utx

Overview
Nameutx (AGA95405.1)
Smed IDSMED30032882
Length (bp)4292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of utx (SMED30032882) t-SNE clustered cells

Violin plots show distribution of expression levels for utx (SMED30032882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of utx (SMED30032882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for utx (SMED30032882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032882SMESG000020110.1 SmedASXL_011152SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032882SMESG000020110.1 SmedASXL_011152SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032882SMESG000020110.1 dd_Smed_v4_5837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032882SMESG000020110.1 dd_Smed_v4_5837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30032882SMESG000020110.1 dd_Smed_v4_5837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032882SMESG000020110.1 dd_Smed_v4_5837_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032882SMESG000020110.1 dd_Smed_v4_5837_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032882SMESG000020110.1 KC262341smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of utx vs. Ensembl Human
Match: KDM6A (lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC:12637])

HSP 1 Score: 518.85 bits (1335), Expect = 3.391e-163
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  533 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 988          
BLAST of utx vs. Ensembl Human
Match: KDM6A (lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC:12637])

HSP 1 Score: 520.39 bits (1339), Expect = 3.756e-163
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  578 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1033          
BLAST of utx vs. Ensembl Human
Match: KDM6A (lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC:12637])

HSP 1 Score: 520.776 bits (1340), Expect = 9.157e-160
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  935 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1390          

HSP 2 Score: 301.982 bits (772), Expect = 4.009e-83
Identity = 180/475 (37.89%), Postives = 251/475 (52.84%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   +     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   45 EREALGGLDSRLFGFVRFHE-DGARTKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATVLQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 435          
BLAST of utx vs. Ensembl Human
Match: KDM6A (lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC:12637])

HSP 1 Score: 521.161 bits (1341), Expect = 1.050e-159
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  963 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1418          

HSP 2 Score: 302.753 bits (774), Expect = 2.386e-83
Identity = 180/475 (37.89%), Postives = 251/475 (52.84%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   +     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   21 EREALGGLDSRLFGFVRFHE-DGARTKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATVLQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 411          
BLAST of utx vs. Ensembl Human
Match: KDM6A (lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC:12637])

HSP 1 Score: 518.464 bits (1334), Expect = 1.613e-159
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  866 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1321          

HSP 2 Score: 284.648 bits (727), Expect = 1.102e-77
Identity = 159/381 (41.73%), Postives = 218/381 (57.22%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSS 1240
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S
Sbjct:   21 EREALGGLDSRLFGFVRFHE-DGARTKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATVLQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRS 357          
BLAST of utx vs. Ensembl Celegans
Match: utx-1 (UTX (Ubiquitously transcribed TPR on X) homolog [Source:UniProtKB/TrEMBL;Acc:A0A131MBT2])

HSP 1 Score: 390.578 bits (1002), Expect = 4.878e-115
Identity = 191/474 (40.30%), Postives = 283/474 (59.70%), Query Frame = 2
Query: 2495 LLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKY 3916
            L+  TP + +D +K+  S EL++F     I  IR L   LR+DL +FSTK + E + N +IE R Q   PP+ N D   +   +C+S  S TT+ +YA YQ+  F    K E      +            + G S +       +    K  + I +GTN DLSD++KW  Q++EL+KLP F ++++  NMLSH G  + GMN+V+L+MKVPGCRTP HQ++N+  SININ+GPGDCEWF+VP +YWG ++ LCE+N +D LTG++WP +++L    IPV+RF Q+ GD+V+++ G +HWVQA GWCNN++WNV PL  +Q S+S+  YEYNKL+ +KS V M  + WQ+AKN+K T+  +Y   K  L+ SL    +  +Y+   +  +   TR   E +H C+ CECEVF I  +K I             ++   C+ CA   +  +  F A+ Q+  ++L  +YD+ KY
Sbjct:  677 LILKTPILTVDNRKEAQSLELQRFLDGSTISCIRGLTGCLRLDLSLFSTKAVAEIDGNQEIEIRTQYQLPPETNCDHASQQTWQCVSDPSYTTVNKYAEYQSESFKHTLKGEAEKIKKNVGG---------TRGPSPKRMKLYKRASSPPKHLKSIKYGTNIDLSDDTKWGKQINELSKLPAFCRLIAGSNMLSHLGHQVHGMNTVKLFMKVPGCRTPAHQDSNHMASININIGPGDCEWFAVPYEYWGKMHKLCEKNGVDLLTGTFWPIIDDLLDAGIPVHRFTQKAGDMVYVSGGAIHWVQASGWCNNISWNVAPLNFQQLSISLLSYEYNKLRRFKSEVPMQLMCWQVAKNVKFTNQLIYNTCKGVLIRSLAFLRMVADYIVSQKKTIKAHTRTSGEQSHFCMTCECEVFCILFVKDIGG-----------KFTVFCVYCA--KSQGIEGFIALQQFSFTDLYSIYDNMKY 1128          

HSP 2 Score: 175.252 bits (443), Expect = 6.315e-44
Identity = 123/366 (33.61%), Postives = 180/366 (49.18%), Query Frame = 2
Query:  482 YGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFT-ETEIRFQIAHLLEVCGKYKQAQKAYEQLI-------GFSKE---------DAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQA-RENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVE-IKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            +GL + Y HF  +  +IE F ++LY  P    + +  +RLG  Y    +++  +  F+ A+NDS +  F  +  I++ IA   E   + + A+  YE LI        F +          D    +K  C RQ+GW+++              K +  NL+  A + D   G+++Y  GR     E    DAF+ YR SIDK E NADTWCSIG LYQ QNQP+DALQA+ CA +L+  H AAWT+LG LYE   QY++AL+C++NA+    NN V  E IK R+  ++K L+ +P                 RP  H + +T                      +P++ EA+  PIP EL  RQ
Sbjct:  143 FGLGLVYLHFKQWKPAIEAFTRLLYSFPTGMIALQAKVRLGVCYMELEDYNRCINLFKLAVNDSDESVFMPKFTIKYNIALSHENNDELEIAESEYENLITELTQHISFLQSKSNVDQQQVDLLISVKAACLRQIGWISYRRSYKDDANRLDHLKKAQENLIS-AHDTDPRDGQSYYYLGRVYGEHEPSAHDAFVNYRFSIDKKEQNADTWCSIGALYQRQNQPIDALQAFICAIELNSTHSAAWTDLGELYEKNAQYQDALECFKNAM---LNNPVAPEPIKARVQFLEKELS-MP--------------VPARPSNHASSSTF------------------ETVIPSLKEAYEQPIPLELRNRQ 471          
BLAST of utx vs. Ensembl Celegans
Match: utx-1 (UTX (Ubiquitously transcribed TPR on X) homolog [Source:UniProtKB/TrEMBL;Acc:A0A131MBT2])

HSP 1 Score: 390.578 bits (1002), Expect = 5.030e-115
Identity = 191/474 (40.30%), Postives = 283/474 (59.70%), Query Frame = 2
Query: 2495 LLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKY 3916
            L+  TP + +D +K+  S EL++F     I  IR L   LR+DL +FSTK + E + N +IE R Q   PP+ N D   +   +C+S  S TT+ +YA YQ+  F    K E      +            + G S +       +    K  + I +GTN DLSD++KW  Q++EL+KLP F ++++  NMLSH G  + GMN+V+L+MKVPGCRTP HQ++N+  SININ+GPGDCEWF+VP +YWG ++ LCE+N +D LTG++WP +++L    IPV+RF Q+ GD+V+++ G +HWVQA GWCNN++WNV PL  +Q S+S+  YEYNKL+ +KS V M  + WQ+AKN+K T+  +Y   K  L+ SL    +  +Y+   +  +   TR   E +H C+ CECEVF I  +K I             ++   C+ CA   +  +  F A+ Q+  ++L  +YD+ KY
Sbjct:  682 LILKTPILTVDNRKEAQSLELQRFLDGSTISCIRGLTGCLRLDLSLFSTKAVAEIDGNQEIEIRTQYQLPPETNCDHASQQTWQCVSDPSYTTVNKYAEYQSESFKHTLKGEAEKIKKNVGG---------TRGPSPKRMKLYKRASSPPKHLKSIKYGTNIDLSDDTKWGKQINELSKLPAFCRLIAGSNMLSHLGHQVHGMNTVKLFMKVPGCRTPAHQDSNHMASININIGPGDCEWFAVPYEYWGKMHKLCEKNGVDLLTGTFWPIIDDLLDAGIPVHRFTQKAGDMVYVSGGAIHWVQASGWCNNISWNVAPLNFQQLSISLLSYEYNKLRRFKSEVPMQLMCWQVAKNVKFTNQLIYNTCKGVLIRSLAFLRMVADYIVSQKKTIKAHTRTSGEQSHFCMTCECEVFCILFVKDIGG-----------KFTVFCVYCA--KSQGIEGFIALQQFSFTDLYSIYDNMKY 1133          

HSP 2 Score: 171.4 bits (433), Expect = 8.897e-43
Identity = 122/371 (32.88%), Postives = 179/371 (48.25%), Query Frame = 2
Query:  482 YGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFT-ETEIRFQIAHLLEVCGKYKQAQKAYEQLI-------GFSKE---------DAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENK------VQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVE-IKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            +GL + Y HF  +  +IE F ++LY  P    + +  +RLG  Y    +++  +  F+ A+NDS +  F  +  I++ IA   E   + + A+  YE LI        F +          D    +K  C RQ+GW+++              K +  NL+  A + D   G+++Y  GR               DAF+ YR SIDK E NADTWCSIG LYQ QNQP+DALQA+ CA +L+  H AAWT+LG LYE   QY++AL+C++NA+    NN V  E IK R+  ++K L+ +P                 RP  H + +T                      +P++ EA+  PIP EL  RQ
Sbjct:  143 FGLGLVYLHFKQWKPAIEAFTRLLYSFPTGMIALQAKVRLGVCYMELEDYNRCINLFKLAVNDSDESVFMPKFTIKYNIALSHENNDELEIAESEYENLITELTQHISFLQSKSNVDQQQVDLLISVKAACLRQIGWISYRRSYKDDANRLDHLKKAQENLIS-AHDTDPRDGQSYYYLGRVYGEHEPSVSGQVAHDAFVNYRFSIDKKEQNADTWCSIGALYQRQNQPIDALQAFICAIELNSTHSAAWTDLGELYEKNAQYQDALECFKNAM---LNNPVAPEPIKARVQFLEKELS-MP--------------VPARPSNHASSSTF------------------ETVIPSLKEAYEQPIPLELRNRQ 476          
BLAST of utx vs. Ensembl Celegans
Match: jmjd-3.1 (Lysine-specific demethylase jmjd-3.1 [Source:UniProtKB/Swiss-Prot;Acc:Q95QK3])

HSP 1 Score: 194.897 bits (494), Expect = 3.045e-50
Identity = 136/492 (27.64%), Postives = 236/492 (47.97%), Query Frame = 2
Query: 2483 EYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRK-----------IYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKN-IKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREE---NEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSF-KAIYQYKLSELVEVYDSF 3910
            +Y +   P P++ +  K++V S +  +   S  I  I  +A  L +   +FS   + + +P   I+   Q  Q  D N D+ G       S  S   +Q++  Y  +   EA +                  ++ISN T++EL+ +      E+   +            I FGTN DL  E+ +  Q++E+ KLP FL      N+L++ G  ++G+N+VQ+Y K  G RTP H EN+   SIN N GPG C WF+VP +YWG +  +  E+   Y    +WP+ +EL +  +PV +F Q+  ++V++N G  HWVQ+  +C NV+WNVG     Q + S+  +++N L   ++ V +V+L W  A+  + + D  +Y+ ++  ++ SL H    ++ ++      ++    E    +    C  C  E+FNI  ++   T  L+      V     C +C        + F K  + + L  LV ++D++
Sbjct:  553 DYHKYRIPCPTLTVTTKEEVFSSDFERILNSASITNISGIAKALNIKTELFSLPEIAKCHPELSIDILNQVPQSADGNCDSKGIRCWDVTSYSSKMKLQDFERYMQKEESEAMQ----------------AFETISNCTAKELESTCQKLKAERIAAQNAIEGCDETMPWIKFGTNIDLLSEN-FKKQMNEIEKLPTFLLPNREGNLLNYAGVDVLGINTVQMYAKPIGSRTPAHMENSLMASINWNRGPGTCVWFAVPYEYWGQLEFMIGEHGHKYQDQDYWPSEKELLELGVPVIKFEQKADEMVYVNTGCFHWVQSNSFCINVSWNVGQPNFTQLATSIVAHDHNMLIGNQAHVPLVNLVWNAARQRLFVDDPEMYKAMRGVMIRSLAHSKWYFDLIDHH--DYIVGDASEWKLADRVQRCKYCTSEIFNI--VRWYTTEDLS------VDSYPFCSHCHVANEYKKDRFLKYTWFFSLETLVNIFDAY 1017          
BLAST of utx vs. Ensembl Celegans
Match: jmjd-3.1 (Lysine-specific demethylase jmjd-3.1 [Source:UniProtKB/Swiss-Prot;Acc:Q95QK3])

HSP 1 Score: 194.512 bits (493), Expect = 4.368e-50
Identity = 136/492 (27.64%), Postives = 236/492 (47.97%), Query Frame = 2
Query: 2483 EYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRK-----------IYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKN-IKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREE---NEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSF-KAIYQYKLSELVEVYDSF 3910
            +Y +   P P++ +  K++V S +  +   S  I  I  +A  L +   +FS   + + +P   I+   Q  Q  D N D+ G       S  S   +Q++  Y  +   EA +                  ++ISN T++EL+ +      E+   +            I FGTN DL  E+ +  Q++E+ KLP FL      N+L++ G  ++G+N+VQ+Y K  G RTP H EN+   SIN N GPG C WF+VP +YWG +  +  E+   Y    +WP+ +EL +  +PV +F Q+  ++V++N G  HWVQ+  +C NV+WNVG     Q + S+  +++N L   ++ V +V+L W  A+  + + D  +Y+ ++  ++ SL H    ++ ++      ++    E    +    C  C  E+FNI  ++   T  L+      V     C +C        + F K  + + L  LV ++D++
Sbjct:  594 DYHKYRIPCPTLTVTTKEEVFSSDFERILNSASITNISGIAKALNIKTELFSLPEIAKCHPELSIDILNQVPQSADGNCDSKGIRCWDVTSYSSKMKLQDFERYMQKEESEAMQ----------------AFETISNCTAKELESTCQKLKAERIAAQNAIEGCDETMPWIKFGTNIDLLSEN-FKKQMNEIEKLPTFLLPNREGNLLNYAGVDVLGINTVQMYAKPIGSRTPAHMENSLMASINWNRGPGTCVWFAVPYEYWGQLEFMIGEHGHKYQDQDYWPSEKELLELGVPVIKFEQKADEMVYVNTGCFHWVQSNSFCINVSWNVGQPNFTQLATSIVAHDHNMLIGNQAHVPLVNLVWNAARQRLFVDDPEMYKAMRGVMIRSLAHSKWYFDLIDHH--DYIVGDASEWKLADRVQRCKYCTSEIFNI--VRWYTTEDLS------VDSYPFCSHCHVANEYKKDRFLKYTWFFSLETLVNIFDAY 1058          
BLAST of utx vs. Ensembl Celegans
Match: jmjd-3.3 (JuMonJi (Transcription factor) Domain protein [Source:UniProtKB/TrEMBL;Acc:A0A131MD67])

HSP 1 Score: 180.644 bits (457), Expect = 7.591e-50
Identity = 103/320 (32.19%), Postives = 164/320 (51.25%), Query Frame = 2
Query: 2966 FGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEK--ARVQMVLQTREENEHTHHCVDCECE---VFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            F TN DL +E K+   + EL+KLPNFLK     N   +   +I G+N VQ+Y K PG RT  H EN    S+N+N+GPG C W++V  ++      L  +  +       WPN EEL    IPV +FIQ   D V++  GT HWVQ+IG+  NV+WN+      Q++++   +++N  + Y S++ ++ ++W+MAK      + +Y LIK  L  SL   T   +  +   A++  +     E  H   C   +C+   +FN  +IKQ   N          + E  C++C      N+     I ++ ++ELV +Y+ +
Sbjct:   26 FATNVDLKEEQKFQPLIQELDKLPNFLKTKGGLN--EYIKESIGGVNEVQMYFKQPGSRTTCHIENQAIGSLNLNLGPGKCIWYAVASEHSAKFEQLLMKKNLWPYDSVLWPNEEELLNWGIPVMKFIQETDDTVYVGTGTYHWVQSIGFTGNVSWNIAESTFDQFAMAALVHDHNTEQSYDSVLPIIPMAWEMAKKRAFLGTEMYPLIKSILARSLAKSTFELDKAKSAGAKISNIEDASVELSHVERCQGKKCKRDVLFNTVVIKQNSRN----------KTEKLCVDCCH----NMKGSTVIMRHTINELVTIYNEY 329          
BLAST of utx vs. Ensembl Fly
Match: Utx (gene:FBgn0260749 transcript:FBtr0333410)

