  + +  W + NC L + V GIWP+ +DGTDIN+V ++H++ ++AT D
Sbjct:   10 IKLRGRRIPVYPP----DNAQPNTNPDKPDQRLALEWVYGYRGKDCRNNLVVVNETGELAYFTAAIVVLYNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASGQVAGHEEVQGELMVNHHYLTQDHMDQLMVNHHYLTYGHTDQLILNHHYLTQ--GHM--------DQLMVYHHYLTQDHMDQLMGHMDQVLVASFTPFEINEGVLSLVSCGKQHVSFWNIEEGRLKCDRGRFDHHVKPLYISCLTFARNGDVITGDTNGTIYVWREGTNEISSSVTNAHQGPVYALLVLPNGDLLSGGGKDGTVRAWN-NMKELSPTGVELRYGVTGIRTLAFDDSNTLYIGTTDNCIWTVRPIPLTLHLKSLSSQGHSDSLQGLAAHPSEPKFFTAGSDMTVRVWNSADHSVQLFRPPADNRDKKLIPCAVSVSSTADTIAVGYKDG----------------RCAQEKISDLKYSPDGKCLAVASHDNNIYVYTLENGGKSMELCGKCEGHTSYVTHFDWSVGSDFIQSTSGDYELLFWDAKKCEQIKLAKDMRNTEWATQNCVLGYPVLGIWPKKADGTDINSVDRSHSRTLLATGD 569          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 67.0106 bits (162), Expect = 4.318e-12
Identity = 72/271 (26.57%), Postives = 115/271 (42.44%), Query Frame = 3
Query: 1488 LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNAD-LVAIGFIEGH--WSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSET--MEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANC-TLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTG 2282
            L+GH+  V  V   P      +   D+ I LW+     +   +  E  + S++ S N   LV++   +    W + +      +  G DG  P+ C++FSPDG L A    D+ + I+ I +    M+ T +    GHS ++  + +SSDG  L S S D  +  W+        AA  L    +HS  C ++A+   G+W                   + + +DDF KV L+     A   A    +GH S +  V F  +D  LAS  
Sbjct:   26 LDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPSDEFLRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTL-TGHDGY-PV-CLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCA------AAEKLKKARFHSERCWSVAYSDDGMW-------------------LASASDDF-KVRLWAVEGYAQVAA---MEGHESEIRVVSFSPDDSLLASAA 264          

HSP 2 Score: 50.0618 bits (118), Expect = 1.837e-6
Identity = 62/278 (22.30%), Postives = 111/278 (39.93%), Query Frame = 3
Query:  783 VRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELI--TGDSSGNIYFWSREK-----RSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAI-VEITGNDGFDNL--LNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWD 1586
            +R+W S T   L    L     AV  V  S  DGG   V    + D  I LWN  + + + + +   + V    F+     +++      L  W +E   L   +   + Y       C+ F+ +G L+  TG  S N+  W         +    A+   H+  +  +  S  G LL+ G +D  +  WD +  EK  +  +  ++   C ++   DD + + + S+   V +   +G+  +  + GH  E+  V   P      +   D+ I +WD
Sbjct:   12 IRVWDSKTGALLAQ--LDGHAGAVTCVRVSP-DGG---VIASSSADKTIRLWN-PSDEFLRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYP-----VCLDFSPDGMLLASTGADS-NVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEKL-KKARFHSER--CWSVAYSDDGMWLASASDDFKVRLWAVEGYAQVAAMEGHESEIRVVSFSPDDSLLASAALDQTIRVWD 273          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml2 (EMAP like 2 [Source:NCBI gene;Acc:101162059])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 304/641 (47.43%), Postives = 435/641 (67.86%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            K+ +    +G +R+F+RGRP+ +++P+     +    +   PD+ L+++W YGYRG+DCR NLY LPTG+IVYF+A +V+L+N   Q QRHY+ HTDD+KC+++HPD VT ATGQVAG+SK EGK   PHVRIW S++L T+H IG+G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P D+N+I TCGK+H+ FW +E   LTK+  +FEK+EKPK+  CV F  NG+ ITGDSSGNIY W++    I+ A++ AH G IFS+ + + GT++SGGGKD  +  WD   ++KA   +++S+  G  R + E   ++L VGTT NAI+     D    ++ GH+DE+WG+D HPS EQFVT   D+ + LWD+ +H+ L SK +E   +S+   P+  ++A+G + G W +        +    DGNE I  I +SPDG+  AVGS DNF+YIY +     + +RVGKCSGHSSF+THLDWS++  ++ +NSGDYE+LFW     K +T   T+ ++ W ++ CTL+F   GIWPE +DGTDINA  ++H   ++A+ADDFGKV+L+ +P   P+    +Y GHSSHVT V FL +D RL S+GG+DT+I+QW 
