DDE_3 domain-containing protein

Overview
NameDDE_3 domain-containing protein
Smed IDSMED30032880
Length (bp)1794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_3 domain-containing protein (SMED30032880) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30032880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_3 domain-containing protein (SMED30032880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_3 domain-containing protein (SMED30032880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig45uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig45newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000009925.1 Contig41uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000009925.1 Contig41newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig44uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000069530.1 SMESG000066274.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000020877.1 SMESG000005064.1 SMESG000002444.1 SMESG000000320.1 SMESG000055828.1 SMESG000014398.1 SMESG000012251.1 SMESG000009925.1 Contig44newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000040831.1 Contig41uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000040831.1 Contig41newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000066332.1 Contig44uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032880SMESG000066332.1 Contig44newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30032880SMESG000069530.1 SMESG000062787.1 SMESG000050992.1 SMESG000041908.1 SMESG000008972.1 SmedASXL_018585SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: W4XP44 (DDE_3 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.433e-19
Identity = 85/321 (26.48%), Postives = 135/321 (42.06%), Query Frame = 1
Query:  112 KTIIYKYRKFGKLSQGKIGGSI-SKISEENGNKLLDFVEKNVYASLEEMKNFL---ISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEA---------------WMDSELGR-------------------NISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNE-----TGYRLIHDNASIHGVA---ISQNNFIE--HLPPYGPFLNPIESVFSKIKFNIRKSISR-----------AGGFSFMNFQS-RFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFG 894
            ++I+  Y   G++ +   GG+  SKI EE  N L D ++ N   +L +MK+ L   + +   VST TI+R L+  L+T K        RN+ RVL  R EY   +LE                 W     GR                   N+S A++  V   VHH++   +  + +++ F      + NE         LI+DNA  H  A      N+ IE   LPPY PFLN  E   S  K  ++++++            A G + +N Q  R D L++     +        T ++ H + + P+C+ +  I G
Sbjct:   44 RSIVATYLDSGRIEKLPRGGARNSKIDEEMKNYLQDIIDTNPLLTLRQMKDKLREDLPQKPEVSTTTIARALDAMLMTLKLAEDVPDARNAPRVLQQREEYAEWFLEHGVLANCVFIDECGYNIWTRRTQGRAPRGVPARRVVHGQRGRNCNVSFAVSAAVG-LVHHEMAFETVTRASFERFLAATVAECNEMFPDDAPVVLIYDNARPHVRAELPEDVNSLIETKRLPPYSPFLNMTEMAHSSFKSAVKRTLALPAWQRRVGDRVAAGRAGVNLQQWRCDALREVAVQCIDTVTPAKCTQWYNHSQTYMPRCLARQEIDG 363          

HSP 2 Score: 32.3426 bits (72), Expect = 9.433e-19
Identity = 14/36 (38.89%), Postives = 23/36 (63.89%), Query Frame = 2
Query:   11 RISEIDKIRIINAME-NGEDYFHFGKLLGIARNSIK 115
            +IS +D+ R++ A E NG+DY      LGI R++ +
Sbjct:    9 KISNVDRRRLVEAFEGNGQDYLELADNLGIKRSTAR 44          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: W4Z6F7 (DDE_3 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.942e-18
Identity = 85/321 (26.48%), Postives = 135/321 (42.06%), Query Frame = 1
Query:  112 KTIIYKYRKFGKLSQGKIGGSI-SKISEENGNKLLDFVEKNVYASLEEMKNFL---ISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEA---------------WMDSELGR-------------------NISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNE-----TGYRLIHDNASIHGVA---ISQNNFIE--HLPPYGPFLNPIESVFSKIKFNIRKSISR-----------AGGFSFMNFQS-RFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFG 894
            ++I+  Y   G++ +   GG+  SKI EE  N L D ++ N   +L +MK+ L   + +   VST TI+R L+  L+T K        RN+ RVL  R EY   +LE                 W     GR                   N+S A++  V   VHH++   +  + +++ F      + NE         LI+DNA  H  A      N+ IE   LPPY PFLN  E   S  K  ++++++            A G   +N Q  R D L++     +        T ++ H + + P+C+++  I G
Sbjct:   44 RSIVATYLDSGRIEKLPRGGARNSKIDEEMKNYLQDIIDTNPLLTLRQMKDKLREDLPQKPEVSTTTIARALDVMLMTLKLAEDVPDARNAPRVLQQRGEYAEWFLEHGVLANCVFIDECGYNIWTRRTQGRAPRGVPARRVVHGQRGRNCNVSFAVSAAVG-LVHHEMAFETVTRASFERFLAAKVAECNEMFPDDAPVVLIYDNARPHVRAELPEDVNSLIETKRLPPYSPFLNMTEMAHSSFKSAVKRTLALPAWQRRVGDRVAAGREGVNLQQWRCDTLREVAVQCIDTVTPAKCTQWYNHSQTYMPRCLERQEIDG 363          