HSP 1 Score: 536.569 bits (1381), Expect = 6.534e-171
Identity = 259/488 (53.07%), Postives = 343/488 (70.29%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKD-ANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYS 3943
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN D + GK +  C+S +S TTI +YA YQA  F ++ KDE +     S        Q++S+  S++   ++N   + KK +   + + FGTN DLSDE KW  QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG ++ LCE+N I YL GSWWP LE+L +  IPVYRFIQ+PGDLVW+NAG VHWVQ+IGWCNN+AWNVGPL +RQYSL++ERYE+NK++ +KSIV MVHLSW +A+NIK++D+ L++LIK  L+ +L +      Y++   V++    R +NE +H+C  CE EVFN+  IK           +++ R+   CL+CA K++P+L     + +Y+LSEL  VYDSF    +   AY+
Sbjct:  465 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKDESDKGFPGS--------QAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIK-----------EQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYT 933          

HSP 2 Score: 205.682 bits (522), Expect = 9.558e-54
Identity = 124/308 (40.26%), Postives = 179/308 (58.12%), Query Frame = 2
Query:  629 FDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWL-NFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNA---VSSDKNNEVR----VEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            F  +LKH + AL  +   +F+E +++FQIAHL EV  K+K A+  YE L+  ++++    +K   YRQLGW+ +    +G+       ++ + +N LQ+++  D  SG++ YL GR  A  NKV DAF+AYRNS++K+E NADTWCSIGVLYQ+QNQP DALQAY CA QLD+ H AAWTNLG+LYES GQ ++A  CY NA   +S  K++ +R    + +K   + + K L+Q        +I+  +      P P                       S   +L +++EAWNLPI  E+  RQ Q
Sbjct:    8 FHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL--NEKNISLELKADVYRQLGWMYHCVECLGEKK----EREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQ--------RITFLEGQLSQAPLP--------------------SITSKRRQLCSIEEAWNLPISLEMNSRQQQ 281          
BLAST of utx vs. Ensembl Fly
Match: Utx (gene:FBgn0260749 transcript:FBtr0080077)

HSP 1 Score: 531.561 bits (1368), Expect = 6.473e-169
Identity = 258/488 (52.87%), Postives = 342/488 (70.08%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKD-ANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYS 3943
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN D + GK +  C+S +S TTI +YA YQA  F ++ K             G  G+Q++S+  S++   ++N   + KK +   + + FGTN DLSDE KW  QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG ++ LCE+N I YL GSWWP LE+L +  IPVYRFIQ+PGDLVW+NAG VHWVQ+IGWCNN+AWNVGPL +RQYSL++ERYE+NK++ +KSIV MVHLSW +A+NIK++D+ L++LIK  L+ +L +      Y++   V++    R +NE +H+C  CE EVFN+  IK           +++ R+   CL+CA K++P+L     + +Y+LSEL  VYDSF    +   AY+
Sbjct:  465 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLK---LILPQDESDKGFPGSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIK-----------EQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYT 938          

HSP 2 Score: 204.912 bits (520), Expect = 1.390e-53
Identity = 124/308 (40.26%), Postives = 179/308 (58.12%), Query Frame = 2
Query:  629 FDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWL-NFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNA---VSSDKNNEVR----VEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            F  +LKH + AL  +   +F+E +++FQIAHL EV  K+K A+  YE L+  ++++    +K   YRQLGW+ +    +G+       ++ + +N LQ+++  D  SG++ YL GR  A  NKV DAF+AYRNS++K+E NADTWCSIGVLYQ+QNQP DALQAY CA QLD+ H AAWTNLG+LYES GQ ++A  CY NA   +S  K++ +R    + +K   + + K L+Q        +I+  +      P P                       S   +L +++EAWNLPI  E+  RQ Q
Sbjct:    8 FHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL--NEKNISLELKADVYRQLGWMYHCVECLGEKK----EREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQ--------RITFLEGQLSQAPLP--------------------SITSKRRQLCSIEEAWNLPISLEMNSRQQQ 281          
BLAST of utx vs. Ensembl Fly
Match: Utx (gene:FBgn0260749 transcript:FBtr0080076)

HSP 1 Score: 531.561 bits (1368), Expect = 6.473e-169
Identity = 258/488 (52.87%), Postives = 342/488 (70.08%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKD-ANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYS 3943
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN D + GK +  C+S +S TTI +YA YQA  F ++ K             G  G+Q++S+  S++   ++N   + KK +   + + FGTN DLSDE KW  QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG ++ LCE+N I YL GSWWP LE+L +  IPVYRFIQ+PGDLVW+NAG VHWVQ+IGWCNN+AWNVGPL +RQYSL++ERYE+NK++ +KSIV MVHLSW +A+NIK++D+ L++LIK  L+ +L +      Y++   V++    R +NE +H+C  CE EVFN+  IK           +++ R+   CL+CA K++P+L     + +Y+LSEL  VYDSF    +   AY+
Sbjct:  465 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLK---LILPQDESDKGFPGSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIK-----------EQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYT 938          

HSP 2 Score: 204.912 bits (520), Expect = 1.390e-53
Identity = 124/308 (40.26%), Postives = 179/308 (58.12%), Query Frame = 2
Query:  629 FDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWL-NFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNA---VSSDKNNEVR----VEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            F  +LKH + AL  +   +F+E +++FQIAHL EV  K+K A+  YE L+  ++++    +K   YRQLGW+ +    +G+       ++ + +N LQ+++  D  SG++ YL GR  A  NKV DAF+AYRNS++K+E NADTWCSIGVLYQ+QNQP DALQAY CA QLD+ H AAWTNLG+LYES GQ ++A  CY NA   +S  K++ +R    + +K   + + K L+Q        +I+  +      P P                       S   +L +++EAWNLPI  E+  RQ Q
Sbjct:    8 FHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL--NEKNISLELKADVYRQLGWMYHCVECLGEKK----EREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQ--------RITFLEGQLSQAPLP--------------------SITSKRRQLCSIEEAWNLPISLEMNSRQQQ 281          
BLAST of utx vs. Ensembl Fly
Match: Utx (gene:FBgn0260749 transcript:FBtr0303903)

HSP 1 Score: 536.954 bits (1382), Expect = 1.011e-168
Identity = 259/488 (53.07%), Postives = 343/488 (70.29%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKD-ANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYS 3943
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN D + GK +  C+S +S TTI +YA YQA  F ++ KDE +     S        Q++S+  S++   ++N   + KK +   + + FGTN DLSDE KW  QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG ++ LCE+N I YL GSWWP LE+L +  IPVYRFIQ+PGDLVW+NAG VHWVQ+IGWCNN+AWNVGPL +RQYSL++ERYE+NK++ +KSIV MVHLSW +A+NIK++D+ L++LIK  L+ +L +      Y++   V++    R +NE +H+C  CE EVFN+  IK           +++ R+   CL+CA K++P+L     + +Y+LSEL  VYDSF    +   AY+
Sbjct:  661 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKDESDKGFPGS--------QAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIK-----------EQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYT 1129          

HSP 2 Score: 256.914 bits (655), Expect = 1.420e-69
Identity = 150/378 (39.68%), Postives = 216/378 (57.14%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWL-NFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAV------SSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            ++  YL F  R  + W N  FIYG+ + YF    F  +I+ FQ++LYL PN + + E+H+RLG + K    F  +LKH + AL  +   +F+E +++FQIAHL EV  K+K A+  YE L+  ++++    +K   YRQLGW+ +    +G+       ++ + +N LQ+++  D  SG++ YL GR  A  NKV DAF+AYRNS++K+E NADTWCSIGVLYQ+QNQP DALQAY CA QLD+ H AAWTNLG+LYES GQ ++A  CY NA       SS    +  + +K   + + K L+Q        +I+  +      P P                       S   +L +++EAWNLPI  E+  RQ Q
Sbjct:  136 AYQKYLRF--RENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLYLSPNFTCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL--NEKNISLELKADVYRQLGWMYHCVECLGEKK----EREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQSSLIRKKQAIRMKKDTIGLSKGLSQ--------RITFLEGQLSQAPLP--------------------SITSKRRQLCSIEEAWNLPISLEMNSRQQQ 477          
BLAST of utx vs. Ensembl Fly
Match: Utx (gene:FBgn0260749 transcript:FBtr0080075)

HSP 1 Score: 531.561 bits (1368), Expect = 9.488e-167
Identity = 258/488 (52.87%), Postives = 342/488 (70.08%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKD-ANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYS 3943
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN D + GK +  C+S +S TTI +YA YQA  F ++ K             G  G+Q++S+  S++   ++N   + KK +   + + FGTN DLSDE KW  QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG ++ LCE+N I YL GSWWP LE+L +  IPVYRFIQ+PGDLVW+NAG VHWVQ+IGWCNN+AWNVGPL +RQYSL++ERYE+NK++ +KSIV MVHLSW +A+NIK++D+ L++LIK  L+ +L +      Y++   V++    R +NE +H+C  CE EVFN+  IK           +++ R+   CL+CA K++P+L     + +Y+LSEL  VYDSF    +   AY+
Sbjct:  662 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLK---LILPQDESDKGFPGSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIK-----------EQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYT 1135          

HSP 2 Score: 258.455 bits (659), Expect = 3.921e-70
Identity = 151/379 (39.84%), Postives = 220/379 (58.05%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWL-NFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNA---VSSDKNNEVR----VEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            ++  YL F  R  + W N  FIYG+ + YF    F  +I+ FQ++LYL PN + + E+H+RLG + K    F  +LKH + AL  +   +F+E +++FQIAHL EV  K+K A+  YE L+  ++++    +K   YRQLGW+ +    +G+       ++ + +N LQ+++  D  SG++ YL GR  A  NKV DAF+AYRNS++K+E NADTWCSIGVLYQ+QNQP DALQAY CA QLD+ H AAWTNLG+LYES GQ ++A  CY NA   +S  K++ +R    + +K   + + K L+Q        +I+  +      P P                       S   +L +++EAWNLPI  E+  RQ Q
Sbjct:  136 AYQKYLRF--RENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLYLSPNFTCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQNKHKAAKDGYEFLL--NEKNISLELKADVYRQLGWMYHCVECLGEKK----EREANALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRMKKDTIGLSKGLSQ--------RITFLEGQLSQAPLP--------------------SITSKRRQLCSIEEAWNLPISLEMNSRQQQ 478          
BLAST of utx vs. Ensembl Zebrafish
Match: kdm6a (lysine (K)-specific demethylase 6A [Source:ZFIN;Acc:ZDB-GENE-081105-56])

HSP 1 Score: 523.087 bits (1346), Expect = 6.617e-161
Identity = 250/476 (52.52%), Postives = 319/476 (67.02%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC   + P+ VIR LA  L++DLG+FSTK LVE NP H +E R Q  QP DEN D  G + + RC SS+S TTI  YA YQA  F E+ ++E                +   + +  E   S N     +   + I FGTN DLSDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+VPE YWG +N  CE+N I+YL GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GTVHWVQAIGWCNN+AWNVGPL   QY L++ERYE+NKL+  KSIV M+HLSW MA+NIK++D  L+++IKY L+ +L  C +    L  A  ++V   R ++E  H+C  CE EVF++  +        T +      Y   C  CA + +PNL++F  + QYK+ +L++VYD F
Sbjct:  924 KLNPPTPSIYLENKRDAFFPPLHQFCTNTANPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVRTQLSQPTDENWDVTGSRKMWRCESSRSHTTIARYAQYQASSFQESLREENEK-------------KGQKDHSDTESAPSENVVRRRRGPFKHIKFGTNIDLSDEKKWKLQLAELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVPEPYWGVMNDFCEKNNINYLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWLNTGTVHWVQAIGWCNNIAWNVGPLTVHQYKLAVERYEWNKLQSVKSIVPMIHLSWNMARNIKVSDHKLFEMIKYCLLRTLKQCQMLREALIAAGKELVWHGRTKDEPAHYCSICEVEVFDLLFV--------TSESNSRKTYVVHCQGCARRCSPNLDNFVVLEQYKIDDLMQVYDQF 1378          

HSP 2 Score: 302.368 bits (773), Expect = 2.022e-83
Identity = 173/411 (42.09%), Postives = 243/411 (59.12%), Query Frame = 2
Query:  305 KQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIG-KSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQL 1531
            K    YD  I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ EI+F IAH+ E+  KY+ A++AYE L+    E+ P  +K    +QLGW++ +   +G K+N N+       I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   + +   +  R+  +Q  L  L +                         ++P               S    LP+++EAW+LPIP ELT RQ  L
Sbjct:   77 KAVRCYDVYILKAEGKVEPEVFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFRWAIKAFQEVLYIDPCFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSTPCTLSKAEIQFHIAHVYEIQKKYRIAKEAYESLL--QTENLPAQVKATTLQQLGWMHHTVEQLGDKANKNS-----YAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPQDAIKCYINATCSKSCSNIPA-LTARIKCLQAQLCNLQQ------------------------GSLP---------------SKSKMLPSIEEAWSLPIPAELTSRQGAL 440          
BLAST of utx vs. Ensembl Zebrafish
Match: kdm6a (lysine (K)-specific demethylase 6A [Source:ZFIN;Acc:ZDB-GENE-081105-56])

HSP 1 Score: 523.472 bits (1347), Expect = 1.372e-160
Identity = 250/476 (52.52%), Postives = 319/476 (67.02%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC   + P+ VIR LA  L++DLG+FSTK LVE NP H +E R Q  QP DEN D  G + + RC SS+S TTI  YA YQA  F E+ ++E                +   + +  E   S N     +   + I FGTN DLSDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+VPE YWG +N  CE+N I+YL GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GTVHWVQAIGWCNN+AWNVGPL   QY L++ERYE+NKL+  KSIV M+HLSW MA+NIK++D  L+++IKY L+ +L  C +    L  A  ++V   R ++E  H+C  CE EVF++  +        T +      Y   C  CA + +PNL++F  + QYK+ +L++VYD F
Sbjct:  986 KLNPPTPSIYLENKRDAFFPPLHQFCTNTANPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVRTQLSQPTDENWDVTGSRKMWRCESSRSHTTIARYAQYQASSFQESLREENEK-------------KGQKDHSDTESAPSENVVRRRRGPFKHIKFGTNIDLSDEKKWKLQLAELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVPEPYWGVMNDFCEKNNINYLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWLNTGTVHWVQAIGWCNNIAWNVGPLTVHQYKLAVERYEWNKLQSVKSIVPMIHLSWNMARNIKVSDHKLFEMIKYCLLRTLKQCQMLREALIAAGKELVWHGRTKDEPAHYCSICEVEVFDLLFV--------TSESNSRKTYVVHCQGCARRCSPNLDNFVVLEQYKIDDLMQVYDQF 1440          

HSP 2 Score: 294.664 bits (753), Expect = 7.321e-81
Identity = 173/426 (40.61%), Postives = 244/426 (57.28%), Query Frame = 2
Query:  305 KQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFD---------------KSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIG-KSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQL 1531
            K    YD  I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF                ++I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ EI+F IAH+ E+  KY+ A++AYE L+    E+ P  +K    +QLGW++ +   +G K+N N+       I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   + +   +  R+  +Q  L  L +                         ++P               S    LP+++EAW+LPIP ELT RQ  L
Sbjct:   77 KAVRCYDVYILKAEGKVEPEVFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFRWAVQLTPSDAQSGQRRAIKAFQEVLYIDPCFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSTPCTLSKAEIQFHIAHVYEIQKKYRIAKEAYESLL--QTENLPAQVKATTLQQLGWMHHTVEQLGDKANKNS-----YAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPQDAIKCYINATCSKSCSNIPA-LTARIKCLQAQLCNLQQ------------------------GSLP---------------SKSKMLPSIEEAWSLPIPAELTSRQGAL 455          
BLAST of utx vs. Ensembl Zebrafish
Match: kdm6ba (lysine (K)-specific demethylase 6B, a [Source:ZFIN;Acc:ZDB-GENE-091005-1])

HSP 1 Score: 497.278 bits (1279), Expect = 1.027e-147
Identity = 240/482 (49.79%), Postives = 326/482 (67.63%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSP 3928
            +L PPTPS+YL+ K+D  SP L QFC     PI VIR LA +LR++LG+FSTK LVE N  H +E R Q  QP DEN DA+G      C SS+S TTI +YA YQA  F E+ ++EK  +                  ++     + NSS E+K   + I FGTN DLSD  +W  QL EL KLP F++V S+ NMLSH G TI+GMN+VQLYMK+PGCRTPGHQENNNFCS+NIN+GPGDCEWF+V + YW AI+  C+++ +DYLTGSWWP L++L +  IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGP+ + QY +++ER+E+N++K  KSIV M+H+SW +A+ +K+TD   Y +IK+ L+ S+ H  +  + L  A +++  Q+R ++E  ++C +C+ EVFN+  +        T +      Y   C +CA + +PNL++   + QY++ EL+ +YDSF    SP
Sbjct: 1524 KLNPPTPSIYLESKRDAFSPVLLQFCTDPKNPITVIRGLAGSLRLNLGLFSTKSLVEANSEHAVEVRTQVQQPADENWDASGTGQTWPCESSRSHTTIAKYAQYQASSFQESLQEEKGSDAEEDNDEKPTTKAE----STTSNSSAPNSSSEQKTVGKIIKFGTNIDLSDPKRWKPQLQELQKLPAFMRVSSSGNMLSHVGHTILGMNTVQLYMKIPGCRTPGHQENNNFCSVNINIGPGDCEWFAVHDDYWEAISDFCQKHGVDYLTGSWWPVLDDLYRANIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPVNAYQYQVALERFEWNEVKKVKSIVPMIHVSWNVARTVKVTDPDAYNMIKHCLLQSIKHIQILRDQLVAAGMKISYQSRVKDEPAYYCNECDVEVFNLLFV--------TSENGSRKMYVVHCEDCARQRSPNLSNVVVLEQYRMEELMNMYDSFSLAVSP 1993          
BLAST of utx vs. Ensembl Zebrafish
Match: kdm6al (lysine (K)-specific demethylase 6A, like [Source:ZFIN;Acc:ZDB-GENE-070112-2002])