Sbjct:  175 KDYSLNAEDGFVRMFLRGRPVTMHIPDEQKSSYSLDQKGALPDKKLKLQWAYGYRGRDCRSNLYLLPTGEIVYFIASVVVLYNTEEQQQRHYLGHTDDVKCLSVHPDMVTIATGQVAGNSK-EGKLLAPHVRIWDSVSLNTVHVIGMGGFDRAVTCVSFSKSNGGAFLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLAAVFHPMDNNLIVTCGKSHINFWTMEGRTLTKRQGLFEKHEKPKYVLCVAFAENGDTITGDSSGNIYIWAKGGSRISHAVSGAHEGGIFSICVLKDGTMVSGGGKDRRVVLWDHDYRKKA--EMEVSDSLGPVRALAEGKPEELFVGTTKNAIIRSAFPDTLTPIVQGHTDELWGLDVHPSMEQFVTCAQDKLVQLWDSNSHQPLWSKSIEDQARSVGFHPSGAVLAVGTMTGRWLVLDADTRDLVSVHTDGNEMISTIRYSPDGNFLAVGSHDNFVYIYAVSEGGRKYSRVGKCSGHSSFVTHLDWSANSQYIVTNSGDYEILFWEASNGKHVTNVDTVRNLEWATSTCTLSFNTLGIWPESADGTDINAACRSHGGSLLASADDFGKVHLFTFPCSQPRAPSLEYGGHSSHVTNVAFLHDDSRLISSGGKDTSILQWA 812          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml2 (EMAP like 2 [Source:NCBI gene;Acc:101162059])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 304/641 (47.43%), Postives = 435/641 (67.86%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            K+ +    +G +R+F+RGRP+ +++P+     +    +   PD+ L+++W YGYRG+DCR NLY LPTG+IVYF+A +V+L+N   Q QRHY+ HTDD+KC+++HPD VT ATGQVAG+SK EGK   PHVRIW S++L T+H IG+G F+RAV  V FSKS+GG  L  VD+ANDH +++W+W   K +   K S + V+ A F+P D+N+I TCGK+H+ FW +E   LTK+  +FEK+EKPK+  CV F  NG+ ITGDSSGNIY W++    I+ A++ AH G IFS+ + + GT++SGGGKD  +  WD   ++KA   +++S+  G  R + E   ++L VGTT NAI+     D    ++ GH+DE+WG+D HPS EQFVT   D+ + LWD+ +H+ L SK +E   +S+   P+  ++A+G + G W +        +    DGNE I  I +SPDG+  AVGS DNF+YIY +     + +RVGKCSGHSSF+THLDWS++  ++ +NSGDYE+LFW     K +T   T+ ++ W ++ CTL+F   GIWPE +DGTDINA  ++H   ++A+ADDFGKV+L+ +P   P+    +Y GHSSHVT V FL +D RL S+GG+DT+I+QW 
Sbjct:  153 KDYSLNAEDGFVRMFLRGRPVTMHIPDEQKSSYSLDQKGALPDKKLKLQWAYGYRGRDCRSNLYLLPTGEIVYFIASVVVLYNTEEQQQRHYLGHTDDVKCLSVHPDMVTIATGQVAGNSK-EGKLLAPHVRIWDSVSLNTVHVIGMGGFDRAVTCVSFSKSNGGAFLCAVDDANDHILSVWDWQKEKQLADVKCSNDSVLAAVFHPMDNNLIVTCGKSHINFWTMEGRTLTKRQGLFEKHEKPKYVLCVAFAENGDTITGDSSGNIYIWAKGGSRISHAVSGAHEGGIFSICVLKDGTMVSGGGKDRRVVLWDHDYRKKA--EMEVSDSLGPVRALAEGKPEELFVGTTKNAIIRSAFPDTLTPIVQGHTDELWGLDVHPSMEQFVTCAQDKLVQLWDSNSHQPLWSKSIEDQARSVGFHPSGAVLAVGTMTGRWLVLDADTRDLVSVHTDGNEMISTIRYSPDGNFLAVGSHDNFVYIYAVSEGGRKYSRVGKCSGHSSFVTHLDWSANSQYIVTNSGDYEILFWEASNGKHVTNVDTVRNLEWATSTCTLSFNTLGIWPESADGTDINAACRSHGGSLLASADDFGKVHLFTFPCSQPRAPSLEYGGHSSHVTNVAFLHDDSRLISSGGKDTSILQWA 790          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 319/779 (40.95%), Postives = 464/779 (59.56%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLT---SPKAAKDVQLRK----SMVSPRTP-----------------VKATRLSGTPTRRSTNDL--------------------VNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE + +   +       +  T    P       L K    ++ SP  P                   +    GT TR+ + D                        ++  F   EG ++++++GRPI +Y+     D +  +++ + P   L+++WVYGYRG+DCR NLY LPTG+ VYF+A +V+L N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RAV  + FSKS+GG  L  VD++NDH ++LW+W     +   K S E V  A+F+PTDSNV+ TCGK+HL FW LEK  L KK  +FEK EKPKF  CVTF  NG+ ITGDS+GNI  W +    I+  I  AH   +F++ +   GTL+SGG KD  +  WD S ++   + +++ +  G  RT+ E   + +++GTT N +++ + +  F  +  GH+DE+WG+  HP K QF+T G+DR++ LWD+ +H+++ +K ++   QS    P+  +VA+G   G W +        +    DGNE +  I + P+G+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS+D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WP+GSDGTDINA  +++ K ++ + DDFGKV+L+ YP    +     Y GHSSHVT V FL +D  + STGG+D +++QW
Sbjct:   55 RIASLEQRVQMQEDEIQLLKSALADVVRRLNLSEEQQALGSRRGPTKARPMIATLPLRPTVNNGTILPKKGGGTLPSPSGPGSRKESNTAANKSTVRRANSNEHVGTLTRKDSGDAKGNRTRAGSTGSNSSGKRSDSKQRDPVFNADEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQI--QTMEVPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDGEFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQW 829          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 319/779 (40.95%), Postives = 464/779 (59.56%), Query Frame = 3