HSP 2 Score: 32.3426 bits (72), Expect = 5.942e-18
Identity = 14/36 (38.89%), Postives = 23/36 (63.89%), Query Frame = 2
Query:   11 RISEIDKIRIINAME-NGEDYFHFGKLLGIARNSIK 115
            +IS +D+ R++ A E NG+DY      LGI R++ +
Sbjct:    9 KISNVDRRRLVEAFEGNGQDYLELADNLGIKRSTAR 44          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A498ND26 (DDE_3 domain-containing protein OS=Labeo rohita OX=84645 GN=ROHU_018785 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.405e-17
Identity = 83/321 (25.86%), Postives = 138/321 (42.99%), Query Frame = 1
Query:  115 TIIYKYRKFGKLS-QGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENL------SVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMR--------------YLEEAWMDSELGR---------------------NISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEIT---VKLNETG--------YRLIHDNASIHGVAISQNNFIEH-------LPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGD 897
            +II  +R+  +L  Q ++GG    ++E+   ++ + V  N   +L ++++ ++ +N       ++S +TI R L+NH +T KQI     ERNSDRV +LR +Y  R              +++EA  +   GR                     NI++  AI  N    H   +G        IF + +    +  NE G        Y ++ DN + H   + +  F  H       LPPY PFLNPIE  FS  ++ + +  ++         Q       DA  +++  +  R    +  H RRFFP+CI +  I  D
Sbjct:   19 SIIQTFRRENRLGRQPRVGGRGKLLNEQQEREICNMVIANNAITLRQIRDAILQDNHIFQNINTISISTIDRVLKNHQMTMKQIYKVPFERNSDRVKELRYQYVNRIMALEGHETPHILVFVDEAGFNLAKGRRRGRNIIGHRATVDVPGQRGGNITMCAAISENGVATHIPSLGPYNTHKLLIFLDRLYTDFIPENERGVIGPHLPIYVIVWDNVNFHHSPLIRGWFATHPRTVMEFLPPYSPFLNPIEEFFSAWRWRVYEHHAQD--------QPSLLHAMDAACDDITGDQCR---GWLRHARRFFPRCIARESIRCD 328          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A498NQ15 (DDE_3 domain-containing protein OS=Labeo rohita OX=84645 GN=ROHU_015315 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.973e-17
Identity = 83/321 (25.86%), Postives = 138/321 (42.99%), Query Frame = 1
Query:  115 TIIYKYRKFGKLS-QGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENL------SVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMR--------------YLEEAWMDSELGR---------------------NISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEIT---VKLNETG--------YRLIHDNASIHGVAISQNNFIEH-------LPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGD 897
            +II  +R+  +L  Q ++GG    ++E+   ++ + V  N   +L ++++ ++ +N       ++S +TI R L+NH +T KQI     ERNSDRV +LR +Y  R              +++EA  +   GR                     NI++  AI  N    H   +G        IF + +    +  NE G        Y ++ DN + H   + +  F  H       LPPY PFLNPIE  FS  ++ + +  ++         Q       DA  +++  +  R    +  H RRFFP+CI +  I  D
Sbjct:   19 SIIQTFRRENRLGRQPRVGGRGKLLNEQQEREICNMVIANNAITLRQIRDAILQDNHIFQNINTISISTIDRVLKNHQMTMKQIYKVPFERNSDRVKELRYQYVNRIMALEGHETPHILVFVDEAGFNLAKGRRRGRNIIGHRATVDVPGQRGGNITMCAAISENGVATHIPSLGPYNTHKLLIFLDRLYTDFIPENERGVIGPHLPIYVIVWDNVNFHHSPLIRGWFATHPRMVMEFLPPYSPFLNPIEEFFSAWRWRVYEHHAQD--------QPSLLHAMDAACDDITGDQCR---GWLRHARRFFPRCIARESIRCD 328          
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Match: A0A267DQJ8 (DDE_3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002000g2 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.804e-15
Identity = 78/313 (24.92%), Postives = 136/313 (43.45%), Query Frame = 1
Query:  112 KTIIYKYRKFGKLSQGKIGGSISK-ISEENGNKLLDFVEKNVYASLEEMKNFLI---SENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEA---------------W-----------------MDSELGRNISLALAIGVNKQ-VHHKLIVGSNKKDTYQIFTNEITVKLNETGYRLIHDNASIH--GVAISQNNFIEHLPPYGPFLNPIESVFSKIKFNIRKSISR--------------AGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYF----WHIR--RFFPKCI 873
            + +I K+ + G++   K GG+  K +S+E    L+ FV     A+L++M+  L+    +  + +  TISR L+  LIT K +R      N+DR+   R E+    + E                W                 + ++ GRN+++ LA+   +  V+ K++ G   ++ +  F  E+   ++E  + L+HDNA  H    A+ +      LPPY PFLN  E   + +K ++++S+SR              A G +    ++R       L+ EL  ED            WH    R+ P+CI
Sbjct:   45 RNVIVKFERTGRVEAEKRGGNKPKALSDEMIEALVGFVADTPAATLQDMRRHLMQAFPDWQACTIQTISRALDGQLITVKLLRTIPNAWNADRIKHERREFAKWLMTEGMGKLLVFCDEMGCNVWTARTQGRAAEGVRAVRIVANQRGRNVTMCLAVSPMRGLVYWKIVRGGMTRELFAEFFAELAALVDEP-FCLLHDNARAHWDPPAMGEEQEYRPLPPYSPFLNMTERAIAAVKASLKRSLSRVELQRQIGDRNAAAALGITLQEHRARI------LEREL--EDCMSAVTQLHCEAWHRESLRYVPRCI 348          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000041908.1 (SMESG000041908.1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.421e-149
Identity = 240/299 (80.27%), Postives = 247/299 (82.61%), Query Frame = 1
Query:   70 FPFWKIIGNS*KFHKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEAWMDSEL---------------------------------GRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNETGYRLIHDNASIHGVAISQNNFIEHLPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPK 867
            F F K++G +    KTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYT RYLEEAWMDS+L                                 GRN+SLALAIGVN  VHHKL+VGS KKDTYQIF NEITVKLN TG+RLIHDNASIHG AIS NN IEHLPPY PFLNPIESVFSKIKFNIRKSISRAGG S MNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPK
Sbjct:  527 FHFGKLLGIARNSIKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAIGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGFRLIHDNASIHGGAISLNNVIEHLPPYSPFLNPIESVFSKIKFNIRKSISRAGGLSSMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPK 825          