HSP 1 Score: 484.182 bits (1245), Expect = 2.930e-147
Identity = 236/481 (49.06%), Postives = 315/481 (65.49%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRK-----IYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC   S P+ VIR LA  L++DLG+FSTK LV+ NP H +E R Q  QP DEN DA+G +   RC S++S TTI +YA YQA  F E+ ++E                        +EL  S  +S E   +RRK     + FG N D+SDE KW  QL EL+KLP F +VVSA N+LSH G  I+GMN+VQL MKVPG RTPGHQE+NNFC++NIN+GPGDCEWF+VPE YWG ++  CE N I++L GSWWPNLE+L + ++PVYRFIQRPGDLVW+N GTVHW QAIGWCNN++WNVGPL + QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK+ D  L+++IK+ L+ +L         L  A  + + Q R  +E  H+C  CE EV+N+  +    +      C+       +C +CA K + +L  F  + Q+++ +L ++Y+ F
Sbjct:  845 KLNPPTPSIYLENKRDAFFPPLHQFCTNPSNPVTVIRGLAGALKLDLGLFSTKTLVDMNPEHLVEVRTQLSQPADENWDASGTRKQWRCESTRSHTTIAKYAQYQAASFQESLREENEKKGQ------------------KELSDSEIASSESVCRRRKGPFKQVKFGMNIDVSDEKKWKLQLQELSKLPAFARVVSAGNLLSHVGHRILGMNTVQLCMKVPGSRTPGHQEHNNFCAVNINIGPGDCEWFAVPEPYWGVMSEFCERNNINFLKGSWWPNLEDLYEARVPVYRFIQRPGDLVWLNTGTVHWGQAIGWCNNISWNVGPLTAHQYKLAVERYEWNKLQSVKSMVPMVHLSWNMARNIKVADQRLFEMIKFCLLRTLRQTQSIRESLLSAGKETLWQRRSRDEPAHYCSVCEVEVWNLLFVCSEGS-----PCRPAA--AVQCQDCARKASVDLQGFVVLQQFRMEDLTQLYEQF 1300          

HSP 2 Score: 287.73 bits (735), Expect = 6.821e-79
Identity = 150/314 (47.77%), Postives = 208/314 (66.24%), Query Frame = 2
Query:  305 KQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDS-VINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSS 1240
            K    Y+ +I   +  +DP  +  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS + + ++ EI+F IAHL E+  +++ A++AYE L+    ED    ++    +QLGW++ +   +G       + KDS  I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q  +A+KCY NA  S
Sbjct:   75 KAVRCYESLILKAEGKVDPEFFCQLGHFNLLLEEYPKALSAYQRYYSLQSDYWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSSRCTLSKAEIQFHIAHLYEIQKRHRAAKEAYESLL--QTEDLQTPVRAAALQQLGWMHHTVEQLGDK-----ANKDSYAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPHDAIKCYINATRS 381          
BLAST of utx vs. Ensembl Zebrafish
Match: kdm6bb (lysine (K)-specific demethylase 6B, b [Source:ZFIN;Acc:ZDB-GENE-040724-166])

HSP 1 Score: 488.419 bits (1256), Expect = 5.808e-146
Identity = 241/482 (50.00%), Postives = 327/482 (67.84%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQ--PIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSP 3928
            +L PPTPS+YL+ K+D  SP L QFC      + VIR LA +LR++LG+FSTK LVE N  H +E R Q  QP DEN + +G      C SS+S TTI +YA YQA  F E+ ++EK+  +          N++ SN  +     S  +S ++K   + I FGTN DLSD  +W AQL EL KLP F++V S  NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+V E YW AI+  CE++ +DYLTGSWWP LE+L +  IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL + QY L++ER+E+N++K  KSIV M+H+SW +A+ IK+TD + +++IK+ LM S+ H  +  + L  A  ++  Q+R ++E  ++C +C+ EVF++  +    ++  T        Y   C +CA + +P LN    + QY++ EL+ +YD+F   + P
Sbjct: 1243 KLNPPTPSIYLESKRDAFSPVLLQFCTDSKNAVTVIRGLAGSLRLNLGLFSTKSLVEANSEHAVEVRTQVQQPADENWNHSGSAQTWPCESSRSHTTIAKYAQYQASSFQESLQEEKDSEDEDEEDKSKEKNEAKSNSQNNIGTTSTTTSSKQKAVGKIIKFGTNIDLSDPKRWKAQLQELLKLPAFMRVSSTANMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWKAISDFCEKHGVDYLTGSWWPVLEDLYRSNIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNAYQYQLALERFEWNEVKKVKSIVPMIHVSWNVARTIKITDPNTFKMIKHCLMQSIKHIQILRDQLVSAGKKISYQSRVKDEPAYYCNECDLEVFDLLFVTSENSSRKT--------YVVHCEDCARERSPGLNGVVVLEQYRIDELMNMYDNFTLSAVP 1716          
BLAST of utx vs. Ensembl Xenopus
Match: kdm6a (lysine demethylase 6A [Source:NCBI gene;Acc:100170558])

HSP 1 Score: 533.487 bits (1373), Expect = 5.656e-165
Identity = 259/476 (54.41%), Postives = 325/476 (68.28%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC SS+S TTI +YA YQA  F E+ ++E    +            S S  TS     S+NS    K   + I FGTN DLSDE KW  QLHEL KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YW  ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MAKNIK++D  L+++IKY L+ +L HC      L  + +++V   R ++E  H+C +CE EVFN+  +        TK+      Y   C +C+ K  PNL +F  + Q+K+ EL+++YD F
Sbjct:  880 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPTGTKKIWRCESSRSHTTIAKYAQYQAASFQESLREENEKKSQHKD-------HSDSESTS-----SDNSGRRRKGPFKTIKFGTNIDLSDERKWKLQLHELTKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPETYWSVMHDFCEKNNINFLLGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTAFQYKLAVERYEWNKLQCVKSIVPMVHLSWNMAKNIKVSDPKLFEMIKYCLLRTLKHCQALREVLNASGIEIVWHGRTKDEPAHYCSNCEVEVFNLLFV--------TKESNSQKTYVVHCHDCSRKSCPNLENFVVLEQFKMEELMQIYDLF 1335          

HSP 2 Score: 305.064 bits (780), Expect = 2.722e-84
Identity = 160/370 (43.24%), Postives = 221/370 (59.73%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            + SAY  + S   D WKN  F+YGL + YFH+NAF  +I  FQ++LY++P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + ++ EI+F IAHL E   KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:  114 ALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFHWAIRAFQEVLYVEPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDCNPCTLSKAEIQFHIAHLYETQKKYHSAKEAYEQLL--QTENLPTQVKATVLQQLGWMHHTVDQLG----DKATKASYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCNNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. Ensembl Xenopus
Match: kdm6a (lysine demethylase 6A [Source:NCBI gene;Acc:100170558])

HSP 1 Score: 533.487 bits (1373), Expect = 6.412e-165
Identity = 259/476 (54.41%), Postives = 325/476 (68.28%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC SS+S TTI +YA YQA  F E+ ++E    +            S S  TS     S+NS    K   + I FGTN DLSDE KW  QLHEL KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YW  ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MAKNIK++D  L+++IKY L+ +L HC      L  + +++V   R ++E  H+C +CE EVFN+  +        TK+      Y   C +C+ K  PNL +F  + Q+K+ EL+++YD F
Sbjct:  895 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPTGTKKIWRCESSRSHTTIAKYAQYQAASFQESLREENEKKSQHKD-------HSDSESTS-----SDNSGRRRKGPFKTIKFGTNIDLSDERKWKLQLHELTKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPETYWSVMHDFCEKNNINFLLGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTAFQYKLAVERYEWNKLQCVKSIVPMVHLSWNMAKNIKVSDPKLFEMIKYCLLRTLKHCQALREVLNASGIEIVWHGRTKDEPAHYCSNCEVEVFNLLFV--------TKESNSQKTYVVHCHDCSRKSCPNLENFVVLEQFKMEELMQIYDLF 1350          

HSP 2 Score: 305.064 bits (780), Expect = 2.696e-84
Identity = 160/370 (43.24%), Postives = 221/370 (59.73%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            + SAY  + S   D WKN  F+YGL + YFH+NAF  +I  FQ++LY++P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + ++ EI+F IAHL E   KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:  114 ALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFHWAIRAFQEVLYVEPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDCNPCTLSKAEIQFHIAHLYETQKKYHSAKEAYEQLL--QTENLPTQVKATVLQQLGWMHHTVDQLG----DKATKASYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCNNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. Ensembl Xenopus
Match: kdm6a (lysine demethylase 6A [Source:NCBI gene;Acc:100170558])

HSP 1 Score: 534.258 bits (1375), Expect = 1.220e-164
Identity = 259/476 (54.41%), Postives = 325/476 (68.28%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC SS+S TTI +YA YQA  F E+ ++E    +            S S  TS     S+NS    K   + I FGTN DLSDE KW  QLHEL KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YW  ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MAKNIK++D  L+++IKY L+ +L HC      L  + +++V   R ++E  H+C +CE EVFN+  +        TK+      Y   C +C+ K  PNL +F  + Q+K+ EL+++YD F
Sbjct:  952 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPTGTKKIWRCESSRSHTTIAKYAQYQAASFQESLREENEKKSQHKD-------HSDSESTS-----SDNSGRRRKGPFKTIKFGTNIDLSDERKWKLQLHELTKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPETYWSVMHDFCEKNNINFLLGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTAFQYKLAVERYEWNKLQCVKSIVPMVHLSWNMAKNIKVSDPKLFEMIKYCLLRTLKHCQALREVLNASGIEIVWHGRTKDEPAHYCSNCEVEVFNLLFV--------TKESNSQKTYVVHCHDCSRKSCPNLENFVVLEQFKMEELMQIYDLF 1407          

HSP 2 Score: 276.174 bits (705), Expect = 7.905e-75
Identity = 150/359 (41.78%), Postives = 210/359 (58.50%), Query Frame = 2
Query:  452 KDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQI-AHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            K   KN  F+YGL + YFH+NAF  +I  FQ++LY++P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + ++ E  F +  +L     KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   88 KSEGKNAAFLYGLGLVYFHYNAFHWAIRAFQEVLYVEPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDCNPCTLSKAETYFVLFMYLFFKQKKYHSAKEAYEQLL--QTENLPTQVKATVLQQLGWMHHTVDQLG----DKATKASYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCNNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 400          
BLAST of utx vs. Ensembl Xenopus
Match: kdm6a (lysine demethylase 6A [Source:NCBI gene;Acc:100170558])

HSP 1 Score: 533.102 bits (1372), Expect = 1.573e-164
Identity = 259/476 (54.41%), Postives = 325/476 (68.28%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC SS+S TTI +YA YQA  F E+ ++E    +            S S  TS     S+NS    K   + I FGTN DLSDE KW  QLHEL KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YW  ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MAKNIK++D  L+++IKY L+ +L HC      L  + +++V   R ++E  H+C +CE EVFN+  +        TK+      Y   C +C+ K  PNL +F  + Q+K+ EL+++YD F
Sbjct:  931 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPTGTKKIWRCESSRSHTTIAKYAQYQAASFQESLREENEKKSQHKD-------HSDSESTS-----SDNSGRRRKGPFKTIKFGTNIDLSDERKWKLQLHELTKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPETYWSVMHDFCEKNNINFLLGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTAFQYKLAVERYEWNKLQCVKSIVPMVHLSWNMAKNIKVSDPKLFEMIKYCLLRTLKHCQALREVLNASGIEIVWHGRTKDEPAHYCSNCEVEVFNLLFV--------TKESNSQKTYVVHCHDCSRKSCPNLENFVVLEQFKMEELMQIYDLF 1386          

HSP 2 Score: 284.648 bits (727), Expect = 1.444e-77
Identity = 158/387 (40.83%), Postives = 220/387 (56.85%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALND--SCKGSFTETEIRFQIAHLLEVC------GKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQLEMQEAV 1549
            + SAY  + S   D WKN  F+YGL + YFH+NAF  +I  FQ++LY++P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D   C  S  E+     IA+ +          KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ  +   + V
Sbjct:  114 ALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFHWAIRAFQEVLYVEPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDCNPCTLSKAESNFFVLIAYFVLFMYLFFKQKKYHSAKEAYEQLL--QTENLPTQVKATVLQQLGWMHHTVDQLG----DKATKASYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCNNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQGAMNSAQQV 454          
BLAST of utx vs. Ensembl Xenopus
Match: kdm6a (lysine demethylase 6A [Source:NCBI gene;Acc:100170558])

HSP 1 Score: 533.487 bits (1373), Expect = 1.676e-164
Identity = 259/476 (54.41%), Postives = 325/476 (68.28%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC SS+S TTI +YA YQA  F E+ ++E    +            S S  TS     S+NS    K   + I FGTN DLSDE KW  QLHEL KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YW  ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MAKNIK++D  L+++IKY L+ +L HC      L  + +++V   R ++E  H+C +CE EVFN+  +        TK+      Y   C +C+ K  PNL +F  + Q+K+ EL+++YD F
Sbjct:  937 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPTGTKKIWRCESSRSHTTIAKYAQYQAASFQESLREENEKKSQHKD-------HSDSESTS-----SDNSGRRRKGPFKTIKFGTNIDLSDERKWKLQLHELTKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPETYWSVMHDFCEKNNINFLLGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTAFQYKLAVERYEWNKLQCVKSIVPMVHLSWNMAKNIKVSDPKLFEMIKYCLLRTLKHCQALREVLNASGIEIVWHGRTKDEPAHYCSNCEVEVFNLLFV--------TKESNSQKTYVVHCHDCSRKSCPNLENFVVLEQFKMEELMQIYDLF 1392          

HSP 2 Score: 305.064 bits (780), Expect = 3.836e-84
Identity = 160/370 (43.24%), Postives = 221/370 (59.73%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            + SAY  + S   D WKN  F+YGL + YFH+NAF  +I  FQ++LY++P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + ++ EI+F IAHL E   KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:  114 ALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFHWAIRAFQEVLYVEPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDCNPCTLSKAEIQFHIAHLYETQKKYHSAKEAYEQLL--QTENLPTQVKATVLQQLGWMHHTVDQLG----DKATKASYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCNNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. Ensembl Mouse
Match: Kdm6a (lysine (K)-specific demethylase 6A [Source:MGI Symbol;Acc:MGI:1095419])

HSP 1 Score: 518.85 bits (1335), Expect = 2.804e-163
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  531 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGKRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 986          
BLAST of utx vs. Ensembl Mouse
Match: Kdm6a (lysine (K)-specific demethylase 6A [Source:MGI Symbol;Acc:MGI:1095419])

HSP 1 Score: 520.39 bits (1339), Expect = 7.479e-160
Identity = 254/476 (53.36%), Postives = 322/476 (67.65%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++           S S  TS     S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  935 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKD-------HSDSESTS-----SDNSGKRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1390          

HSP 2 Score: 303.138 bits (775), Expect = 1.192e-83
Identity = 182/475 (38.32%), Postives = 252/475 (53.05%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S KN      +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   47 EREALGGLDSRLFGFVRFHE-DGARMKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATILQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRS-KNCSNTSGLAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. Ensembl Mouse
Match: Kdm6a (lysine (K)-specific demethylase 6A [Source:MGI Symbol;Acc:MGI:1095419])

HSP 1 Score: 519.62 bits (1337), Expect = 2.200e-159
Identity = 255/480 (53.12%), Postives = 323/480 (67.29%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKS 3922
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++           S S  TS     S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F   S
Sbjct:  935 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKD-------HSDSESTS-----SDNSGKRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLVS 1394          

HSP 2 Score: 302.753 bits (774), Expect = 1.811e-83
Identity = 182/475 (38.32%), Postives = 252/475 (53.05%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S KN      +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   47 EREALGGLDSRLFGFVRFHE-DGARMKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATILQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRS-KNCSNTSGLAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. Ensembl Mouse
Match: Uty (ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome [Source:MGI Symbol;Acc:MGI:894810])

HSP 1 Score: 501.516 bits (1290), Expect = 1.424e-155
Identity = 248/485 (51.13%), Postives = 317/485 (65.36%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAA 3937
            +L PPTPS+YL+ K+D   P L QFC++   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D +G K + R  +  S TTI +YA YQA  F E+ ++E                  + + +  E   S+NS   +K   + I  G N DLSD  KW  QLHEL KLP F++VVSA N+LSH G+TI+GMNSVQL MKVPG R PGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L  SWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+ WNVGPL + QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+  L HC      L  A  +++   R  +E   +C  CE EVFN+  +        T +      Y   C NCA K + NL +F  + QYK+ +L++VYD F    S  +A
Sbjct:  646 KLNPPTPSIYLENKRDAFFPPLHQFCINPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPSGTKKIWRYENKSSHTTIAKYAQYQACSFQESLREENERRT------------QVKDYSDNESTCSDNSGRRQKAPFKTIKCGINIDLSDNKKWKLQLHELTKLPAFVRVVSAGNLLSHVGYTILGMNSVQLCMKVPGSRIPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNITWNVGPLTAFQYKLAVERYEWNKLQSVKSVVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKHCQTLREALVAAGKEVLWHGRINDEPAPYCSICEVEVFNLLFV--------TNESNSQKTYIVHCQNCARKTSGNLENFVVLEQYKMEDLIQVYDQFTLAPSLSSA 1110          