Query:  117 KIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLT---SPKAAKDVQLRK----SMVSPRTP-----------------VKATRLSGTPTRRSTNDL--------------------VNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +I  LE+    Q +EI  LK+ L D + R+   EE + +   +       +  T    P       L K    ++ SP  P                   +    GT TR+ + D                        ++  F   EG ++++++GRPI +Y+     D +  +++ + P   L+++WVYGYRG+DCR NLY LPTG+ VYF+A +V+L N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RAV  + FSKS+GG  L  VD++NDH ++LW+W     +   K S E V  A+F+PTDSNV+ TCGK+HL FW LEK  L KK  +FEK EKPKF  CVTF  NG+ ITGDS+GNI  W +    I+  I  AH   +F++ +   GTL+SGG KD  +  WD S ++   + +++ +  G  RT+ E   + +++GTT N +++ + +  F  +  GH+DE+WG+  HP K QF+T G+DR++ LWD+ +H+++ +K ++   QS    P+  +VA+G   G W +        +    DGNE +  I + P+G+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS+D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WP+GSDGTDINA  +++ K ++ + DDFGKV+L+ YP    +     Y GHSSHVT V FL +D  + STGG+D +++QW
Sbjct:   37 RIASLEQRVQMQEDEIQLLKSALADVVRRLNLSEEQQALGSRRGPTKARPMIATLPLRPTVNNGTILPKKGGGTLPSPSGPGSRKESNTAANKSTVRRANSNEHVGTLTRKDSGDAKGNRTRAGSTGSNSSGKRSDSKQRDPVFNADEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQI--QTMEVPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDGEFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQW 811          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Match: eml1 (EMAP like 1 [Source:NCBI gene;Acc:101173348])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 295/640 (46.09%), Postives = 424/640 (66.25%), Query Frame = 3
Query:  402 KEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGK---PHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVE-IDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            +  T  K EG ++++++GRPI +Y+     D +  +++ + P   L+++WVYGYRG+DCR NLY LPTG+ VYF+A +V+L N++ Q QRHY  HTDDIKC+A+HPDK+T ATGQVAG S  +GK   PHVR+W S++L TLH +G GFF+RAV  + FSKS+GG  L  VD++NDH ++LW+W     +   K S E V  A+F+PTDSNV+ TCGK+HL FW LEK  L KK  +FEK EKPKF  CVTF  NG+ ITGDS+GNI  W +    I+  I  AH   +F++ +   GTL+SGG KD  +  WD S ++   + +++ +  G  RT+ E   + +++GTT N +++ + +  F  +  GH+DE+WG+  HP K QF+T G+DR++ LWD+ +H+++ +K ++   QS    P+  +VA+G   G W +        +    DGNE +  I + P+G+  A+GS DN+IYIY +     + +RVGKCSGHSSFITHLDWS+D  +L SNSGDYE+L+W    CKQ+ +  T  D+ W +  CTL F+V G+WP+GSDGTDINA  +++ K ++ + DDFGKV+L+ YP    +     Y GHSSHVT V FL +D  + STGG+D +++QW
Sbjct:  203 RRVTHCKDEGYVKMYLKGRPITMYMNKDQMDSYCLEARAELPSNKLKLDWVYGYRGRDCRSNLYLLPTGETVYFIASVVVLFNVDEQLQRHYTGHTDDIKCLAVHPDKITIATGQVAGTSS-DGKQLAPHVRVWDSVSLNTLHVLGAGFFDRAVVCLAFSKSNGGNTLCVVDDSNDHILSLWDWQREDRLAEVKGSNESVFAADFHPTDSNVVVTCGKSHLCFWTLEKGILVKKQGLFEKQEKPKFVICVTFAENGDAITGDSNGNILVWGKGTNRISHVIQGAHEASVFAVCMLRNGTLVSGG-KDRRLISWDGSYQQI--QTMEVPDLFGPIRTVAEGRGETVLIGTTKNFVLQGSLDGEFKCITQGHTDELWGLAVHPCKPQFLTCGYDRQVCLWDSSSHQLIWTKTVDDAAQSAGFHPSGAVVAVGTQTGRWLVLDTDSKDLVTVHTDGNEQLSVIRYGPEGNFLAIGSHDNYIYIYAVAENGRKYSRVGKCSGHSSFITHLDWSADSQYLVSNSGDYEILYWIPSVCKQVVSVETTRDIEWATYTCTLGFQVFGLWPDGSDGTDINAACRSNAKNLLVSGDDFGKVHLFLYPCSQFRAPSHVYGGHSSHVTNVTFLHDDSSVVSTGGKDMSVMQW 838          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 1511.12 bits (3911), Expect = 0.000e+0
Identity = 741/742 (99.87%), Postives = 741/742 (99.87%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEE KKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV
Sbjct:    1 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEEGKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 742          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 1508.43 bits (3904), Expect = 0.000e+0
Identity = 737/742 (99.33%), Postives = 740/742 (99.73%), Query Frame = 3
Query:   87 MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            ++I+ DIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEE KKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV
Sbjct:  144 IKIDKDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEEGKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 885          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000021391.1 (SMESG000021391.1)

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 734/735 (99.86%), Postives = 734/735 (99.86%), Query Frame = 3
Query:  108 MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 2312
            MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEE KKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV
Sbjct:    1 MQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEEGKKVNKDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTNDLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGTTSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWV 735          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 358/809 (44.25%), Postives = 507/809 (62.67%), Query Frame = 3
Query:   96 ENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESK-KVNKDKNTVTPNSL------KLTSPKAAKDV---QLRKSMV------SPR---------------------------------TPVKATRLSG-------TPTRRSTND---------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEI-----TGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            E   +++K+ ELEK+  +QA+EI  LK+ + D L R+  LE+S+ K NK  N++   S+       L SP +  +V    L KSMV      SPR                                 TPV+ T   G       +  R+S N          L N KE  + K EG L+I+I+GRPI L VP + A   D +       E+L++EWVYGYRG+D R N+Y+LPTG+IVYF+A +VIL+N+  QTQRHY+ HTDD+K +A+HPDK+T ATGQVAGHSK +GKPH+RIWSS+ L TLH +GLG FER++  + FSK+DGG L+  VDEAN+H +++W W   + I  +KSSTEP++  +F+P ++  I TCGKNHL FW  E N L+KK A++EK EKPKF  C  F +NGEL+TGDSSGNI  W+ E   +   +T AH GPIFSLL+++  TLLSGGGKD  I EW  S     G    L   +G  R + +    ++ VG+T ++I++      + +  F ++++GH +E+WG+ +HP + +FVT G+D+ +  WD+LT  ++  K+  +N+ S+   P  +++ IG   G W +      + +    DGNE I+C++FS DG   A+GSRDN IY+Y +     + +R GKC GHSSFITH+DWS++G FLRSNSGDYE+L+WN   C+Q+ +   + D+ W + NCT+ +  AGIW EG DGTDINAV K H+  ++ +ADDFG+VNLY YP    K+ H +++GHSSHVT VKFL +D R+ S+GG+D++I+QW
Sbjct:  167 ETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNNIKETIYNKDEGSLKIYIKGRPIILSVP-TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWS-SLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 973          
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Match: SMESG000003186.1 (SMESG000003186.1)

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 358/809 (44.25%), Postives = 507/809 (62.67%), Query Frame = 3
Query:   96 ENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESK-KVNKDKNTVTPNSL------KLTSPKAAKDV---QLRKSMV------SPR---------------------------------TPVKATRLSG-------TPTRRSTND---------LVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDESLRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEHTDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLGFFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWAXXXXXXXXXXXXEPVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTTCVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAGTLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLV-VGTTSNAIVEI-----TGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWDALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQGKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGHSSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSANCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPACAPKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQW 2309