HSP 2 Score: 72.4034 bits (176), Expect = 6.637e-13
Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 2
Query:   11 RISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK 115
            +ISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK
Sbjct:  507 KISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK 541          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000005064.1 (SMESG000005064.1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.708e-139
Identity = 230/300 (76.67%), Postives = 238/300 (79.33%), Query Frame = 1
Query:   70 FPFWKIIGNS*KFHKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEAWMDSEL---------------------------------GRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNETGYRLIHDNASIHGVAISQNNFIEHLPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKC 870
            F F K++G S    KTIIYKYRKF KLSQGKIGG+ SKISEE+GNKLLDFVEKNVYASL EMKNFLISENLSVSTNTISRFL NHLITTKQIRPSVAERNSDRVLD RM+YT RYLEEAWMDS+L                                 GRN+SLALA GVN  VHHKL+VGS KKDTYQIF NEITVKLN TGYRLIHDNASIHG AIS NN IEHLPPY PFLN IESVFSKIKFNIRKSISRAGGFS MNFQSRFDFLKDALDNELVKEDY DLTNYF HIRRFF  C
Sbjct:  149 FYFGKLLGISRNSIKTIIYKYRKFEKLSQGKIGGNKSKISEEHGNKLLDFVEKNVYASLVEMKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDFRMKYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAFGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGYRLIHDNASIHGGAISLNNAIEHLPPYSPFLNLIESVFSKIKFNIRKSISRAGGFSSMNFQSRFDFLKDALDNELVKEDYSDLTNYFGHIRRFFRNC 448          