HSP 2 Score: 275.018 bits (702), Expect = 2.294e-75
Identity = 141/301 (46.84%), Postives = 194/301 (64.45%), Query Frame = 2
Query:  422 SAYLEFESRNKDSWK-------NIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKL 1300
            S++  F +R KD  K       N  F+YGL + YF++NAF  +I  FQ++LY+ PN  R+KEIH+RLG+++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A+ AYEQL+    E  P  +K    +QLGW++ +   IG    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG+LYES  Q ++A+KCY NA  S   N     +  R+  +Q +
Sbjct:   46 SSFFGFLTRCKDGAKMKTLLNKNAAFLYGLGLVYFYYNAFQWAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLKHFQLALIDCNVCTLSSVEIQFHIAHLYETQRKYHSAKAAYEQLLQI--ESLPSQVKATVLQQLGWMHHNMDLIG----DNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCNQPQDAIKCYLNAARSKSCNNTSA-LTSRIKFLQSV 339          
BLAST of utx vs. Ensembl Mouse
Match: Uty (ubiquitously transcribed tetratricopeptide repeat gene, Y chromosome [Source:MGI Symbol;Acc:MGI:894810])

HSP 1 Score: 501.516 bits (1290), Expect = 3.900e-155
Identity = 248/485 (51.13%), Postives = 317/485 (65.36%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAA 3937
            +L PPTPS+YL+ K+D   P L QFC++   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D +G K + R  +  S TTI +YA YQA  F E+ ++E                  + + +  E   S+NS   +K   + I  G N DLSD  KW  QLHEL KLP F++VVSA N+LSH G+TI+GMNSVQL MKVPG R PGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L  SWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+ WNVGPL + QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+  L HC      L  A  +++   R  +E   +C  CE EVFN+  +        T +      Y   C NCA K + NL +F  + QYK+ +L++VYD F    S  +A
Sbjct:  684 KLNPPTPSIYLENKRDAFFPPLHQFCINPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPSGTKKIWRYENKSSHTTIAKYAQYQACSFQESLREENERRT------------QVKDYSDNESTCSDNSGRRQKAPFKTIKCGINIDLSDNKKWKLQLHELTKLPAFVRVVSAGNLLSHVGYTILGMNSVQLCMKVPGSRIPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNITWNVGPLTAFQYKLAVERYEWNKLQSVKSVVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKHCQTLREALVAAGKEVLWHGRINDEPAPYCSICEVEVFNLLFV--------TNESNSQKTYIVHCQNCARKTSGNLENFVVLEQYKMEDLIQVYDQFTLAPSLSSA 1148          

HSP 2 Score: 300.442 bits (768), Expect = 1.199e-83
Identity = 160/370 (43.24%), Postives = 220/370 (59.46%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            + S+Y  + S   D WKN  F+YGL + YF++NAF  +I  FQ++LY+ PN  R+KEIH+RLG+++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A+ AYEQL+    E  P  +K    +QLGW++ +   IG    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG+LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   44 ALSSYQRYYSLQTDYWKNAAFLYGLGLVYFYYNAFQWAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLKHFQLALIDCNVCTLSSVEIQFHIAHLYETQRKYHSAKAAYEQLLQI--ESLPSQVKATVLQQLGWMHHNMDLIG----DNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCNQPQDAIKCYLNAARSKSCNNTSA-LTSRIKFLQAQLCNLPQSSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 367          
BLAST of utx vs. UniProt/SwissProt
Match: sp|O15550|KDM6A_HUMAN (Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2)

HSP 1 Score: 520.776 bits (1340), Expect = 4.397e-159
Identity = 251/476 (52.73%), Postives = 321/476 (67.44%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++              + +  E   S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  935 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHK------------DHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1390          

HSP 2 Score: 301.982 bits (772), Expect = 1.925e-82
Identity = 180/475 (37.89%), Postives = 251/475 (52.84%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S   +     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   45 EREALGGLDSRLFGFVRFHE-DGARTKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATVLQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSA-LAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 435          
BLAST of utx vs. UniProt/SwissProt
Match: sp|O70546|KDM6A_MOUSE (Lysine-specific demethylase 6A OS=Mus musculus OX=10090 GN=Kdm6a PE=1 SV=2)

HSP 1 Score: 520.39 bits (1339), Expect = 5.232e-159
Identity = 254/476 (53.36%), Postives = 322/476 (67.65%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K +  C S++S TTI +YA YQA  F E+ ++E    ++           S S  TS     S+NS    K   + I FGTN DLSD+ KW  QLHEL KLP F++VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L GSWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+AWNVGPL + QY L++ERYE+NKL+  KSIV MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  +++   R + E  H+C  CE EVF++  +        T +      Y   C +CA K + NL +F  + QYK+ +L++VYD F
Sbjct:  935 KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKD-------HSDSESTS-----SDNSGKRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFV--------TNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQF 1390          

HSP 2 Score: 303.138 bits (775), Expect = 8.339e-83
Identity = 182/475 (38.32%), Postives = 252/475 (53.05%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E + L  L S  FGF+ F+   G   K +L KA+ C +S +       K +   E   F   G   +    E Y K +                             SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+  R+KEIH+RLG ++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+    +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S KN      +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:   47 EREALGGLDSRLFGFVRFHE-DGARMKALLGKAVRCYESLI------LKAEGKVESDFFCQLGHFNL--LLEDYPKAL-----------------------------SAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLSAQVKATILQQLGWMHHTVDLLG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRS-KNCSNTSGLAARIKYLQAQLCNLPQGSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 437          
BLAST of utx vs. UniProt/SwissProt
Match: sp|O14607|UTY_HUMAN (Histone demethylase UTY OS=Homo sapiens OX=9606 GN=UTY PE=1 SV=2)

HSP 1 Score: 507.294 bits (1305), Expect = 1.521e-154
Identity = 248/476 (52.10%), Postives = 313/476 (65.76%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D  G K + RC S++S TTI +YA YQA  F E+ ++E                    + +  E   S NS    K   + I FGTN DLSD  KW  QLHEL KLP F +VVSA N+L+H G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L  SWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL + QY L++ERYE+NKLK  KS V MVHLSW MA+NIK++D  L+++IKY L+  L         L  A  +++   R  +E  H+C  CE EVFN+  +        T +      Y   C +CA K + +L +F  + QYK+ +L++VYD F
Sbjct:  882 KLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTIAKYAQYQASSFQESLREENEKRTQHK------------DHSDNESTSSENSGRRRKGPFKTIKFGTNIDLSDNKKWKLQLHELTKLPAFARVVSAGNLLTHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLTACQYKLAVERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAAGKEVIWHGRTNDEPAHYCSICEVEVFNLLFV--------TNESNTQKTYIVHCHDCARKTSKSLENFVVLEQYKMEDLIQVYDQF 1337          

HSP 2 Score: 281.567 bits (719), Expect = 6.222e-76
Identity = 148/317 (46.69%), Postives = 206/317 (64.98%), Query Frame = 2
Query:  299 IGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDK 1246
            +GK    Y+ +I   +  ++   +  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YF++NAF  +I+ FQ +LY+ P+  R+KEIH+RLG ++K+N ++  SLKHF+ AL D    + +  EI+F IAHL E   KY  A++AYEQL+    E+ P  +K    +QLGW++ +   +G    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S +
Sbjct:   70 LGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDYKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL--QTENLPAQVKATVLQQLGWMHHNMDLVG----DKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNAARSKR 380          
BLAST of utx vs. UniProt/SwissProt
Match: sp|P79457|UTY_MOUSE (Histone demethylase UTY OS=Mus musculus OX=10090 GN=Uty PE=1 SV=2)

HSP 1 Score: 501.901 bits (1291), Expect = 7.218e-154
Identity = 248/485 (51.13%), Postives = 317/485 (65.36%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAA 3937
            +L PPTPS+YL+ K+D   P L QFC++   P+ VIR LA  L++DLG+FSTK LVE N  H +E R Q LQP DEN D +G K + R  +  S TTI +YA YQA  F E+ ++E                  + + +  E   S+NS   +K   + I  G N DLSD  KW  QLHEL KLP F++VVSA N+LSH G+TI+GMNSVQL MKVPG R PGHQENNNFCS+NIN+GPGDCEWF VPE YWG +N  CE+N +++L  SWWPNLE+L +  +PVYRFIQRPGDLVWINAGTVHWVQAIGWCNN+ WNVGPL + QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+  L HC      L  A  +++   R  +E   +C  CE EVFN+  +        T +      Y   C NCA K + NL +F  + QYK+ +L++VYD F    S  +A
Sbjct:  747 KLNPPTPSIYLENKRDAFFPPLHQFCINPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHIVEVRTQLLQPADENWDPSGTKKIWRYENKSSHTTIAKYAQYQACSFQESLREENERRT------------QVKDYSDNESTCSDNSGRRQKAPFKTIKCGINIDLSDNKKWKLQLHELTKLPAFVRVVSAGNLLSHVGYTILGMNSVQLCMKVPGSRIPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNITWNVGPLTAFQYKLAVERYEWNKLQSVKSVVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKHCQTLREALVAAGKEVLWHGRINDEPAPYCSICEVEVFNLLFV--------TNESNSQKTYIVHCQNCARKTSGNLENFVVLEQYKMEDLIQVYDQFTLAPSLSSA 1211          

HSP 2 Score: 300.442 bits (768), Expect = 1.435e-82
Identity = 160/370 (43.24%), Postives = 220/370 (59.46%), Query Frame = 2
Query:  416 SFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            + S+Y  + S   D WKN  F+YGL + YF++NAF  +I  FQ++LY+ PN  R+KEIH+RLG+++K+N +++ SLKHF+ AL D    + +  EI+F IAHL E   KY  A+ AYEQL+    E  P  +K    +QLGW++ +   IG    +  +K+   I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG+LYES  Q ++A+KCY NA  S   N     +  R+  +Q  L  LP+ ++                  QN   +                     LP+++EAW+LPIP ELT RQ
Sbjct:  107 ALSSYQRYYSLQTDYWKNAAFLYGLGLVYFYYNAFQWAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLKHFQLALIDCNVCTLSSVEIQFHIAHLYETQRKYHSAKAAYEQLLQI--ESLPSQVKATVLQQLGWMHHNMDLIG----DNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCNQPQDAIKCYLNAARSKSCNNTSA-LTSRIKFLQAQLCNLPQSSL------------------QNKTKL---------------------LPSIEEAWSLPIPAELTSRQ 430          
BLAST of utx vs. UniProt/SwissProt
Match: sp|Q5NCY0|KDM6B_MOUSE (Lysine-specific demethylase 6B OS=Mus musculus OX=10090 GN=Kdm6b PE=1 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 9.973e-144
Identity = 237/476 (49.79%), Postives = 311/476 (65.34%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQ--PIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D  SP L QFC     PI VIR LA +LR++LG+FSTK LVE +  H +E R Q  QP DEN D  G + +  C SS+S TTI +YA YQA  F E+ ++E+   +  S           + GTS        SS  + K    I FGTN DLSD  +W  QL EL KLP F++V S  NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+V E YW  I+  C+ + +DYLTGSWWP L++L    IPVYRF+QRPGDLVWINAGTVHWVQA GWCNN+AWNVGPL + QY L++ERYE+N++K  KSIV M+H+SW +A+ +K++D  L+++IK+ L+ S+ HC +    L +A  ++  Q R ++E  ++C +C+ EVFNI  +        T +      Y   C  CA + +  L     + QY+  EL + YD+F
Sbjct: 1178 KLNPPTPSIYLESKRDAFSPVLLQFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLTGTRQIWPCESSRSHTTIAKYAQYQASSFQESLQEERESEDEESEE------PDSTTGTSP-------SSAPDPKNHHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILDDLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECDVEVFNILFV--------TSENGSRNTYLVHCEGCARRRSAGLQGVVVLEQYRTEELAQAYDAF 1632          
BLAST of utx vs. TrEMBL
Match: L0H970 (Utx (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1388.25 bits (3592), Expect = 0.000e+0
Identity = 832/832 (100.00%), Postives = 832/832 (100.00%), Query Frame = 2
Query: 1154 AAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQLEMQEAVXXXXXXXXXXXXFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEXXXXXXXXXXXXVMISLXXXXXXXXXXXXXXXNKLFXXXXXXXXXXXXSADSSGQSIDHLNCKKDMKNIAXXXXXXXXXXXXXAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEEQEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIXXXXXXXXXXXXNERXXXXXXXXXXXXXXXXXXXXXXEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLE 3649
            AAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEKNIPNQISNQQKISQIRPPPHQNVNTIPVGGPASSLSPSMMSQSMMMKLPTVDEAWNLPIPTELTQRQMQLEMQEAVASASSSGGISRIFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEQQSNQLNNQQRQVMISLQNQQQRYQQQQLQQQNKLFINTNNIMTTCTNSADSSGQSIDHLNCKKDMKNIANQDQSSTNQDSNSAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEEQEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIPQPPYPPPLVVPNERSSDSNSFNNVNNNNSSISRQNSEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKNGNNNSSLLSGALGNQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLE
Sbjct:    1 AAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEKNIPNQISNQQKISQIRPPPHQNVNTIPVGGPASSLSPSMMSQSMMMKLPTVDEAWNLPIPTELTQRQMQLEMQEAVASASSSGGISRIFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEQQSNQLNNQQRQVMISLQNQQQRYQQQQLQQQNKLFINTNNIMTTCTNSADSSGQSIDHLNCKKDMKNIANQDQSSTNQDSNSAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEEQEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIPQPPYPPPLVVPNERSSDSNSFNNVNNNNSSISRQNSEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKNGNNNSSLLSGALGNQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLE 832          
BLAST of utx vs. TrEMBL
Match: A0A1I8I818 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 1.739e-176
Identity = 258/487 (52.98%), Postives = 341/487 (70.02%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR 3952
            QL PPT S+YLD KKD HSPEL +FC  QP+ VIR LA+ LR+DL +FSTK LVE N  H+IE R Q +QPPD N+DA G+T+  C S +  TTI  Y  YQA+ F EA K+EK+               + +         + N++   K+    I FGTNCDLSDE KW  QL EL KLP F+KVVSA NMLSH G TI+GMN+VQLYMKVPG RTPGHQENN+FCS+NIN+GPGDCEWF+VPEQYWGA++ LC  + +DYL GSWWP+L +L    +PVYRFIQRPGDLVWINAGT HWVQAIGWCNN+AWNVGPL ++QY L+ ERYE+NKL  +KSIV M+HLSW +A+N+K++D  L++LIK+TL  SL++C +T  +++  R+++    R+ +E T +C  C+ E+FNI  +            +++ ++   CL+CA K+ P L  F  + +Y + EL++VYD+F+ ++ PI AY+V +
Sbjct:  593 QLYPPTSSIYLDSKKDAHSPELMRFCKQQPVAVIRGLAAALRLDLSLFSTKTLVEANGEHRIEVRTQRVQPPDVNRDAEGRTVWICESPRGHTTIAAYGRYQAQSFQEAVKEEKSEMQQQQH-------SASAGAGGAGASAAANAAAAAKRAPSVIRFGTNCDLSDEKKWLPQLQELTKLPTFVKVVSASNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNSFCSVNINIGPGDCEWFAVPEQYWGALHNLCHRHGVDYLHGSWWPDLTDLAAEGVPVYRFIQRPGDLVWINAGTPHWVQAIGWCNNIAWNVGPLTAKQYMLARERYEFNKLNNFKSIVPMIHLSWMLARNLKLSDQSLFELIKHTLQRSLVYCYMTIEFVQHLRLEVKWHGRKPDEDTQYCNVCDIELFNILFV-----------MEQNKKFVCHCLDCARKIQPELQGFTVLAEYSMQELIDVYDNFQLQTQPIPAYAVGK 1061          