            E   +++K+ ELEK+  +QA+EI  LK+ + D L R+  LE+S+ K NK  N++   S+       L SP +  +V    L KSMV      SPR                                 TPV+ T   G       +  R+S N          L N KE  + K EG L+I+I+GRPI L VP + A   D +       E+L++EWVYGYRG+D R N+Y+LPTG+IVYF+A +VIL+N+  QTQRHY+ HTDD+K +A+HPDK+T ATGQVAGHSK +GKPH+RIWSS+ L TLH +GLG FER++  + FSK+DGG L+  VDEAN+H +++W W   + I  +KSSTEP++  +F+P ++  I TCGKNHL FW  E N L+KK A++EK EKPKF  C  F +NGEL+TGDSSGNI  W+ E   +   +T AH GPIFSLL+++  TLLSGGGKD  I EW  S     G    L   +G  R + +    ++ VG+T ++I++      + +  F ++++GH +E+WG+ +HP + +FVT G+D+ +  WD+LT  ++  K+  +N+ S+   P  +++ IG   G W +      + +    DGNE I+C++FS DG   A+GSRDN IY+Y +     + +R GKC GHSSFITH+DWS++G FLRSNSGDYE+L+WN   C+Q+ +   + D+ W + NCT+ +  AGIW EG DGTDINAV K H+  ++ +ADDFG+VNLY YP    K+ H +++GHSSHVT VKFL +D R+ S+GG+D++I+QW
Sbjct:  162 ETYALREKVSELEKIVSQQADEIACLKSAMADNLRRLKLLEDSRSKKNKTVNSMLTISIDENDNDPLLSPNSYSNVTNYSLSKSMVHLSTQASPRSSVSNSVALLNTNSLVPNSRRSTGQRTKRYPDVTPVRTTNSIGRFSSGKHSSARQSANSSTPSINHIGLNNIKETIYNKDEGSLKIYIKGRPIILSVP-TYAQPIDLELLAPAAHETLKLEWVYGYRGRDSRNNVYFLPTGEIVYFIAAVVILYNMEEQTQRHYLGHTDDVKSIAIHPDKITIATGQVAGHSKNQGKPHIRIWSSVNLNTLHVVGLGDFERSICCLSFSKADGGMLICAVDEANEHVLSIWQWEKERRIVEAKSSTEPILSVDFHPLNNKSIITCGKNHLTFWNFEDNQLSKKQAVYEKNEKPKFILCQAFLDNGELVTGDSSGNIILWNMETHKVEKIVTTAHEGPIFSLLLTKNSTLLSGGGKDRKIKEWS-SLLACIGCEKTLPETHGAIRMLSQGPGGMILVGSTKSSILQFHLQSNSQSMEFRSIVDGHVEEMWGLATHPKQHRFVTVGYDKLLCYWDSLTRTLIWRKEFTENLHSVCFHPLFEVIIIGCCAGRWMVIDTITREMVGVHTDGNEKIECVQFSTDGRSLAIGSRDNSIYVYNVSDNGYKYSRNGKCVGHSSFITHIDWSTNGQFLRSNSGDYEVLYWNSSTCRQVQSNDQIRDIDWATVNCTIDWSTAGIWSEGMDGTDINAVDKGHHLPVLCSADDFGRVNLYSYPFPNSKVPHHQFRGHSSHVTNVKFLFDDSRVISSGGKDSSIMQW 968          
The following BLAST results are available for this feature:
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EML10.000e+044.42EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+049.53EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+049.53EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML10.000e+049.53EMAP like 1 [Source:HGNC Symbol;Acc:HGNC:3330][more]
EML20.000e+042.46EMAP like 2 [Source:HGNC Symbol;Acc:HGNC:18035][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp-14.522e-9630.79Echinoderm microtubule-associated protein-like elp... [more]
elp-14.522e-9630.79Echinoderm microtubule-associated protein-like elp... [more]
elp-16.832e-9630.79Echinoderm microtubule-associated protein-like elp... [more]
elp-16.832e-9630.79Echinoderm microtubule-associated protein-like elp... [more]
prp-198.768e-922.41Pre-mRNA-processing factor 19 [Source:UniProtKB/S... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCX-EMAP3.494e-11431.23gene:FBgn0259099 transcript:FBtr0299510[more]
DCX-EMAP1.058e-11331.23gene:FBgn0259099 transcript:FBtr0330139[more]
DCX-EMAP1.919e-11131.23gene:FBgn0259099 transcript:FBtr0299509[more]
DCX-EMAP4.512e-11131.23gene:FBgn0259099 transcript:FBtr0331181[more]
CG39094.173e-1123.90gene:FBgn0027524 transcript:FBtr0082172[more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml20.000e+047.89EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71][more]
eml20.000e+047.89EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71][more]
eml20.000e+047.89EMAP like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-71][more]