HSP 2 Score: 68.1662 bits (165), Expect = 1.509e-11
Identity = 32/34 (94.12%), Postives = 34/34 (100.00%), Query Frame = 2
Query:   14 ISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK 115
            ISEIDKIRIINAMENGEDYF+FGKLLGI+RNSIK
Sbjct:  130 ISEIDKIRIINAMENGEDYFYFGKLLGISRNSIK 163          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000069530.1 (SMESG000069530.1)

HSP 1 Score: 401.364 bits (1030), Expect = 1.132e-137
Identity = 203/254 (79.92%), Postives = 208/254 (81.89%), Query Frame = 1
Query:  253 MKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEAWMDSEL---------------------------------GRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNETGYRLIHDNASIHGVAISQNNFIEHLPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGDYLLLLT 915
            MKNFLISENLSVSTNTISRFL NHLITTKQIRPSVAERNSDRVLDLRMEYT RYLEEAWMDS+L                                 GRN+SLALAIGVN  VHHKL+VGS KKDTYQ+F NEITVKLN TG+RLIHDNASIHG AIS NN IEHLPPY PFLNPIESVFSKIKFNIRKSISRAGG S MNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGDYLLLLT
Sbjct:    1 MKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDLRMEYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAIGVNGPVHHKLVVGSYKKDTYQVFINEITVKLNGTGFRLIHDNASIHGGAISLNNVIEHLPPYSPFLNPIESVFSKIKFNIRKSISRAGGLSSMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIRRFFPKCIKKIHIFGDYLLLLT 254          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000005064.1 (SMESG000005064.1)

HSP 1 Score: 399.438 bits (1025), Expect = 7.755e-126
Identity = 212/281 (75.44%), Postives = 221/281 (78.65%), Query Frame = 1
Query:   70 FPFWKIIGNS*KFHKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEAWMDSEL---------------------------------GRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNETGYRLIHDNASIHGVAISQNNFIEHLPPYGPFLNPIESVFSKIKFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKE 813
            F F K++G S    KTIIYKYRKF KLSQGKIGG+ SKISEE+GNKLLDFVEKNVYASL EMKNFLISENLSVSTNTISRFL NHLITTKQIRPSVAERNSDRVLD RM+YT RYLEEAWMDS+L                                 GRN+SLALA GVN  VHHKL+VGS KKDTYQIF NEITVKLN TGYRLIHDNASIHG AIS NN IEHLPPY PFLN IESVFSKIKFNIRKSISRAGGFS MNFQSRFDFLKDALDNEL  +
Sbjct:  132 FYFGKLLGISRNSIKTIIYKYRKFEKLSQGKIGGNKSKISEEHGNKLLDFVEKNVYASLVEMKNFLISENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDFRMKYTTRYLEEAWMDSQLIYIDECGFNTWTSQKLGRNKKGERLYATLPTNRGRNMSLALAFGVNGPVHHKLVVGSYKKDTYQIFINEITVKLNGTGYRLIHDNASIHGGAISLNNAIEHLPPYSPFLNLIESVFSKIKFNIRKSISRAGGFSSMNFQSRFDFLKDALDNELCND 412          