HSP 2 Score: 338.576 bits (867), Expect = 9.493e-94
Identity = 206/499 (41.28%), Postives = 280/499 (56.11%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINF---NTPKGQA---------KKQILEKAINCLDSTLSKLV----ETFKEKKDQEQAEFKNSGLLTIGKQFELYD---------KVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E K++++L S  FGF      +TP             K+ IL+KA+  LDS + + V    E  K+ KD  + +   S  L      E  D         +  +  + ++ P +Y +LGH+ LLL  +E +FSAY  +E R   +  N  ++YGL +C++HFN FD +I  F ++LY +P  SR+ EIH+RLG IYK+  + + SL+HF++AL D    S T  EIRF IAHL EVC K + A+  Y QL    K D    +K LCY QLGWL        S P      D+ +  LQ AL  D   G T+YL GR  +   +VQDAFMAYR+SIDK EA ADTWCSIGVLYQ+QNQPMDALQAY CA QLD+ HVAAW++LG+LYES GQY++AL CY +A   DK  E+   +++R+ ++Q+ L  +P+K I  ++              Q+ N +                     LP V EAWNLPIP ELTQR+
Sbjct:   15 EVKLVQDLDSLAFGFAKLGPSDTPPAPGATASSSSGSKRTILQKAVTYLDSLVLQSVIDAEEFAKQTKDSVKFDSTKSEQLAAASDEEATDIGVVESEAARARRHFEQSVPPALYCYLGHFHLLLEHWEQAFSAYTVYEQREPRADTNSAYLYGLGLCHYHFNRFDSAISAFHRVLYQEPAFSRANEIHVRLGVIYKLRADLERSLRHFKRALYDRSPCSLTSAEIRFHIAHLYEVCNKVRFAKDYYSQLA--EKPDTSKELKALCYLQLGWLY------HSKPEL-GDHDTAVQYLQNALTLDREHG-TYYLLGRCFSALGRVQDAFMAYRSSIDKLEACADTWCSIGVLYQQQNQPMDALQAYVCAVQLDKDHVAAWSDLGILYESNGQYRDALTCYTSAAKVDKRGELNPMLRERITVLQEYLANIPDKLIEQKV-------------QQSGNHL---------------------LPPVKEAWNLPIPAELTQRK 469          
BLAST of utx vs. TrEMBL
Match: A0A267G179 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018358g1 PE=4 SV=1)

HSP 1 Score: 561.992 bits (1447), Expect = 3.051e-175
Identity = 259/494 (52.43%), Postives = 342/494 (69.23%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEE-------KKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR 3952
            QL PPT S+YLD KKD HSPEL +FC  QP+ VIR LA+ LR+DL +FSTK LVE N  H+IE R Q +QPPD N+DA G+T+  C S +  TTI  Y  YQA+ F EA K+EK+          +   Q+ +  +S         +          K+    I FGTNCDLSDE KW  QL EL KLP F+KVVSA NMLSH G TI+GMN+VQLYMKVPG RTPGHQENN+FCS+NIN+GPGDCEWF+VPEQYWGA++ LC  + +DYL GSWWP+L +L    +PVYRFIQRPGDLVWINAGT HWVQAIGWCNN+AWNVGPL ++QY L+ ERYE+NKL  +KSIV M+HLSW +A+N+K++D  L++LIK+TL  SL++C +T  +++  R+++    R+ +E T +C  C+ E+FNI  +            +++ ++   CL+CA K+ P L  F  + +Y + EL++VYD+F+ ++ PI AY+V +
Sbjct:  596 QLYPPTSSIYLDSKKDAHSPELMRFCKQQPVAVIRGLAAALRLDLSLFSTKTLVEANGEHRIEVRTQRVQPPDVNRDAEGRTVWICESPRGHTTISAYGRYQAQSFQEAVKEEKSEMQQQQQSGSSQQAQNGAASSSVSAGAGGAGASAAANAAAAAKRAPSVIRFGTNCDLSDEKKWLPQLQELTKLPTFVKVVSASNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNSFCSVNINIGPGDCEWFAVPEQYWGALHNLCHRHGVDYLHGSWWPDLTDLAAEGVPVYRFIQRPGDLVWINAGTPHWVQAIGWCNNIAWNVGPLTAKQYMLARERYEFNKLNNFKSIVPMIHLSWMLARNLKLSDQSLFELIKHTLQRSLVYCYMTIEFVQHLRLEVKWHGRKPDEDTQYCNVCDIELFNILFV-----------MEQNKKFVCHCLDCARKIQPELQGFTVLAEYSMQELIDVYDNFQLQTQPIPAYAVGK 1078          

HSP 2 Score: 334.339 bits (856), Expect = 3.031e-92
Identity = 204/502 (40.64%), Postives = 278/502 (55.38%), Query Frame = 2
Query:  101 ETKILRELSSFDFGFINFNTP---------------KGQAKKQILEKAINCLDSTLSKLV----ETFKEKKDQEQAEFKNSGLLTIGKQFELYD---------KVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            E K++++L S  FGF                        +K+ IL+KA+  LDS + + V    E  K+ KD  + +   S  L      E  D         +  +  + ++ P +Y +LGH+ LLL  +E +FSAY  +E R   +  N  ++YGL +C++HFN FD +I  F ++LY +P  SR+ EIH+RLG IYK+  + + SL+HF++AL D    S T  EIRF IAHL EVC K + A+  Y QL    K D    +K LCY QLGWL        S P      D+ +  LQ AL  D   G T+YL GR  +   +VQDAFMAYR+SIDK EA ADTWCSIGVLYQ+QNQPMDALQAY CA QLD+ HVAAW++LG+LYES GQY++AL CY +A   DK  E+   +++R+ ++Q+ L  +P+K I  ++              Q+ N +                     LP V EAWNLPIP ELTQR+
Sbjct:   15 EVKLVQDLDSLAFGFAKLGPSDTPPAPGAAAASSSSSSGSKRTILQKAVTYLDSLVLQSVIDAEEFAKQTKDSVKFDSTKSEQLAAASDEEATDIGVVESEAARARRHFEQSVPPALYCYLGHFHLLLEHWEQAFSAYTVYEQREPRADTNSAYLYGLGLCHYHFNRFDSAISAFHRVLYQEPAFSRANEIHVRLGVIYKLRADLERSLRHFKRALYDRSPCSLTSAEIRFHIAHLYEVCNKVRFAKDYYSQLA--EKPDTSKELKALCYLQLGWLY------HSKPEL-GDHDTAVQYLQNALTLDREHG-TYYLLGRCFSALGRVQDAFMAYRSSIDKLEACADTWCSIGVLYQQQNQPMDALQAYVCAVQLDKDHVAAWSDLGILYESNGQYRDALTCYTSAAKVDKRGELNPMLRERITVLQEYLANIPDKLIEQKV-------------QQSGNHL---------------------LPPVKEAWNLPIPAELTQRK 472          
BLAST of utx vs. TrEMBL
Match: A0A482V9L7 (Lysine-specific demethylase 6A OS=Asbolus verrucosus OX=1661398 GN=BDFB_003030 PE=4 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 4.935e-174
Identity = 261/475 (54.95%), Postives = 337/475 (70.95%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDA-NGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTS-EELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            QLLPPTPSVYLD KK   SP+L++FCL  PI VIR LA+ L++DLG+FSTK LVE NP+H +E R Q  QP DEN D  +GK +  C+S +S TTI  YA YQA  F E+ K+E++ + +    S +  + +         +  S N+ G  + K  K  FGTN DLSDE KW  QL EL KLP F +VVSA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWGA+ TLCE+N+I+YL GSWWP LE+L +  IPVYRF+QRPGDLVW+NAG VHWVQA+GWCNN+AWNVGPL +RQY L++ERYE+NKL+ +KSIV M+HLSW +++NIK++D  L+ LIK  LM +L  C++   +++   V++    R +NE +H+C  CE EVFNI  I+           +++ R+   C+ CA K +PNL  F  + +YK+ EL EVYD+F
Sbjct:   61 QLLPPTPSVYLDNKKHAFSPQLQEFCLKHPIAVIRGLAAALKLDLGLFSTKTLVEANPDHSVEVRTQIQQPSDENWDPQSGKKVWACISHRSHTTIARYAQYQASSFKESLKEERDKSASGLSDSDSKDSMNFPKRRKLSNVAPSFNTKGCNQPKMLK--FGTNVDLSDEKKWKPQLQELMKLPAFARVVSAGNMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGAVCTLCEKNQINYLHGSWWPVLEDLYKANIPVYRFLQRPGDLVWVNAGCVHWVQAVGWCNNIAWNVGPLTARQYQLAIERYEWNKLQSFKSIVPMLHLSWNLSRNIKVSDPKLFHLIKNCLMRTLRQCSMILEFVKHKGVEVKFHGRGKNEASHYCGQCEIEVFNILFIR-----------EQEKRHVVHCMECARKQSPNLEGFVCLEEYKMEELTEVYDNF 522          
BLAST of utx vs. TrEMBL
Match: A0A034VW96 (Lysine-specific demethylase 6A (Fragment) OS=Bactrocera dorsalis OX=27457 GN=KDM6A PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 4.483e-173
Identity = 258/483 (53.42%), Postives = 342/483 (70.81%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDAN-GKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKR---RKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSP 3928
            QLLPPTPSV+L+ KK   SP+L++FCL  PI V+R LA  L++DLG+FSTK LVE NP+H +E R Q  Q PDEN DA+  K +  C+S +S TTI +YA YQA  F ++ KDE +               ++S+  S++   ++N SG+ KK +   + + FGTN DLSDE KW +QL EL KLP F +V+SA NMLSH G  I+GMN+VQLYMKVPG RTPGHQENNNFCSININ+GPGDCEWF+VP+ YWG I+ LCE+N I YL GSWWP LE+L +  IPVYRFIQRPGDLVW+NAG VHWVQ++GWCNN+AWNVGPL +RQYSL++ERYE+NKL+ +KSIV MVHLSW +A+NIK++D  L++L+K  L+ +L +   T  Y++   V++    R +NE +H+C  CE EVFNI  I+           +++ R+   C+ CA K++PNL     + +Y+LSEL+++YD+F     P
Sbjct:  142 QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGALKLDLGLFSTKTLVEANPDHSVEVRTQVHQSPDENWDASQAKRVWACISHRSHTTIAKYAQYQASSFQDSLKDEHDKGPTGVP--------TMSDSDSKDSVSNSNVSGKRKKLKNGNKMLRFGTNVDLSDERKWRSQLAELQKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAVPDAYWGGIHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQRPGDLVWVNAGCVHWVQSVGWCNNIAWNVGPLTARQYSLAVERYEWNKLQNFKSIVPMVHLSWNLARNIKVSDPKLFELVKMCLLQTLKNVVHTLEYVKSKGVEVRFHGRGKNEASHYCGQCEVEVFNILFIR-----------EQEKRHVVHCMACARKLSPNLQGIVCLEEYRLSELLQIYDAFALYKVP 605          
BLAST of utx vs. Ensembl Cavefish
Match: kdm6al (lysine (K)-specific demethylase 6A, like [Source:ZFIN;Acc:ZDB-GENE-070112-2002])

HSP 1 Score: 509.605 bits (1311), Expect = 1.073e-156
Identity = 247/481 (51.35%), Postives = 318/481 (66.11%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRK-----IYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC   S P+ VIR LA  L++DLG+FSTK LVE NP H +E R Q  QP DEN DA+G +   RC S++S TTI +YA YQA  F E+ ++E                        +EL  S  SS E   +RRK     I FGTN D+SDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQL+MKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+VPE YWG ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GTVHWVQAIGWCNN++WNVGPL + QY L++ERYE+NKL+  KS V MVHLSW MA+NIK++D  L+++IK+ L+ +L  C      L  A  + +   R  +E   +C  CE EVFN+  +        T +      +   C +CA K +  L+ F  + QYK+ +L+++YD F
Sbjct:  849 KLNPPTPSIYLENKRDAFFPPLHQFCTNPSNPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVRTQLCQPADENWDASGTRKQWRCESTRSLTTIAKYAQYQAASFQESLREENEKKGQ------------------KELSDSEMSSSENVARRRKGPFKQIKFGTNIDVSDEKKWKLQLQELSKLPAFGRVVSAGNLLSHVGHTILGMNTVQLFMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVPEPYWGVMSEFCEKNNINFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWLNTGTVHWVQAIGWCNNISWNVGPLTAHQYKLAVERYEWNKLQSVKSTVPMVHLSWNMARNIKVSDHKLFEMIKFCLLRTLKQCQTVKEALVAAGKETIWHGRSRDEPARYCTICEVEVFNLLFV--------TSESYSRKTFVVHCQDCARKGSSELDGFVVLEQYKMEDLMQIYDQF 1303          

HSP 2 Score: 282.722 bits (722), Expect = 2.565e-77
Identity = 166/408 (40.69%), Postives = 235/408 (57.60%), Query Frame = 2
Query:  305 KQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDS-VINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQ 1522
            K    YD +I   +  +DP ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ E ++  +   +   +Y+ A++AYE L+    E+ P  +K    +QLGW++ +   +G       + KDS  I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S K       +  R+  +Q  L  L                      H ++ +                      LP+++EAW+LPIP ELT RQ
Sbjct:   82 KAVRCYDSLILKAEGKVDPELFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSNHCTLSKAESKYSHSQYQK---RYRAAKEAYESLL--KTENLPAQVKAATLQQLGWMHHTVEQLGDR-----ANKDSYAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHSAAWMDLGTLYESCNQPQDAIKCYINATRS-KVCSNTAALTARIKYLQAQLCNL---------------------QHTSLQS------------------KSKMLPSIEEAWSLPIPAELTSRQ 439          
BLAST of utx vs. Ensembl Cavefish
Match: kdm6ba (lysine demethylase 6B [Source:NCBI gene;Acc:103028970])

HSP 1 Score: 504.982 bits (1299), Expect = 1.241e-150
Identity = 244/482 (50.62%), Postives = 327/482 (67.84%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQ--PIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSP 3928
            +L PPTPS+YL+ K+D  SP L QFC     PI VIR LA +LR++LG+FSTK LVE N  H +E R Q  QP DEN D  G   +  C SS+S TTI +YA YQA  F E+ ++EK  ++            S  +GT+     S  S  E+K   + I FGTN DLSD  +W  QL EL KLP F++V S+ NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+V + YW AI+  CE++ +DYLTGSWWP LE+L +  IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL + QY L++ER+E+N++K  KSIV M+H+SW +A+ +K+TD   Y++IK+ L+ S+ H  +  + L  A  ++  Q+R ++E  ++C +C+ EVF++  +        T +      Y  RC +CA + +PNL++   + QY++ +L+  YDSF   S+P
Sbjct: 1510 KLNPPTPSIYLESKRDAFSPVLLQFCTDPKNPITVIRGLAGSLRLNLGLFSTKSLVEANSEHAVEVRTQVQQPADENWDPTGTGQIWPCESSRSHTTIAKYAQYQASSFQESLQEEKGSDDEDDDDVKKPLTNS--DGTNSNSANSGPSP-EQKSVGKIIKFGTNIDLSDPKRWKPQLQELQKLPAFMRVSSSGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHDNYWKAISDFCEKHGVDYLTGSWWPVLEDLYRSNIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNAYQYQLALERFEWNEVKNVKSIVPMIHVSWNVARTVKITDPDTYKMIKHCLLQSMKHIQVLRDQLVAAGKKISYQSRVKDEPAYYCNECDVEVFDLLFV--------TSENGSKKTYVVRCEDCARQRSPNLSNVVVLEQYRMEDLMNTYDSFSLASAP 1980          
BLAST of utx vs. Ensembl Cavefish
Match: kdm6a (lysine (K)-specific demethylase 6A [Source:ZFIN;Acc:ZDB-GENE-081105-56])

HSP 1 Score: 483.797 bits (1244), Expect = 7.840e-148
Identity = 238/481 (49.48%), Postives = 311/481 (64.66%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRK-----IYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC +   P+ VIR LA  L++DLG+FSTK LVE NP+H +E R Q  QP DEN D  G +   RC SS+S TTI +YA YQA  F E+ ++E                        +E   + ++S E   +RR+     I FGTN DLSDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+VPE YWG +N  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGD+            AIGWCNNVAWN+GPL + QY L++ERYE+NK +  KSIV M+HLSW +A+NIK++D  L+++IKY+L+ +L  C +    L  A   +V   R  +E  H+C  CE EVFN+  +        T +      Y   C +CA + +P+L++F  + QYK+ +L +VYD F
Sbjct:  751 KLNPPTPSIYLESKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANPDHLVEVRTQFSQPTDENWDLMGSRKTWRCESSRSHTTISKYAQYQASSFQESLREENEKKGQ------------------KEHSDTESASVENLVRRRRGPFKHIKFGTNIDLSDERKWKLQLTELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVPETYWGVMNDFCEKNNINFLMGSWWPNLEDLYEANVPVYRFIQRPGDM------------AIGWCNNVAWNIGPLTAHQYKLAVERYEWNKFQSVKSIVPMIHLSWNLARNIKVSDHKLFEMIKYSLLRTLKQCQMLREALIAAGKDLVWHGRSRDEPAHYCSICEVEVFNLLFV--------TSESNSRKTYVVHCQDCARRGSPDLDNFVVLEQYKIEDLTQVYDQF 1193          

HSP 2 Score: 298.901 bits (764), Expect = 8.095e-83
Identity = 166/404 (41.09%), Postives = 237/404 (58.66%), Query Frame = 2
Query:  320 YDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQL 1531
            YD  I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D+WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P+ SR+KEIH+RLG ++K+N +F+ SLKHF+ AL DS   + ++ E ++Q  +   +  KY+ A++AYE L+    ED P  +K    +QLGW++   +  +   +  +K    I  LQ++L  D+ SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q ++A+KCY NA  S     +   +  R+  +Q  L  L +                         ++P               S    LP+++EAW+LPIP ELT RQ  L
Sbjct:   60 YDAYILKAEGKVEPEVFCQLGHFNLLLEDYPKALSAYQRYYSLQSDNWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPSFSRAKEIHLRLGLMFKVNTDFESSLKHFQLALIDSTPCTLSKAESKYQKPNFTMISKKYRAAKEAYESLL--QTEDLPAQVKATTLQQLGWMH---HTVEQLGDKANKDSYAIQCLQKSLEADSNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPQDAIKCYFNATCSKSCTNI-TALTSRIKCLQAQLCNLQQ------------------------GSLP---------------SKSKVLPSIEEAWSLPIPAELTSRQGAL 418          
BLAST of utx vs. Ensembl Cavefish
Match: kdm6bb (lysine-specific demethylase 6B-like [Source:NCBI gene;Acc:103028490])

HSP 1 Score: 484.567 bits (1246), Expect = 3.581e-144
Identity = 236/484 (48.76%), Postives = 316/484 (65.29%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFC--LSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIA 3934
            +L PPTPS+YL+ K+D  SP L QFC     P+ VIR LA +LR++LG+FSTK LVE N  H +E R Q  QP DEN +  G      C SS+S TTI +YA YQA  F E+   ++  ++           +S     S      +  S ++K   + I FGTN DLSD  +W  QL EL KLP F++V S  NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNF S+NIN+GPGDCEWF+V E YW AIN  CE++ +DYLTGSWWP LE+L Q  IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL   QY L++ER+E+N++K  KSIV M+H+SW +A+ IK+TD++ Y++I++ L+ S+ H  +    L  A  ++  Q+R ++E  ++C +C+ EVFN+  +        T +      Y   C +CA + +P +     + QY++ EL+ +YD+F     P +
Sbjct: 1324 KLNPPTPSIYLESKRDAFSPVLLQFCTDAKNPVTVIRGLAGSLRLNLGLFSTKSLVEANGEHAVEVRTQVQQPADENWNTAGSAQTWPCESSRSHTTIAKYAQYQASSFQESL--QEEKDSEDEDEGDKKSTESKPEALSSPPSAPSTPSSDQKSIGKIIKFGTNIDLSDPKRWKPQLQELLKLPAFMRVSSTDNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFSSVNINIGPGDCEWFAVHEHYWEAINDFCEKHGVDYLTGSWWPVLEDLYQANIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNPYQYQLALERFEWNEVKKVKSIVPMIHVSWNVARTIKITDANTYKMIRHCLLQSMKHIQILRGQLTAAGKKISYQSRVKDEPAYYCNECDVEVFNLLFV--------TSENSSRKTYVVHCEDCARRRSPGMTGVVVLEQYRVEELMSIYDNFSLAPMPFS 1797          
BLAST of utx vs. Ensembl Cavefish
Match: kdm6bb (lysine-specific demethylase 6B-like [Source:NCBI gene;Acc:103028490])

HSP 1 Score: 484.567 bits (1246), Expect = 3.581e-144
Identity = 236/484 (48.76%), Postives = 316/484 (65.29%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFC--LSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIA 3934
            +L PPTPS+YL+ K+D  SP L QFC     P+ VIR LA +LR++LG+FSTK LVE N  H +E R Q  QP DEN +  G      C SS+S TTI +YA YQA  F E+   ++  ++           +S     S      +  S ++K   + I FGTN DLSD  +W  QL EL KLP F++V S  NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNF S+NIN+GPGDCEWF+V E YW AIN  CE++ +DYLTGSWWP LE+L Q  IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL   QY L++ER+E+N++K  KSIV M+H+SW +A+ IK+TD++ Y++I++ L+ S+ H  +    L  A  ++  Q+R ++E  ++C +C+ EVFN+  +        T +      Y   C +CA + +P +     + QY++ EL+ +YD+F     P +
Sbjct: 1324 KLNPPTPSIYLESKRDAFSPVLLQFCTDAKNPVTVIRGLAGSLRLNLGLFSTKSLVEANGEHAVEVRTQVQQPADENWNTAGSAQTWPCESSRSHTTIAKYAQYQASSFQESL--QEEKDSEDEDEGDKKSTESKPEALSSPPSAPSTPSSDQKSIGKIIKFGTNIDLSDPKRWKPQLQELLKLPAFMRVSSTDNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFSSVNINIGPGDCEWFAVHEHYWEAINDFCEKHGVDYLTGSWWPVLEDLYQANIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNPYQYQLALERFEWNEVKKVKSIVPMIHVSWNVARTIKITDANTYKMIRHCLLQSMKHIQILRGQLTAAGKKISYQSRVKDEPAYYCNECDVEVFNLLFV--------TSENSSRKTYVVHCEDCARRRSPGMTGVVVLEQYRVEELMSIYDNFSLAPMPFS 1797          
BLAST of utx vs. Ensembl Sea Lamprey
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 50.447 bits (119), Expect = 3.114e-6
Identity = 51/239 (21.34%), Postives = 98/239 (41.00%), Query Frame = 2
Query:  518 FDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAV 1234
            FD+++  + + L L  N      +H  L  +Y      D ++  +R+A+    + +F +      +A+ L+  G   +A++ Y   +            HLC      LN    I +   N     +  + L ++AL                  ++ K+QDA + Y+ +I  +   AD + ++G   +E      ALQ Y  A Q++     A +NL  +++  G   EA+  Y+ A+
Sbjct:  242 FDRAVAAYLRALSLNHN---HAVVHGNLACVYYEQGLIDLAIDTYRRAI--ELQPNFPDAYC--NLANALKEKGNIAEAEECYNTAL------------HLCPNHADSLNNLANIKREQGNI----EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTAL 457          
BLAST of utx vs. Ensembl Yeast
Match: CYC8 (General transcriptional co-repressor; acts together with Tup1p; also acts as part of a transcriptional co-activator complex that recruits the SWI/SNF and SAGA complexes to promoters; can form the prion [OCT+] [Source:SGD;Acc:S000000316])

HSP 1 Score: 128.642 bits (322), Expect = 2.168e-30
Identity = 91/277 (32.85%), Postives = 141/277 (50.90%), Query Frame = 2
Query:  482 YGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPN--TPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESM-GQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLL 1303
            +G+ I Y  + + D + E F K+L L P+  ++ EI+ RLG IYK    +  +L+ FR  L         E +I FQ+  +LE  G+++ A++AYE ++  ++     H K L  +QLG L      G SN     P K    ++ L ++L  D +   TWY  GR          A+ A++ ++++   N   WCSIGVLY + +Q  DAL AY  A +L+      W +LG LYE+   Q  +AL  Y+ A   D NN   V I++R+  + K L
Sbjct:  154 HGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYIL-PQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLAQNQH----HAKVL--QQLGCL-----YGMSNVQFYDPQK---ALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN---VHIRERLEALTKQL 412          
BLAST of utx vs. Ensembl Yeast
Match: CDC23 (Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C); APC/C is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition [Source:SGD;Acc:S000001209])

HSP 1 Score: 49.2914 bits (116), Expect = 3.712e-6
Identity = 33/138 (23.91%), Postives = 55/138 (39.86%), Query Frame = 2
Query:  905 INLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPE 1318
            I   ++AL  D  +   W L G      +    A   YR ++D    +   W  +G  Y   +  + +L  +  AC L       W  LG  Y   G   EA+KCY+ ++ + +  +    I  R+  + + L  L E
Sbjct:  417 IMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLYEELEDLQE 554          
BLAST of utx vs. Ensembl Nematostella
Match: EDO39330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA95])

HSP 1 Score: 401.749 bits (1031), Expect = 3.945e-118
Identity = 227/525 (43.24%), Postives = 308/525 (58.67%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLS--QPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSA-CNMLSHCGFTIMG------------------------MNSVQLYMKVPG-----CR-------------TPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFK-YKSS 3925
            +L PPTPS++++ K+D  SP L+   LS   PI V+R LA+ L++DL ++STK LVETN +H++E R Q  Q PDEN DA G K +  C SS+S TTI +YA YQA  F E+ K+E+  +                +  S+    S +  G +  K + I FGTN DLSDE KW  QL EL KLP F +VV    N+L  C   +                           N+ +  +  PG     C+             TPGHQENNN+CSININ+GPGDCEWF+ P +YWG I+ LCE++ I+YLTGSWWP LEEL + ++PVYRFIQRPGDLV+INAG VHWVQA+GWCNN+AWNVGPL    +++++ERYE+NKL+  KS+V+M+HL+W +A+NIK+T+  LY  IK  L  S  +  +T   L +  + +    + +NE  H+C  CE EVFN+  +    TN        + ++   C +CA K +  L  F  + QY L EL E   SF+ YK S
Sbjct:  781 KLSPPTPSIWVENKRDAFSPVLQNLLLSPSNPITVVRGLAAALKLDLSLYSTKTLVETNADHQVEIRTQRQQAPDENWDAQGEKKVWLCGSSRSFTTIAKYAQYQANTFQESLKEEQEMH------------HRSIHSDSDSSSSSRSKKGSKTSKWKWIKFGTNVDLSDERKWKPQLQELTKLPPFARVVLCDINVLISCQVVLWEHAESFWEHHLRHELCSVVHENTRLQNTRKTGIGTPGRLLLLCQEDWYWYTWKTGIGTPGHQENNNYCSININIGPGDCEWFATPYEYWGVIHNLCEKHGINYLTGSWWPVLEELYEERVPVYRFIQRPGDLVFINAGVVHWVQALGWCNNIAWNVGPLTETIFNIAIERYEWNKLQGEKSMVAMIHLAWNLARNIKITEKALYDHIKLILDRSYKYSLVTIENLNRGGIDVKWHGKVQNEAPHYCAQCEVEVFNLLFV----TN--------NRKHLVYCQDCARKTSNTLQGFIVLNQYTLEELDETRKSFRLYKMS 1281          

HSP 2 Score: 265.774 bits (678), Expect = 2.010e-72
Identity = 157/405 (38.77%), Postives = 222/405 (54.81%), Query Frame = 2
Query:  416 SFSAYLEFESRNK-DSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLK--------------------------HFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAP---DHIKHLCYRQLGWLNFSG-YIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAV---SSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            + SAY +F +  + + WK+  F+YGL + YFHF  +  +I++FQ++LYL P  S S E+H+RLG ++K   N++ S+K                          HF  AL DS   S ++TEI+F + HL E+  K +QAQ+ YE LI     ++P   + +K   Y+QLGW+ ++  ++G    +  ++    + LLQ+A+  D  SG +WYL GR  A + KV DAF +YR++IDK+EANADTWCSIGVLYQ+QNQPMDALQAY CA QLD  HVAAWT+LG+LYE+  Q  +A+ CY  A    ++D + E R         I+ L T+LP                 +P   Q  N                       LP+V EAW LPIP ELT R ++
Sbjct:   86 ALSAYQKFYNIPQVNYWKDAPFLYGLGLVYFHFATYQWAIKVFQQVLYLDPGFSCSNEVHLRLGIMFKAQNNYEASIKKFNHSAMIDGSPAGKTVTYPTFGMGWHFHMALMDSNPCSLSKTEIQFHLGHLFEMQNKCQQAQEIYEALI-----ESPGLNNTVKANAYKQLGWMYYNKEHLG----DRATRMQKAVQLLQKAIETDPNSGSSWYLIGRCYAMQGKVHDAFTSYRHAIDKSEANADTWCSIGVLYQQQNQPMDALQAYVCAIQLDPAHVAAWTDLGILYEACDQPSDAILCYSAARKYGATDSSIEAR---------IKSLQTKLP---------------FSKPVDSQKKN-----------------------LPSVGEAWKLPIPAELTTRTIR 434          
BLAST of utx vs. Ensembl Nematostella
Match: EDO28045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7K6])

HSP 1 Score: 143.665 bits (361), Expect = 2.567e-37
Identity = 82/184 (44.57%), Postives = 102/184 (55.43%), Query Frame = 2
Query:  986 ENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAV---SSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQ 1528
            + KV DAF +YR++IDK+EANADTWCSIGVLYQ+QNQPMDALQAY CA QLD  HVAAWT+LG+LYE+  Q  +A+ CY  A    ++D + E R         I+ L T+LP                 +P   Q  N                       LP+V EAW LPIP ELT R ++
Sbjct:   64 KGKVHDAFTSYRHAIDKSEANADTWCSIGVLYQQQNQPMDALQAYVCAIQLDPAHVAAWTDLGILYEACDQPSDAILCYSAARKYGATDSSIEAR---------IKSLQTKLP---------------FSKPVDSQKKN-----------------------LPSVGEAWKLPIPAELTTRTIR 200          

HSP 2 Score: 67.3958 bits (163), Expect = 1.264e-11
Identity = 29/74 (39.19%), Postives = 47/74 (63.51%), Query Frame = 2
Query:  476 FIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLK--------HFRQALNDS 673
            F+YGL + YFHF  +  +I++FQ++LYL P  S S E+H+RLG ++K   N++ S+K         +R A++ S
Sbjct:    8 FLYGLGLVYFHFATYQWAIKVFQQVLYLDPGFSCSNEVHLRLGIMFKAQNNYEASIKGKVHDAFTSYRHAIDKS 81          
BLAST of utx vs. Ensembl Nematostella
Match: EDO27118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA53])

HSP 1 Score: 98.9821 bits (245), Expect = 1.830e-24
Identity = 45/107 (42.06%), Postives = 70/107 (65.42%), Query Frame = 2
Query: 3410 GWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEV 3730
            GWCNN+AWNVGPL    +++++ERYE+NKL+  KS+V+M+HL+W +A+NIK+T+  LY  IK  L  S  +  +T   L +  + +    + +NE  H+C  CE  +
Sbjct:    1 GWCNNIAWNVGPLTETIFNIAIERYEWNKLQGEKSMVAMIHLAWNLARNIKITEKALYDHIKLILDRSYKYSLVTIENLNRGGIDVKWHGKVQNESPHYCAQCEVSL 107          
BLAST of utx vs. Ensembl Nematostella
Match: EDO39747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9A3])

HSP 1 Score: 53.5286 bits (127), Expect = 7.253e-7
Identity = 28/101 (27.72%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  929 NFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNA 1231
              D    K W   G     + +  +A MAYR ++      ADT  ++G+L   Q +  DA+Q+Y  A     +   A  NLG++ + +G+ ++A++  +NA
Sbjct:  510 GIDVNPAKAWGNLGNVLGNQGRTNEAEMAYRKALSYRSNMADTHYNLGILLAGQKRYKDAIQSYENAITFRPRLAVAHLNLGIVLDQVGRKEDAIRILKNA 610          
BLAST of utx vs. Ensembl Nematostella
Match: EDO43484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL8])

HSP 1 Score: 52.373 bits (124), Expect = 1.438e-6
Identity = 30/108 (27.78%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  911 LLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAV 1234
            LL++A++        W   G  +A  NK+Q+A   Y+N+I   +   D + ++G LY + N+  +A+ A+  A +L   HV AW N  +L +   +  E ++    A+
Sbjct:  567 LLERAVDSSKAFAAGWMNLGTVKAALNKMQEAETCYKNAIRYRKKYPDAFFNLGNLYIDWNRDAEAVAAFRKAVKLKSDHVGAWMNHILLLDKTDKRTEGIELAYEAL 674          
BLAST of utx vs. Ensembl Medaka
Match: ENSORLT00000028751.1 (histone demethylase UTY [Source:NCBI gene;Acc:101161131])

HSP 1 Score: 517.309 bits (1331), Expect = 1.313e-158
Identity = 248/483 (51.35%), Postives = 328/483 (67.91%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPI 3931
            +L PPTPS+YL+ K+D   P L QFC   S P+ VIR LA  L++DLG+FSTK LVE NP H +E   Q  QP DEN D  G K + RC S++S TTI +YA YQA  F E+ ++E                +++   +  E   + +++ + +   + I FGTN D+SDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG R PGHQE+NNFC++NIN+GPGDCEWF+VPE YWG ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GT+HWVQAIGWCNN+AWNVGPLI+ QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  + VL+TR  +E  H+C  CE EVFN+  +++     LTKK      Y   C +CA K +  L+ F  + QY++ +L++VYD F   S  I
Sbjct:  940 KLNPPTPSIYLENKRDAFFPPLHQFCTNPSNPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVWTQLSQPADENWDPTGTKKMWRCESARSHTTIAKYAQYQATSFQESLREENEK-------------KALKEPSDTEPASAESAARKRRGPLKYIKFGTNIDVSDERKWKQQLQELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRIPGHQEHNNFCAVNINIGPGDCEWFAVPEPYWGVMSNFCEKNNINFLMGSWWPNLEDLYEADVPVYRFIQRPGDLVWLNTGTIHWVQAIGWCNNIAWNVGPLIAHQYKLAVERYEWNKLQSVKSMVPMVHLSWNMARNIKVSDHKLFEMIKYCLLRTLKQCQWVKEALATAGKETVLRTRTRDEPAHYCTICEVEVFNLLFVRR---ELLTKK-----PYVVHCQDCARKGSATLDDFVVLEQYRMEDLMQVYDQFTLVSPQI 1401          

HSP 2 Score: 293.123 bits (749), Expect = 1.913e-80
Identity = 153/322 (47.52%), Postives = 212/322 (65.84%), Query Frame = 2
Query:  278 KNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSS 1240
            +  GLL   K    YD +I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ EI+F IAHL E+  +Y+ +++AYE L+    ED P  +K    +QLGW++ +   +G    +  S+    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q  +A+KCY NA  S
Sbjct:   74 RTKGLLM--KAVRCYDSLILKAEGKVEPELFCQLGHFNLLLEDYSKALSAYQRYYSLQSDYWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSNPCTLSKAEIQFHIAHLYEIQKRYRASKEAYESLL--QTEDLPPQVKAATLQQLGWMHHTVEQLG----DKASRDSYAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPHDAIKCYINATRS 387          
BLAST of utx vs. Ensembl Medaka
Match: ENSORLT00000028049.1 (histone demethylase UTY [Source:NCBI gene;Acc:101161131])

HSP 1 Score: 517.694 bits (1332), Expect = 1.494e-158
Identity = 246/476 (51.68%), Postives = 326/476 (68.49%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D   P L QFC   S P+ VIR LA  L++DLG+FSTK LVE NP H +E   Q  QP DEN D  G K + RC S++S TTI +YA YQA  F E+ ++E                +++   +  E   + +++ + +   + I FGTN D+SDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG R PGHQE+NNFC++NIN+GPGDCEWF+VPE YWG ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GT+HWVQAIGWCNN+AWNVGPLI+ QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  + VL+TR  +E  H+C  CE EVFN+  +++     LTKK      Y   C +CA K +  L+ F  + QY++ +L++VYD F
Sbjct:  986 KLNPPTPSIYLENKRDAFFPPLHQFCTNPSNPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVWTQLSQPADENWDPTGTKKMWRCESARSHTTIAKYAQYQATSFQESLREENEK-------------KALKEPSDTEPASAESAARKRRGPLKYIKFGTNIDVSDERKWKQQLQELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRIPGHQEHNNFCAVNINIGPGDCEWFAVPEPYWGVMSNFCEKNNINFLMGSWWPNLEDLYEADVPVYRFIQRPGDLVWLNTGTIHWVQAIGWCNNIAWNVGPLIAHQYKLAVERYEWNKLQSVKSMVPMVHLSWNMARNIKVSDHKLFEMIKYCLLRTLKQCQWVKEALATAGKETVLRTRTRDEPAHYCTICEVEVFNLLFVRR---ELLTKK-----PYVVHCQDCARKGSATLDDFVVLEQYRMEDLMQVYDQF 1440          

HSP 2 Score: 303.138 bits (775), Expect = 1.265e-83
Identity = 181/468 (38.68%), Postives = 258/468 (55.13%), Query Frame = 2
Query:  278 KNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQLEMQEAVXXXXXXXXXXXXFAHHSPIYLANNGINSDITIDPNGSKRRRIT 1678
            +  GLL   K    YD +I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ EI+F IAHL E+  +Y+ +++AYE L+    ED P  +K    +QLGW++ +   +G    +  S+    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q  +A+KCY NA  S     +   +  R+  +Q  L+  P+ +     S                                        LP ++EAW+LPIP ELT RQ  L      A   +            P ++++ G   D +     +KRRR +
Sbjct:   74 RTKGLLM--KAVRCYDSLILKAEGKVEPELFCQLGHFNLLLEDYSKALSAYQRYYSLQSDYWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSNPCTLSKAEIQFHIAHLYEIQKRYRASKEAYESLL--QTEDLPPQVKAATLQQLGWMHHTVEQLG----DKASRDSYAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPHDAIKCYINATRSKGCTNI-AALTHRIKCLQAQLSN-PQLSSLQGKSKM--------------------------------------LPLIEEAWSLPIPAELTSRQGGLSSAPQQACKPNHSAEGGASGQSLPPHVSSLGQTEDQSCP---AKRRRAS 490          
BLAST of utx vs. Ensembl Medaka
Match: ENSORLT00000006128.2 (histone demethylase UTY [Source:NCBI gene;Acc:101161131])

HSP 1 Score: 517.694 bits (1332), Expect = 1.949e-158
Identity = 248/483 (51.35%), Postives = 328/483 (67.91%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANG-KTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPI 3931
            +L PPTPS+YL+ K+D   P L QFC   S P+ VIR LA  L++DLG+FSTK LVE NP H +E   Q  QP DEN D  G K + RC S++S TTI +YA YQA  F E+ ++E                +++   +  E   + +++ + +   + I FGTN D+SDE KW  QL EL+KLP F +VVSA N+LSH G TI+GMN+VQLYMKVPG R PGHQE+NNFC++NIN+GPGDCEWF+VPE YWG ++  CE+N I++L GSWWPNLE+L +  +PVYRFIQRPGDLVW+N GT+HWVQAIGWCNN+AWNVGPLI+ QY L++ERYE+NKL+  KS+V MVHLSW MA+NIK++D  L+++IKY L+ +L  C      L  A  + VL+TR  +E  H+C  CE EVFN+  +++     LTKK      Y   C +CA K +  L+ F  + QY++ +L++VYD F   S  I
Sbjct:  986 KLNPPTPSIYLENKRDAFFPPLHQFCTNPSNPVTVIRGLAGALKLDLGLFSTKTLVEANPEHLVEVWTQLSQPADENWDPTGTKKMWRCESARSHTTIAKYAQYQATSFQESLREENEK-------------KALKEPSDTEPASAESAARKRRGPLKYIKFGTNIDVSDERKWKQQLQELSKLPAFARVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRIPGHQEHNNFCAVNINIGPGDCEWFAVPEPYWGVMSNFCEKNNINFLMGSWWPNLEDLYEADVPVYRFIQRPGDLVWLNTGTIHWVQAIGWCNNIAWNVGPLIAHQYKLAVERYEWNKLQSVKSMVPMVHLSWNMARNIKVSDHKLFEMIKYCLLRTLKQCQWVKEALATAGKETVLRTRTRDEPAHYCTICEVEVFNLLFVRR---ELLTKK-----PYVVHCQDCARKGSATLDDFVVLEQYRMEDLMQVYDQFTLVSPQI 1447          

HSP 2 Score: 303.138 bits (775), Expect = 1.434e-83
Identity = 181/468 (38.68%), Postives = 257/468 (54.91%), Query Frame = 2
Query:  278 KNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFS-GYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQLEMQEAVXXXXXXXXXXXXFAHHSPIYLANNGINSDITIDPNGSKRRRIT 1678
            +  GLL   K    YD +I   +  ++P ++  LGH+ LLL  Y  + SAY  + S   D WKN  F+YGL + YFH+NAF  +I+ FQ++LY+ P  SR+KEIH+RLG ++K+N +++ SLKHF+ AL DS   + ++ EI+F IAHL E+  +Y+ +++AYE L+    ED P  +K    +QLGW++ +   +G    +  S+    I  LQ++L  D  SG++WY  GR  +   KVQDAF++YR SIDK+EA+ADTWCSIGVLYQ+QNQPMDALQAY CA QLD  H AAW +LG LYES  Q  +A+KCY NA  S     +   +  R+  +Q  L+                          N     + G                 LP ++EAW+LPIP ELT RQ  L      A   +            P ++++ G   D +     +KRRR +
Sbjct:   74 RTKGLLM--KAVRCYDSLILKAEGKVEPELFCQLGHFNLLLEDYSKALSAYQRYYSLQSDYWKNAAFLYGLGMVYFHYNAFQWAIKAFQEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSNPCTLSKAEIQFHIAHLYEIQKRYRASKEAYESLL--QTEDLPPQVKAATLQQLGWMHHTVEQLG----DKASRDSYAIQCLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPHDAIKCYINATRSKGCTNI-AALTHRIKCLQAQLS--------------------------NPQLSSLQG-------------KSKMLPLIEEAWSLPIPAELTSRQGGLSSAPQQACKPNHSAEGGASGQSLPPHVSSLGQTEDQSCP---AKRRRAS 490          
BLAST of utx vs. Ensembl Medaka
Match: kdm6ba (lysine-specific demethylase 6B [Source:NCBI gene;Acc:101160692])

HSP 1 Score: 491.115 bits (1263), Expect = 1.189e-145
Identity = 240/478 (50.21%), Postives = 319/478 (66.74%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCLSQ--PIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVR--YETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D  SP L QFC     P+ VIR LA +LR++LG+FSTK LVE N +  +E R Q  QP DEN D +G      C SS+S TTI +YA YQA  F E+ ++EK  +             S  +   +  K  +N  GE+K   + I FGTN DLSD  +W  QL EL KLP F++V S+ NMLSH G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF V E YW AIN  CE++ +DYLTGSWWP LE+L    IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL + QY +++ER+E+N++K  KSIV M+H+SW +A  +K+TD   Y++IK+ L+ S+ H  +  + L     ++  Q+R ++E  ++C +C+ EVF++  +           C+   R  Y   C +CA + +PNL +   + QY++ EL+ +YDSF
Sbjct: 1544 KLNPPTPSIYLESKRDAFSPVLLQFCTDSKNPVTVIRGLAGSLRLNLGLFSTKSLVEANADQAVEVRTQVQQPADENWDPSGTGQTWPCESSRSYTTIAKYAQYQASSFQESLQEEKGSDEEEEDEDVKKSLPSSVDANKDSSKEGSN--GEQKAVGKIIKFGTNIDLSDPKRWKPQLQELQKLPAFMRVASSGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFCVHENYWEAINDFCEKHGVDYLTGSWWPVLEDLYNANIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNAYQYQVALERFEWNEVKKVKSIVPMIHVSWNVAHTLKVTDPDTYKMIKHCLLQSMKHIQILRDQLVAEGKKISYQSRVKDEPAYYCNECDVEVFDLLFV----------TCESSSRKTYVVHCEDCARQRSPNLTNVVVLEQYRVEELMSIYDSF 2009          
BLAST of utx vs. Ensembl Medaka
Match: kdm6bb (lysine-specific demethylase 6B [Source:NCBI gene;Acc:101164833])

HSP 1 Score: 477.633 bits (1228), Expect = 1.075e-142
Identity = 240/488 (49.18%), Postives = 320/488 (65.57%), Query Frame = 2
Query: 2492 QLLPPTPSVYLDCKKDVHSPELRQFCL--SQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLL-RCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXX----------QSISNGTSEELKYSNNSS--GEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSF 3910
            +L PPTPS+YL+ K+D  SP L QFC     P+ VIR LA +LR++LG+FSTK LVE N +H +E R Q  QP DEN + +G      C SS+S TTI +YA YQA  F E+ ++EK   +                      S++N  +     ++  S   ++K  R+ I FGTN DLSD  +W AQL EL KLP F++V S  NMLS  G TI+GMN+VQLYMKVPG RTPGHQENNNFCS+NIN+GPGDCEWF+V E YW  IN  CE++ +DYLTGSWWP LE+L    IPVYRFIQRPGDLVWINAGTVHWVQA+GWCNN+AWNVGPL S QY L++ER+E+N++K  KSIV M+H+SW +A+ +K+TD   +++IK+ LM S+ H  +    L  A  ++  Q R ++E  ++C +C+ EVFN+     + T+  TK+      YE  C +CA   + +L     + QY+  +L+ +YD+F
Sbjct: 1141 KLNPPTPSIYLESKRDAFSPILLQFCTDPKNPVTVIRGLAGSLRLNLGLFSTKSLVEANSDHAVEVRTQVQQPADENWNTSGSVQTWPCESSRSHTTISKYAQYQASSFQESLQEEKGSESEDEEEETVKAALTLTICKGNPPSVTNKATSAPHVTSTPSFFSDQKTSRKIIKFGTNIDLSDPKRWKAQLQELLKLPAFMRVESNSNMLSLVGQTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFAVHENYWETINKFCEKHGVDYLTGSWWPVLEDLYSSNIPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLNSYQYQLALERFEWNEVKKVKSIVPMIHVSWNVARLVKITDEDTFKMIKHCLMQSIKHIQILREQLVAAGKKICFQPRVKDEPAYYCNECDVEVFNLLF---VTTDSSTKRT-----YEVHCEDCARAKSSSLAGVVVLEQYRTEDLMRIYDNF 1620          
BLAST of utx vs. Planmine SMEST
Match: SMESG000020110.1 (SMESG000020110.1)

HSP 1 Score: 2297.32 bits (5952), Expect = 0.000e+0
Identity = 1297/1298 (99.92%), Postives = 1297/1298 (99.92%), Query Frame = 2
Query:   59 MNXXXXXXXXXXXXETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIXXXXXXXXXXXXXXEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEXXXXXXXXXXXXXXXXRPPPHQNVNTIPVGGPAXXXXXXXXXXXXXXKLPTVDEAWNLPIPTELTQRQMQLEMQEAVXXXXXXXXXXXXFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEXXXXXXXXXXXXVMISLXXXXXXXXXXXXXXXNKLFXXXXXXXXXXXXSADSSGQSIDHLNCKKDMKNIAXXXXXXXXXXXXXAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEEQEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIXXXXXXXXXXXXNERXXXXXXXXXXXXXXXXXXXXXXEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKXXXXXXXXXXXXXXXQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR 3952
            MNSDLSHSFKFSSSETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIYLFLGHYQLLLYLYEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEKNIPNQISNQQKISQIRPPPHQNVNTIPVGGPASSLSPSMMSQSMMMKLPTVDEAWNLPIPTELTQRQMQLEMQEAVASASSSGGISRIFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEQQSNQLNNQQRQVMISLQNQQQRYQQQQLQQQNKLFINTNNIMTTCTNSADSSGQSIDHLNCKKDMKNIANQDQSSTNQDSNSAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEE EHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIPQPPYPPPLVVPNERSSDSNSFNNVNNNNSSISRQNSEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKNGNNNSSLLSGALGNQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR
Sbjct:    1 MNSDLSHSFKFSSSETKILRELSSFDFGFINFNTPKGQAKKQILEKAINCLDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNIDPYIYLFLGHYQLLLYLYEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFHFNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDHIKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTWYLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEVRVEIKDRMMIIQKLLTQLPEKNIPNQISNQQKISQIRPPPHQNVNTIPVGGPASSLSPSMMSQSMMMKLPTVDEAWNLPIPTELTQRQMQLEMQEAVASASSSGGISRIFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLTQQQTQILLSMEQQSNQLNNQQRQVMISLQNQQQRYQQQQLQQQNKLFINTNNIMTTCTNSADSSGQSIDHLNCKKDMKNIANQDQSSTNQDSNSAHNEDLHLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIGSIENVKEEPEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKVTKLASTNPNLWNITYLPGNRIPQPPYPPPLVVPNERSSDSNSFNNVNNNNSSISRQNSEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLASTLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSSKSTTTIQEYANYQARMFVEAKKDEKNGNNNSSLLSGALGNQSISNGTSEELKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVSACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDCEWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIYKSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKARVQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYETRCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR 1298          
BLAST of utx vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 53.5286 bits (127), Expect = 6.158e-7
Identity = 26/90 (28.89%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  986 ENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNE 1255
            EN   DA   Y  +I+    NA  +C+    Y + N+  +A++    A ++D K+  A++ +G+ Y  MG++ EA+ CY+ A+  + +N+
Sbjct:   71 ENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQ 160          
BLAST of utx vs. Planmine SMEST
Match: SMESG000020957.1 (SMESG000020957.1)