eml10.000e+043.04EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+047.81EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc810.000e+045.20coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+043.52coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+048.59coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+043.26coiled-coil domain containing 81 [Source:Xenbase;A... [more]
ccdc810.000e+042.98coiled-coil domain containing 81 [Source:Xenbase;A... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eml10.000e+043.89echinoderm microtubule associated protein like 1 [... [more]
Eml10.000e+043.89echinoderm microtubule associated protein like 1 [... [more]
Eml20.000e+042.46echinoderm microtubule associated protein like 2 [... [more]
Eml10.000e+048.91echinoderm microtubule associated protein like 1 [... [more]
Eml20.000e+047.66echinoderm microtubule associated protein like 2 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4V8C3|EMAL1_RAT0.000e+044.26Echinoderm microtubule-associated protein-like 1 O... [more]
sp|O00423|EMAL1_HUMAN0.000e+044.42Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q05BC3|EMAL1_MOUSE0.000e+043.89Echinoderm microtubule-associated protein-like 1 O... [more]
sp|Q6P6T4|EMAL2_RAT0.000e+047.66Echinoderm microtubule-associated protein-like 2 O... [more]
sp|O95834|EMAL2_HUMAN0.000e+047.97Echinoderm microtubule-associated protein-like 2 O... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IDM80.000e+044.63echinoderm microtubule-associated protein-like 2 i... [more]
A0A1S3IBB10.000e+050.38echinoderm microtubule-associated protein-like 2 i... [more]
A0A564YMH50.000e+043.32WD_REPEATS_REGION domain-containing protein OS=Hym... [more]
A0A1S3IBB60.000e+049.33echinoderm microtubule-associated protein-like 2 i... [more]
A0A1S3IBK70.000e+049.33echinoderm microtubule-associated protein-like 2 i... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml20.000e+046.72echinoderm microtubule-associated protein-like 2 [... [more]
eml20.000e+046.72echinoderm microtubule-associated protein-like 2 [... [more]
eml10.000e+042.91EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml10.000e+044.84EMAP like 1 [Source:ZFIN;Acc:ZDB-GENE-060929-156][more]
eml20.000e+046.85echinoderm microtubule-associated protein-like 2 [... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001632.10.000e+045.24pep scaffold:Pmarinus_7.0:GL476536:457691:473572:-... [more]
ENSPMAT00000006636.11.747e-9449.08pep scaffold:Pmarinus_7.0:GL476567:332173:347209:1... [more]
ENSPMAT00000002683.12.378e-8541.77pep scaffold:Pmarinus_7.0:GL480753:496:3963:1 gene... [more]
ENSPMAT00000006396.11.167e-4232.50pep scaffold:Pmarinus_7.0:GL484846:253:8190:1 gene... [more]
wdr901.427e-1921.04WD repeat domain 90 [Source:ZFIN;Acc:ZDB-GENE-0704... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TUP11.084e-924.04General repressor of transcription; forms complex ... [more]
LST81.207e-824.47Protein required for the transport of Gap1p; requi... [more]
PRP42.638e-722.15Splicing factor; component of the U4/U6-U5 snRNP c... [more]
HIR13.946e-725.60Subunit of the HIR complex; HIR is a nucleosome as... [more]
RRP97.752e-728.26Protein involved in pre-rRNA processing; associate... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423941.465e-14939.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498771.215e-12536.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484873.359e-12434.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310137.639e-12135.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447954.318e-1226.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eml20.000e+047.43EMAP like 2 [Source:NCBI gene;Acc:101162059][more]
eml20.000e+047.43EMAP like 2 [Source:NCBI gene;Acc:101162059][more]
eml10.000e+040.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+040.95EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
eml10.000e+046.09EMAP like 1 [Source:NCBI gene;Acc:101173348][more]
back to top
BLAST of Echinoderm microtubule-associated protein-like 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021391.10.000e+099.87SMESG000021391.1[more]
SMESG000021391.10.000e+099.33SMESG000021391.1[more]
SMESG000021391.10.000e+099.86SMESG000021391.1[more]
SMESG000003186.10.000e+044.25SMESG000003186.1[more]
SMESG000003186.10.000e+044.25SMESG000003186.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032885 ID=SMED30032885|Name=Echinoderm microtubule-associated protein-like 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2611bp
ATTAAAACATTAAATTTAATTTTCATTTGTTTAATCTATTAAGTATTTAT
TTACTCTTATATTTGGCGGGTTACAAAATTCTACTTATGGAAATCGAAAA
CGATATAATGCAAAAGAAAATTGACGAACTGGAAAAGGTTTCAGATAAAC
AAGCAAACGAAATTACCGGATTAAAAACAATTTTGAATGATTGCCTTGCT
CGAATTGCTGCTCTCGAAGAAAGTAAAAAAGTTAACAAAGATAAGAACAC
CGTAACTCCAAATTCATTGAAACTGACATCACCAAAAGCAGCGAAAGATG
TGCAATTACGAAAATCAATGGTGAGTCCTAGAACTCCAGTGAAGGCTACA
AGACTATCCGGAACACCAACTCGTAGGAGTACTAATGATTTGGTTAATCA
CAAAGAAGCGACATTTATCAAAGGCGAAGGAATATTACGCATATTTATCA
GAGGAAGACCGATAAATTTATATGTTCCTAATTCATTGGCCGATGGATTT
GACTTTAAAAGTCAAATACAGGAACCAGATGAAAGTCTGAGAATGGAATG
GGTATATGGCTATAGAGGTAAAGACTGCCGGAAAAATTTATACTACTTGC
CAACTGGAGATATTGTATATTTTGTAGCCGGTATTGTAATTCTTCATAAT
CTTAATAATCAAACTCAAAGGCATTACGTCGAGCATACTGATGACATAAA
ATGTATGGCTTTGCATCCTGATAAAGTCACTTTCGCAACAGGACAAGTAG
CAGGTCATTCAAAAGTTGAAGGAAAGCCACATGTTCGTATATGGAGTTCA
TTAACTCTTCAAACCTTACACACGATTGGATTGGGATTCTTTGAAAGAGC
CGTAGCTGCTGTTGGCTTCTCAAAATCGGATGGAGGGAAATTATTGGTAA
CAGTTGACGAAGCAAATGATCACAATATTACTCTATGGAATTGGGCAACA
ACGAAAAGTATTTGTACATCAAAGAGTTCTACAGAACCAGTGATTGAGGC
AGAATTTAATCCTACCGATAGTAATGTTATTGCAACATGTGGTAAAAATC
ACTTAGCTTTTTGGATATTGGAAAAGAATGCTTTAACCAAAAAGATGGCA
ATATTCGAGAAATATGAGAAACCAAAATTTACTACTTGTGTTACTTTTAC
AAATAATGGAGAACTTATTACTGGAGATTCTTCTGGCAATATTTATTTTT
GGAGTCGTGAAAAGCGATCAATTACTTCTGCAATTACACAGGCTCATAAT
GGACCAATTTTCTCACTATTAATTTCTGAAGCTGGAACGCTTTTGTCAGG
TGGTGGAAAAGATCATGCCATTTTCGAGTGGGATTTATCAACTAAAGAAA
AAGCTGGAAGAAATATTCAACTTTCGAACGATAATGGATTTTGTAGAACT
ATTGTCGAAATTGATGATAAATTAGTGGTTGGTACAACAAGTAATGCCAT
TGTTGAGATAACAGGAAATGATGGATTTGATAATTTATTAAATGGCCACA
GTGATGAAGTTTGGGGAGTTGATAGTCATCCTTCCAAAGAACAATTTGTA
ACAGGTGGTCATGATCGCAAAATAATTTTATGGGATGCTTTAACTCACAA
AGTGTTACTTAGTAAACAATTAGAAAAAAATATTCAGTCTATTTCTGTGA
GTCCCAATGCTGATTTAGTTGCCATAGGATTCATTGAAGGACATTGGTCT
ATTTGCACAATGACTGAATTCAAGGAGATTCATCAAGGCAAGGATGGAAA
TGAGCCTATTCAATGTATCGAATTTAGCCCAGATGGATCTCTATTTGCTG
TAGGATCACGCGATAATTTTATATATATTTATAAAATCGACTCGGAAACA
ATGGAAGTAACCCGAGTTGGGAAATGTTCGGGTCACTCTAGTTTTATAAC
TCATTTGGATTGGTCAAGTGATGGATTGTTTTTGAGAAGCAATTCGGGAG
ATTATGAACTTTTGTTCTGGAATATTCCAGAATGCAAACAACTGACTGCA
GCAAGCACACTTGCTGATGTTTCGTGGCATTCCGCAAATTGCACATTGGC
TTTCGAAGTTGCTGGTATTTGGCCGGAAGGTTCTGATGGAACAGATATTA
ACGCCGTGACTAAAGCGCACAATAAACTAATAATTGCAACAGCAGATGAT
TTTGGGAAAGTTAATTTGTATCGTTATCCAGCTTGTGCACCAAAAATGGC
GCATAAGAAATACAAAGGCCATAGTAGTCATGTGACTGGAGTGAAGTTTC
TGGTTGAAGATCATCGGCTTGCGAGCACCGGAGGGCAAGACACGGCCATC
ATTCAGTGGGTTCTCTCGTAAGCAGAGGAATCTTCATAAGAACTGAAATT
GATGTGATTTTGAATTTGTAAGATTTGATTTTTGTATCAGTGTGAGAGTG
TCTGTGACTTATTGTATCAATGTGTTCCAATGATTGATAGAAATTTCATT
TCCTGGCTCTCTTAGTATGATGAGGATGATGTCTCTAACCGTACTATGGT
TATAGTGCTTAATTTATTTAGACTGTTTATTTCGAATTTTATCTAAAATC