HSP 2 Score: 68.1662 bits (165), Expect = 1.445e-11
Identity = 32/34 (94.12%), Postives = 34/34 (100.00%), Query Frame = 2
Query:   14 ISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK 115
            ISEIDKIRIINAMENGEDYF+FGKLLGI+RNSIK
Sbjct:  113 ISEIDKIRIINAMENGEDYFYFGKLLGISRNSIK 146          
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Match: SMESG000050992.1 (SMESG000050992.1)

HSP 1 Score: 270.396 bits (690), Expect = 1.489e-78
Identity = 147/205 (71.71%), Postives = 154/205 (75.12%), Query Frame = 1
Query:   70 FPFWKIIGNS*KFHKTIIYKYRKFGKLSQGKIGGSISKISEENGNKLLDFVEKNVYASLEEMKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEYTMRYLEEAWMDSEL---------------------------------GRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNEITVKLNETGYR 585
            F F K++G      KT+IYKYRKFGKLSQGKIGGS SKISE+ GNKLLDFVEKNVYASLEEMKNFLI ENLSVSTNTISRFL NHLITTKQIRPSVAERNSDRVLDLRM+YT RYLEEAWMDS+L                                 GRN+SLALAIGVN  VHHKLIVGS KKDTYQIF NEITVKLN TGYR
Sbjct:  984 FHFGKLLGIFRNSIKTLIYKYRKFGKLSQGKIGGSKSKISEDYGNKLLDFVEKNVYASLEEMKNFLIFENLSVSTNTISRFLGNHLITTKQIRPSVAERNSDRVLDLRMKYTTRYLEEAWMDSQLIYIDECGFNIWTSQKLGRNKKGERLYSTLPTNRGRNMSLALAIGVNGSVHHKLIVGSYKKDTYQIFINEITVKLNGTGYR 1188          