HSP 1 Score: 53.5286 bits (127), Expect = 6.273e-7
Identity = 26/90 (28.89%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  986 ENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDALQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNE 1255
            EN   DA   Y  +I+    NA  +C+    Y + N+  +A++    A ++D K+  A++ +G+ Y  MG++ EA+ CY+ A+  + +N+
Sbjct:   92 ENLFSDAVSCYSKAIELDPRNAVYYCNRAAAYSKLNKNENAIEDCHSALKIDAKYGKAYSRMGLAYTGMGKFDEAIVCYKRAIEIEPDNQ 181          
The following BLAST results are available for this feature:
BLAST of utx vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KDM6A3.391e-16352.73lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC... [more]
KDM6A3.756e-16352.73lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC... [more]
KDM6A9.157e-16052.73lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC... [more]
KDM6A1.050e-15952.73lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC... [more]
KDM6A1.613e-15952.73lysine demethylase 6A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of utx vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
utx-14.878e-11540.30UTX (Ubiquitously transcribed TPR on X) homolog [... [more]
utx-15.030e-11540.30UTX (Ubiquitously transcribed TPR on X) homolog [... [more]
jmjd-3.13.045e-5027.64Lysine-specific demethylase jmjd-3.1 [Source:UniP... [more]
jmjd-3.14.368e-5027.64Lysine-specific demethylase jmjd-3.1 [Source:UniP... [more]
jmjd-3.37.591e-5032.19JuMonJi (Transcription factor) Domain protein [So... [more]
back to top
BLAST of utx vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Utx6.534e-17153.07gene:FBgn0260749 transcript:FBtr0333410[more]
Utx6.473e-16952.87gene:FBgn0260749 transcript:FBtr0080077[more]
Utx6.473e-16952.87gene:FBgn0260749 transcript:FBtr0080076[more]
Utx1.011e-16853.07gene:FBgn0260749 transcript:FBtr0303903[more]
Utx9.488e-16752.87gene:FBgn0260749 transcript:FBtr0080075[more]
back to top
BLAST of utx vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm6a6.617e-16152.52lysine (K)-specific demethylase 6A [Source:ZFIN;Ac... [more]
kdm6a1.372e-16052.52lysine (K)-specific demethylase 6A [Source:ZFIN;Ac... [more]
kdm6ba1.027e-14749.79lysine (K)-specific demethylase 6B, a [Source:ZFIN... [more]
kdm6al2.930e-14749.06lysine (K)-specific demethylase 6A, like [Source:Z... [more]
kdm6bb5.808e-14650.00lysine (K)-specific demethylase 6B, b [Source:ZFIN... [more]
back to top
BLAST of utx vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm6a5.656e-16554.41lysine demethylase 6A [Source:NCBI gene;Acc:100170... [more]
kdm6a6.412e-16554.41lysine demethylase 6A [Source:NCBI gene;Acc:100170... [more]
kdm6a1.220e-16454.41lysine demethylase 6A [Source:NCBI gene;Acc:100170... [more]
kdm6a1.573e-16454.41lysine demethylase 6A [Source:NCBI gene;Acc:100170... [more]
kdm6a1.676e-16454.41lysine demethylase 6A [Source:NCBI gene;Acc:100170... [more]
back to top
BLAST of utx vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kdm6a2.804e-16352.73lysine (K)-specific demethylase 6A [Source:MGI Sym... [more]
Kdm6a7.479e-16053.36lysine (K)-specific demethylase 6A [Source:MGI Sym... [more]
Kdm6a2.200e-15953.13lysine (K)-specific demethylase 6A [Source:MGI Sym... [more]
Uty1.424e-15551.13ubiquitously transcribed tetratricopeptide repeat ... [more]
Uty3.900e-15551.13ubiquitously transcribed tetratricopeptide repeat ... [more]
back to top
BLAST of utx vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15550|KDM6A_HUMAN4.397e-15952.73Lysine-specific demethylase 6A OS=Homo sapiens OX=... [more]
sp|O70546|KDM6A_MOUSE5.232e-15953.36Lysine-specific demethylase 6A OS=Mus musculus OX=... [more]
sp|O14607|UTY_HUMAN1.521e-15452.10Histone demethylase UTY OS=Homo sapiens OX=9606 GN... [more]
sp|P79457|UTY_MOUSE7.218e-15451.13Histone demethylase UTY OS=Mus musculus OX=10090 G... [more]
sp|Q5NCY0|KDM6B_MOUSE9.973e-14449.79Lysine-specific demethylase 6B OS=Mus musculus OX=... [more]
back to top
BLAST of utx vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L0H9700.000e+0100.00Utx (Fragment) OS=Schmidtea mediterranea OX=79327 ... [more]
A0A1I8I8181.739e-17652.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G1793.051e-17552.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A482V9L74.935e-17454.95Lysine-specific demethylase 6A OS=Asbolus verrucos... [more]
A0A034VW964.483e-17353.42Lysine-specific demethylase 6A (Fragment) OS=Bactr... [more]
back to top
BLAST of utx vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm6al1.073e-15651.35lysine (K)-specific demethylase 6A, like [Source:Z... [more]
kdm6ba1.241e-15050.62lysine demethylase 6B [Source:NCBI gene;Acc:103028... [more]
kdm6a7.840e-14849.48lysine (K)-specific demethylase 6A [Source:ZFIN;Ac... [more]
kdm6bb3.581e-14448.76lysine-specific demethylase 6B-like [Source:NCBI g... [more]
kdm6bb3.581e-14448.76lysine-specific demethylase 6B-like [Source:NCBI g... [more]
back to top
BLAST of utx vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ogt.13.114e-621.34O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
back to top
BLAST of utx vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYC82.168e-3032.85General transcriptional co-repressor; acts togethe... [more]
CDC233.712e-623.91Subunit of the Anaphase-Promoting Complex/Cyclosom... [more]
back to top
BLAST of utx vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393303.945e-11843.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280452.567e-3744.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271181.830e-2442.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397477.253e-727.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434841.438e-627.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of utx vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028751.11.313e-15851.35histone demethylase UTY [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000028049.11.494e-15851.68histone demethylase UTY [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000006128.21.949e-15851.35histone demethylase UTY [Source:NCBI gene;Acc:1011... [more]
kdm6ba1.189e-14550.21lysine-specific demethylase 6B [Source:NCBI gene;A... [more]
kdm6bb1.075e-14249.18lysine-specific demethylase 6B [Source:NCBI gene;A... [more]
back to top
BLAST of utx vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020110.10.000e+099.92SMESG000020110.1[more]
SMESG000020957.16.158e-728.89SMESG000020957.1[more]
SMESG000020957.16.273e-728.89SMESG000020957.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032882
GenBankAGA95405.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032882 ID=SMED30032882|Name=utx|organism=Schmidtea mediterranea sexual|type=transcript|length=4292bp
CTATATATACGGACTTTTTCAACACTAATAATGTTATACTATTTTTCATA
CTTGCTAAATGAACTCTGATTTATCTCATTCGTTTAAGTTCTCTAGTTCG
GAGACCAAAATATTACGTGAACTTAGCAGCTTTGATTTCGGTTTTATAAA
TTTTAATACCCCTAAAGGTCAAGCTAAAAAACAAATATTAGAAAAAGCCA
TTAATTGTTTGGATAGTACATTATCTAAGTTAGTTGAAACTTTTAAAGAA
AAGAAAGATCAAGAGCAAGCCGAATTTAAAAACAGTGGCCTATTAACAAT
AGGAAAACAGTTTGAATTGTATGACAAAGTTATAAAATTACTAGATAGTA
ACATTGATCCATACATTTATTTATTTCTTGGCCATTATCAACTTTTATTG
TATCTATACGAAGACTCATTTTCAGCATACCTAGAATTTGAATCTCGAAA
TAAAGATAGTTGGAAAAATATACAATTTATTTACGGATTAGCTATTTGTT
ATTTTCATTTCAACGCTTTCGATAAATCCATCGAATTATTTCAAAAGATT
CTATATCTTCAACCAAACTGCAGCAGATCGAAAGAAATTCATATTAGATT
AGGCTATATCTATAAAATCAACATAAATTTCGATTGTAGCTTGAAACATT
TCCGTCAAGCTCTTAACGATTCTTGCAAAGGCTCATTTACTGAAACTGAA
ATACGCTTTCAAATTGCTCATCTTCTTGAAGTTTGTGGAAAATATAAACA
AGCCCAAAAAGCATACGAACAATTAATTGGATTTAGTAAAGAAGACGCTC
CAGATCACATAAAACATTTGTGCTATAGGCAATTAGGCTGGTTAAACTTT
TCTGGCTATATTGGGAAATCTAATCCAAATACTCCTTCGAAGAAAGATTC
AGTAATTAATCTATTACAACAAGCACTTAATTTTGACAATACAAGCGGGA
AAACTTGGTATTTATTTGGAAGAGCTCAAGCTAGAGAAAACAAAGTCCAA
GACGCGTTTATGGCATATAGGAATTCAATCGATAAAACGGAAGCAAATGC
GGATACATGGTGTTCTATCGGTGTTCTTTATCAAGAACAAAATCAACCAA
TGGATGCATTGCAAGCATATTTCTGTGCTTGTCAATTGGATAGAAAGCAT
GTGGCTGCTTGGACAAATCTTGGTGTGCTCTATGAAAGTATGGGACAATA
CAAAGAAGCCTTGAAATGCTATCAGAATGCAGTAAGTTCTGACAAAAATA
ACGAAGTTCGAGTGGAAATCAAAGATCGCATGATGATTATACAAAAATTA
TTAACTCAATTACCGGAGAAAAATATACCCAATCAAATTTCAAATCAACA
GAAAATTTCTCAGATACGGCCACCTCCACACCAAAATGTCAATACCATTC
CAGTTGGTGGTCCTGCTAGCTCATTGTCTCCGTCCATGATGTCACAATCT
ATGATGATGAAGTTGCCGACTGTGGATGAAGCATGGAATCTGCCCATTCC
CACAGAGTTGACCCAAAGACAAATGCAATTAGAAATGCAAGAAGCTGTTG
CTTCAGCTTCCAGCTCAGGTGGAATATCACGAATATTTGCTCATCATTCT
CCGATTTATTTAGCAAATAATGGAATTAATTCAGATATTACAATCGATCC
AAATGGCAGCAAGCGAAGACGAATCACAGAAGGGGATGAATTGGTGTCTC
CATTAACGCAGCAACAAACACAAATTCTTTTGTCCATGGAGCAGCAAAGC
AATCAATTAAACAACCAGCAACGTCAGGTAATGATATCTCTGCAAAATCA
ACAACAAAGATATCAACAACAACAACTACAACAGCAAAACAAATTATTCA
TCAACACCAATAATATAATGACGACATGCACCAACAGCGCAGACTCATCC
GGTCAAAGTATTGATCATCTGAATTGCAAAAAAGATATGAAAAATATCGC
CAATCAAGACCAATCTAGTACTAATCAAGATAGCAACAGCGCTCACAATG
AAGATCTGCATCTGATGCAAGATCTCGATGAAATCCCCGAGGATTACAGT
GACGATATTATGGTGAATTTAGATGCTTTGCTAAATGATCCGATGGGAAA
TTTCGATGAGCATTTCGATGATGCAAATTCCGCAACAAACAATGCCAATC
AGATTGGATCTATTGAAAATGTCAAAGAAGAGCAGGAACATCCTGTCACG
GATTTGCTATCATATCTGAGAACAGTACTTGATGAAAAGCAACCGAAAGT
CGATATACTGGAAGAAATGGACATATTGATGAATGGTGCCCAGATTATTG
ACAAAGTCACCAAATTAGCGAGCACAAATCCTAACCTATGGAATATCACT
TACCTTCCGGGAAACAGAATCCCACAACCGCCTTATCCTCCACCACTTGT
CGTGCCCAATGAAAGGTCATCCGATTCTAACAGTTTCAATAATGTTAACA
ACAACAACTCATCAATATCTAGACAGAATTCCGAATATTTCCAATTGCTT
CCACCGACACCAAGTGTCTATCTAGATTGTAAAAAGGATGTTCATTCACC
AGAACTCAGACAATTCTGTTTGTCTCAGCCAATTGTAGTTATACGGAATT
TGGCATCAACTTTGAGGATGGATCTCGGAATGTTCTCGACTAAAATGTTG
GTGGAAACTAATCCGAATCACAAAATTGAGCAAAGAATTCAAGATTTACA
ACCACCCGATGAAAATAAAGATGCCAATGGAAAAACTCTTTTACGTTGTT
TGTCTTCTAAAAGCACAACTACTATTCAAGAATATGCAAATTATCAAGCT
CGAATGTTTGTTGAAGCCAAGAAAGATGAGAAAAATGGTAATAATAATTC
ATCACTTCTTTCTGGCGCGTTAGGCAATCAATCCATATCGAACGGGACAT
CCGAGGAATTAAAATATTCCAATAATTCCTCGGGAGAAGAAAAGAAAAAG
CGACGAAAAATATATTTTGGCACAAATTGTGATCTATCTGATGAATCAAA
GTGGTTTGCTCAGCTTCATGAACTAAATAAACTTCCAAATTTTCTCAAAG
TGGTAAGCGCTTGTAATATGCTTAGCCACTGTGGTTTCACGATTATGGGA
ATGAATTCTGTCCAGTTATACATGAAAGTACCCGGCTGTCGCACTCCGGG
ACATCAAGAAAACAACAATTTTTGTTCTATCAATATTAATGTTGGTCCTG
GAGATTGTGAATGGTTCTCTGTTCCAGAACAATATTGGGGAGCAATTAAT
ACATTATGTGAAGAAAATAAGATTGATTATTTAACTGGTTCTTGGTGGCC
TAATTTAGAAGAATTAAAACAACGACAAATTCCTGTATATCGGTTTATTC
AACGTCCAGGAGATTTGGTTTGGATAAATGCTGGTACAGTTCACTGGGTC
CAAGCTATTGGTTGGTGCAATAATGTCGCCTGGAATGTAGGTCCATTAAT
AAGTCGTCAATACAGTCTTAGTATGGAAAGATATGAGTATAATAAATTGA
AAATTTATAAATCTATCGTTTCAATGGTTCATTTGAGTTGGCAAATGGCG
AAAAATATAAAAATGACTGATAGTCATCTTTACCAGCTAATTAAATATAC
CTTGATGGTAAGTCTTATACACTGTACATTGACTTGGAATTATCTCGAGA
AAGCTCGAGTTCAAATGGTCCTACAAACTAGAGAAGAAAATGAACATACT
CATCACTGTGTTGATTGTGAATGTGAAGTATTTAATATATTTCTTATTAA
ACAAATCAAGACAAATCCATTGACAAAAAAGTGTCAGAAAGATGTGCGTT
ATGAAACTCGTTGCCTCAACTGTGCATTTAAAATGAATCCTAATTTGAAT
TCGTTTAAAGCCATCTATCAATATAAATTATCAGAATTAGTAGAAGTTTA
CGATTCTTTCAAATACAAATCGTCGCCAATTGCAGCATACTCAGTGAACA
GATAAGAATAGATATGATAATCGATAATGGGATTACTGTTGTATATTTCT
CAAATTCATAATAACAATCAGTGTAGCTAGTAATCAGTGGACATTCAATT
TAGGTAGTTTGTTGCGTTGATTTCCCGGAAGCTATCTCAATGCAATGAAC
TCTACATGTTAAATTTGGATCTTGTTCATATTATTATTATTAATATATTT
GTTATTATTTTTCTACAATTTACATGTGGTTAGCATTCCTGATATTTATG
CCGCATTTTATATTTTCATTTCTCTATCACGTTTATCTGGCTCTGAAATA
TTCTTTGATTGTATTTGCTGTACACATGAAACATCACCCTAC
back to top

protein sequence of SMED30032882-orf-1

>SMED30032882-orf-1 ID=SMED30032882-orf-1|Name=SMED30032882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1299bp
MNSDLSHSFKFSSSETKILRELSSFDFGFINFNTPKGQAKKQILEKAINC
LDSTLSKLVETFKEKKDQEQAEFKNSGLLTIGKQFELYDKVIKLLDSNID
PYIYLFLGHYQLLLYLYEDSFSAYLEFESRNKDSWKNIQFIYGLAICYFH
FNAFDKSIELFQKILYLQPNCSRSKEIHIRLGYIYKININFDCSLKHFRQ
ALNDSCKGSFTETEIRFQIAHLLEVCGKYKQAQKAYEQLIGFSKEDAPDH
IKHLCYRQLGWLNFSGYIGKSNPNTPSKKDSVINLLQQALNFDNTSGKTW
YLFGRAQARENKVQDAFMAYRNSIDKTEANADTWCSIGVLYQEQNQPMDA
LQAYFCACQLDRKHVAAWTNLGVLYESMGQYKEALKCYQNAVSSDKNNEV
RVEIKDRMMIIQKLLTQLPEKNIPNQISNQQKISQIRPPPHQNVNTIPVG
GPASSLSPSMMSQSMMMKLPTVDEAWNLPIPTELTQRQMQLEMQEAVASA
SSSGGISRIFAHHSPIYLANNGINSDITIDPNGSKRRRITEGDELVSPLT
QQQTQILLSMEQQSNQLNNQQRQVMISLQNQQQRYQQQQLQQQNKLFINT
NNIMTTCTNSADSSGQSIDHLNCKKDMKNIANQDQSSTNQDSNSAHNEDL
HLMQDLDEIPEDYSDDIMVNLDALLNDPMGNFDEHFDDANSATNNANQIG
SIENVKEEQEHPVTDLLSYLRTVLDEKQPKVDILEEMDILMNGAQIIDKV
TKLASTNPNLWNITYLPGNRIPQPPYPPPLVVPNERSSDSNSFNNVNNNN
SSISRQNSEYFQLLPPTPSVYLDCKKDVHSPELRQFCLSQPIVVIRNLAS
TLRMDLGMFSTKMLVETNPNHKIEQRIQDLQPPDENKDANGKTLLRCLSS
KSTTTIQEYANYQARMFVEAKKDEKNGNNNSSLLSGALGNQSISNGTSEE
LKYSNNSSGEEKKKRRKIYFGTNCDLSDESKWFAQLHELNKLPNFLKVVS
ACNMLSHCGFTIMGMNSVQLYMKVPGCRTPGHQENNNFCSININVGPGDC
EWFSVPEQYWGAINTLCEENKIDYLTGSWWPNLEELKQRQIPVYRFIQRP
GDLVWINAGTVHWVQAIGWCNNVAWNVGPLISRQYSLSMERYEYNKLKIY
KSIVSMVHLSWQMAKNIKMTDSHLYQLIKYTLMVSLIHCTLTWNYLEKAR
VQMVLQTREENEHTHHCVDCECEVFNIFLIKQIKTNPLTKKCQKDVRYET
RCLNCAFKMNPNLNSFKAIYQYKLSELVEVYDSFKYKSSPIAAYSVNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR003347JmjC_dom
IPR011990TPR-like_helical_dom_sf
IPR001440TPR_1
IPR013026TPR-contain_dom
IPR001633EAL_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0046872metal ion binding
GO:0071558histone demethylase activity (H3-K27 specific)
Vocabulary: biological process
TermDefinition
GO:0010468regulation of gene expression
GO:0032259methylation
GO:0071557histone H3-K27 demethylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 161..181
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 379..724
e-value: 8.7E-150
score: 500.4
NoneNo IPR availableGENE3DG3DSA:2.10.110.20coord: 793..865
e-value: 9.1E-44
score: 150.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.1370coord: 725..878
e-value: 9.1E-44
score: 150.7
NoneNo IPR availablePANTHERPTHR14017GLUCOSE REPRESSION MEDIATOR PROTEINcoord: 18..878
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 423..775
IPR003347JmjC domainSMARTSM00558cupin_9coord: 574..737
e-value: 3.7E-41
score: 152.7
IPR003347JmjC domainPFAMPF02373JmjCcoord: 612..720
e-value: 1.7E-30
score: 105.7
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 574..737
score: 28.527