CAATATGATAATAATAATATTGTTATGAATAAAATATTTTTTTCGCACTG
AAAAAAAAAGA
back to top

protein sequence of SMED30032885-orf-1

>SMED30032885-orf-1 ID=SMED30032885-orf-1|Name=SMED30032885-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=745bp
MEIENDIMQKKIDELEKVSDKQANEITGLKTILNDCLARIAALEESKKVN
KDKNTVTPNSLKLTSPKAAKDVQLRKSMVSPRTPVKATRLSGTPTRRSTN
DLVNHKEATFIKGEGILRIFIRGRPINLYVPNSLADGFDFKSQIQEPDES
LRMEWVYGYRGKDCRKNLYYLPTGDIVYFVAGIVILHNLNNQTQRHYVEH
TDDIKCMALHPDKVTFATGQVAGHSKVEGKPHVRIWSSLTLQTLHTIGLG
FFERAVAAVGFSKSDGGKLLVTVDEANDHNITLWNWATTKSICTSKSSTE
PVIEAEFNPTDSNVIATCGKNHLAFWILEKNALTKKMAIFEKYEKPKFTT
CVTFTNNGELITGDSSGNIYFWSREKRSITSAITQAHNGPIFSLLISEAG
TLLSGGGKDHAIFEWDLSTKEKAGRNIQLSNDNGFCRTIVEIDDKLVVGT
TSNAIVEITGNDGFDNLLNGHSDEVWGVDSHPSKEQFVTGGHDRKIILWD
ALTHKVLLSKQLEKNIQSISVSPNADLVAIGFIEGHWSICTMTEFKEIHQ
GKDGNEPIQCIEFSPDGSLFAVGSRDNFIYIYKIDSETMEVTRVGKCSGH
SSFITHLDWSSDGLFLRSNSGDYELLFWNIPECKQLTAASTLADVSWHSA
NCTLAFEVAGIWPEGSDGTDINAVTKAHNKLIIATADDFGKVNLYRYPAC
APKMAHKKYKGHSSHVTGVKFLVEDHRLASTGGQDTAIIQWVLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR024977Apc4_WD40_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR005108HELP
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0008017microtubule binding
GO:0015631tubulin binding
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0002244hematopoietic progenitor cell differentiation
GO:0007052mitotic spindle organization
GO:0007405neuroblast proliferation
GO:0007420brain development
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005875microtubule associated complex
GO:0048471perinuclear region of cytoplasm
GO:0097431mitotic spindle pole
GO:1990023mitotic spindle midzone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 299..339
e-value: 0.82
score: 17.5
coord: 467..506
e-value: 7.0E-5
score: 32.2
coord: 256..296
e-value: 2.3
score: 14.7
coord: 211..250
e-value: 12.0
score: 10.2
coord: 426..464
e-value: 340.0
score: 1.0
coord: 163..208
e-value: 110.0
score: 4.0
coord: 113..160
e-value: 1.1
score: 16.7
coord: 384..423
e-value: 6.4E-6
score: 35.7
coord: 513..552
e-value: 0.024
score: 23.8
coord: 625..665
e-value: 6.3
score: 11.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 391..423
e-value: 2.8E-4
score: 21.6
coord: 115..160
e-value: 0.0034
score: 18.2
coord: 631..664
e-value: 0.091
score: 13.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 391..432
score: 13.316
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 307..348
score: 10.609
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 474..515
score: 9.239
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 520..561
score: 10.408
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 632..667
score: 8.537
IPR005108HELPPFAMPF03451HELPcoord: 40..111
e-value: 3.7E-27
score: 94.0
IPR024977Anaphase-promoting complex subunit 4, WD40 domainPFAMPF12894ANAPC4_WD40coord: 444..534
e-value: 1.4E-6
score: 28.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 70..664
e-value: 1.2E-236
score: 788.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 82..397
e-value: 1.2E-236
score: 788.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 26..665
NoneNo IPR availablePANTHERPTHR13720:SF9ECHINODERM MICROTUBULE-ASSOCIATED PROTEIN-LIKE 2coord: 26..665
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 632..667
score: 8.597
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 199..561
score: 23.941
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 511..664
IPR011047Quinoprotein alcohol dehydrogenase-like superfamilySUPERFAMILYSSF50998Quinoprotein alcohol dehydrogenase-likecoord: 69..557