HSP 2 Score: 72.0182 bits (175), Expect = 8.744e-13
Identity = 34/35 (97.14%), Postives = 34/35 (97.14%), Query Frame = 2
Query:   11 RISEIDKIRIINAMENGEDYFHFGKLLGIARNSIK 115
            RISEIDKIRIINAMENGEDYFHFGKLLGI RNSIK
Sbjct:  964 RISEIDKIRIINAMENGEDYFHFGKLLGIFRNSIK 998          
The following BLAST results are available for this feature:
BLAST of DDE_3 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4XP449.433e-1926.48DDE_3 domain-containing protein OS=Strongylocentro... [more]
W4Z6F75.942e-1826.48DDE_3 domain-containing protein OS=Strongylocentro... [more]
A0A498ND265.405e-1725.86DDE_3 domain-containing protein OS=Labeo rohita OX... [more]
A0A498NQ155.973e-1725.86DDE_3 domain-containing protein OS=Labeo rohita OX... [more]
A0A267DQJ81.804e-1524.92DDE_3 domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_3 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041908.11.421e-14980.27SMESG000041908.1[more]
SMESG000005064.12.708e-13976.67SMESG000005064.1[more]
SMESG000069530.11.132e-13779.92SMESG000069530.1[more]
SMESG000005064.17.755e-12675.44SMESG000005064.1[more]
SMESG000050992.11.489e-7871.71SMESG000050992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032880 ID=SMED30032880|Name=DDE_3 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1794bp
TTCTTCTTACAGAATTTCGGAAATCGATAAAATACGAATTATCAATGCCA
TGGAAAATGGTGAAGACTATTTCCATTTTGGAAAATTATTGGGAATAGCT
AGAAATTCCATAAAACAATAATTTATAAATACCGGAAATTTGGGAAATTG
TCACAAGGCAAGATTGGTGGCAGTATATCCAAAATTTCGGAAGAAAATGG
CAACAAACTACTTGATTTTGTGGAGAAAAATGTTTATGCTTCATTAGAGG
AAATGAAGAACTTCTTAATTTCCGAAAATTTAAGTGTTTCCACAAACACT
ATTTCCCGTTTTCTTGAAAATCATCTCATAACGACCAAGCAAATAAGACC
ATCGGTCGCTGAAAGAAATTCAGATCGCGTCTTGGATCTCAGAATGGAAT
ACACGATGCGATATTTAGAAGAAGCATGGATGGATTCTGAATTAGGGCGA
AATATATCCTTGGCTCTCGCAATTGGAGTCAATAAACAAGTCCATCATAA
ATTAATAGTAGGATCCAATAAAAAGGATACCTACCAGATCTTCACCAACG
AAATAACTGTAAAATTGAATGAAACTGGATATCGTTTAATCCACGATAAT
GCTTCAATTCATGGTGTTGCAATATCTCAAAATAATTTTATTGAACATTT
ACCACCATATGGTCCTTTTCTGAACCCAATTGAAAGTGTGTTCAGTAAAA
TCAAATTCAATATTCGGAAATCTATATCAAGAGCAGGTGGATTCAGTTTC
ATGAATTTCCAATCCAGATTCGATTTTCTGAAGGACGCACTGGATAACGA
GCTGGTGAAAGAAGACTACAGAGATTTAACTAATTACTTTTGGCATATTA
GGAGATTTTTTCCGAAATGTATAAAAAAAATACATATTTTTGGAGACTAT
TTATTGTTACTTACTTGATTTCCTAAATATTATTTATAGTAATATATGAA
ATAAATGATGATTAAAAGTTATATTTAAGAGCTTGAATTATGATCATATT
TCCTTATGAAATCATAATTCAACTCTTAAAATTTAACTTTAAGTTATATA
ACAATATAAAAAACAACTTACTTAGCAGCCATTTAAAAAATGGCTGAAAT
GAATTCACAAAAAATAAATTCCGCCAAGTTGATTTATGTGTCAACTTGAA
TTATAGCGGAATTTATCTCAGTGACAGCTGGTGTATATATATAATTTATG
GACTGGAATATGTGTAGTTCCTGAAAGTGAGACAGTAATGTACGTTTGTG
ATTGCTAATTTTTGGACGTTTTAATGGAAATTGTAAAAATATCTATAATA
AATCTTTGAAAGTTTATAAAGTAAATTGATCGAAAATTATGAAGCACCTA
ATAATGTCCATATCAGTCATATTTTGTATTCATTTAATAGTTCGAAGTAA
TAAAAGATTTATACAATTAGCTAATGATTAGTGTGATATTCATGTTATCT
GATTTACTGACAATAAAATTTAGTAATGCACATGTTATTTTATCTGTAAC
TTTGACATTTTCAACTGAATTGTGATTTTAATTGTCACATTGCCTTGACT
GTTTTATTGAAGAAATTGTGATGGAATCTCGTTCTTGTTACATAAGGTGC
GAATAATTTCACGTCAGCTAATTATTCATATCTATGCTTTGTTGAACAAA
TCAATATTATAATTATTCACATTTCTTCTAATTCATTAATTTAAAGAAAG
CAAAATTCAATTTACTACAATAATCGAATCCATCAAAGTCATGACTTAGT
ATTTTCAAAATTTAAAACGTCTAAATAATAACTGCGATATTGTA
back to top

protein sequence of SMED30032880-orf-1

>SMED30032880-orf-1 ID=SMED30032880-orf-1|Name=SMED30032880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MKNFLISENLSVSTNTISRFLENHLITTKQIRPSVAERNSDRVLDLRMEY
TMRYLEEAWMDSELGRNISLALAIGVNKQVHHKLIVGSNKKDTYQIFTNE
ITVKLNETGYRLIHDNASIHGVAISQNNFIEHLPPYGPFLNPIESVFSKI
KFNIRKSISRAGGFSFMNFQSRFDFLKDALDNELVKEDYRDLTNYFWHIR
RFFPKCIKKIHIFGDYLLLLT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0004519endonuclease activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis