U2 snRNP auxiliary factor large subunit

Overview
NameU2 snRNP auxiliary factor large subunit
Smed IDSMED30032873
Length (bp)1514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U2 snRNP auxiliary factor large subunit (SMED30032873) t-SNE clustered cells

Violin plots show distribution of expression levels for U2 snRNP auxiliary factor large subunit (SMED30032873) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U2 snRNP auxiliary factor large subunit (SMED30032873) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U2 snRNP auxiliary factor large subunit (SMED30032873) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032873

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30032873SMESG000051274.1 dd_Smed_v4_3590_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 467.233 bits (1201), Expect = 2.666e-161
Identity = 249/393 (63.36%), Postives = 298/393 (75.83%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 470          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 467.233 bits (1201), Expect = 3.120e-161
Identity = 248/395 (62.78%), Postives = 296/395 (74.94%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAG--------GVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      +N    +L   G        G   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 370.163 bits (949), Expect = 1.389e-125
Identity = 201/308 (65.26%), Postives = 242/308 (78.57%), Query Frame = 2
Query:  497 MIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:    1 MMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 306          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: U2AF2 (U2 small nuclear RNA auxiliary factor 2 [Source:HGNC Symbol;Acc:HGNC:23156])

HSP 1 Score: 98.2117 bits (243), Expect = 2.492e-24
Identity = 47/83 (56.63%), Postives = 55/83 (66.27%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITE 490
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE
Sbjct:   10 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITE 86          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 66.6254 bits (161), Expect = 6.074e-12
Identity = 58/194 (29.90%), Postives = 90/194 (46.39%), Query Frame = 2
Query:  449 RRLYVGNIPFGITETAMIELFNSQM----KMKGLMQAEG-DPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            + LYVGN+   +TE  +++LF SQ+      K +M   G DP           + FVEF        ALA ++G    G+++K+    ++   P  S     S   VVST   +    VF+G L   +T + +K     FG +    +VKD ATG SKGY F  + ++   + A   + G  LG ++I    A+
Sbjct:    7 KTLYVGNLSRDVTEALILQLF-SQIGPCKNCKMIMDTAGNDP-----------YCFVEFHEHRHAAAALAAMNGRKIMGKEVKV----NWATTPS-SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWAT 183          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 395.971 bits (1016), Expect = 1.046e-133
Identity = 219/405 (54.07%), Postives = 276/405 (68.15%), Query Frame = 2
Query:  191 RSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
             +RSR   +PQK   P K  Y++WDVPP GF+  +P  YK MQA+GQ+P      G V              S +P  G +V  Q+RRLYVGNIPFG  E AM++ FN QM + GL QA G+P++  QIN+DKNFAF+EFRS+DETT  +A DGINF GQQLK+RRPRDY P     D   M+    VST+V ++ NK+FIG LPNYLT+DQVKELL SFGPL+ F+L  D + G SKGYAF EY+D ++TD A AGLNGMQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:   93 EARSRREPEPQKPREPKK--YRFWDVPPTGFETTTPMEYKNMQAAGQVP-----RGSV-------------QSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD---MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 395.586 bits (1015), Expect = 1.341e-133
Identity = 219/405 (54.07%), Postives = 276/405 (68.15%), Query Frame = 2
Query:  191 RSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
             +RSR   +PQK   P K  Y++WDVPP GF+  +P  YK MQA+GQ+P      G V              S +P  G +V  Q+RRLYVGNIPFG  E AM++ FN QM + GL QA G+P++  QIN+DKNFAF+EFRS+DETT  +A DGINF GQQLK+RRPRDY P     D   M+    VST+V ++ NK+FIG LPNYLT+DQVKELL SFGPL+ F+L  D + G SKGYAF EY+D ++TD A AGLNGMQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:   96 EARSRREPEPQKPREPKK--YRFWDVPPTGFETTTPMEYKNMQAAGQVP-----RGSV-------------QSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD---MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 395.586 bits (1015), Expect = 2.717e-133
Identity = 219/405 (54.07%), Postives = 276/405 (68.15%), Query Frame = 2
Query:  191 RSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
             +RSR   +PQK   P K  Y++WDVPP GF+  +P  YK MQA+GQ+P      G V              S +P  G +V  Q+RRLYVGNIPFG  E AM++ FN QM + GL QA G+P++  QIN+DKNFAF+EFRS+DETT  +A DGINF GQQLK+RRPRDY P     D   M+    VST+V ++ NK+FIG LPNYLT+DQVKELL SFGPL+ F+L  D + G SKGYAF EY+D ++TD A AGLNGMQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:  118 EARSRREPEPQKPREPKK--YRFWDVPPTGFETTTPMEYKNMQAAGQVP-----RGSV-------------QSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD---MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 496          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 130.954 bits (328), Expect = 4.737e-36
Identity = 78/145 (53.79%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  971 MQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            MQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:    1 MQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 130.954 bits (328), Expect = 4.737e-36
Identity = 78/145 (53.79%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  971 MQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            MQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:    1 MQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307178)

HSP 1 Score: 454.136 bits (1167), Expect = 2.840e-157
Identity = 240/399 (60.15%), Postives = 295/399 (73.93%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS----VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K   YWDVPP GF+HI+P  YKAMQASGQIP +V            P+ P    + +P  GS + RQARRLYVGNIPFG+TE  M+E FN QM + GL QA G PV+A QIN+DKNFAF+EFRS+DETTQA+A DGIN +GQ LK+RRP DY P+PG++D P +       GV+ST+V ++P+K+FIG LPNYL DDQVKELLLSFG LR FNLVKD ATGLSKGYAFCEYVD S+TD + AGLNGMQLGDKK+IVQRAS+GAK+          + + +P       +++ +G    T+VLCL+NMV  ++L DEEEYED+++DI  EC KYG V S+EIPRP   + V G GK+FVEF SV+DCQKA  ALTGRKF++RVVVTSY+D DKY+RREF
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV-----------VPDTP---QTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVP----GLSNVVTSG--PPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0074234)

HSP 1 Score: 454.136 bits (1167), Expect = 2.840e-157
Identity = 240/399 (60.15%), Postives = 295/399 (73.93%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS----VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K   YWDVPP GF+HI+P  YKAMQASGQIP +V            P+ P    + +P  GS + RQARRLYVGNIPFG+TE  M+E FN QM + GL QA G PV+A QIN+DKNFAF+EFRS+DETTQA+A DGIN +GQ LK+RRP DY P+PG++D P +       GV+ST+V ++P+K+FIG LPNYL DDQVKELLLSFG LR FNLVKD ATGLSKGYAFCEYVD S+TD + AGLNGMQLGDKK+IVQRAS+GAK+          + + +P       +++ +G    T+VLCL+NMV  ++L DEEEYED+++DI  EC KYG V S+EIPRP   + V G GK+FVEF SV+DCQKA  ALTGRKF++RVVVTSY+D DKY+RREF
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV-----------VPDTP---QTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVP----GLSNVVTSG--PPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307176)

HSP 1 Score: 454.521 bits (1168), Expect = 2.864e-157
Identity = 240/399 (60.15%), Postives = 295/399 (73.93%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS----VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K   YWDVPP GF+HI+P  YKAMQASGQIP +V            P+ P    + +P  GS + RQARRLYVGNIPFG+TE  M+E FN QM + GL QA G PV+A QIN+DKNFAF+EFRS+DETTQA+A DGIN +GQ LK+RRP DY P+PG++D P +       GV+ST+V ++P+K+FIG LPNYL DDQVKELLLSFG LR FNLVKD ATGLSKGYAFCEYVD S+TD + AGLNGMQLGDKK+IVQRAS+GAK+          + + +P       +++ +G    T+VLCL+NMV  ++L DEEEYED+++DI  EC KYG V S+EIPRP   + V G GK+FVEF SV+DCQKA  ALTGRKF++RVVVTSY+D DKY+RREF
Sbjct:   49 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV-----------VPDTP---QTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVP----GLSNVVTSG--PPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 427          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: U2af50 (gene:FBgn0005411 transcript:FBtr0307177)

HSP 1 Score: 424.861 bits (1091), Expect = 1.420e-146
Identity = 228/379 (60.16%), Postives = 280/379 (73.88%), Query Frame = 2
Query:  302 HYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS----VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
             YKAMQASGQIP +V            P+ P    + +P  GS + RQARRLYVGNIPFG+TE  M+E FN QM + GL QA G PV+A QIN+DKNFAF+EFRS+DETTQA+A DGIN +GQ LK+RRP DY P+PG++D P +       GV+ST+V ++P+K+FIG LPNYL DDQVKELLLSFG LR FNLVKD ATGLSKGYAFCEYVD S+TD + AGLNGMQLGDKK+IVQRAS+GAK+          + + +P       +++ +G    T+VLCL+NMV  ++L DEEEYED+++DI  EC KYG V S+EIPRP   + V G GK+FVEF SV+DCQKA  ALTGRKF++RVVVTSY+D DKY+RREF
Sbjct:    2 QYKAMQASGQIPASV-----------VPDTP---QTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVP----GLSNVVTSG--PPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 360          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Match: LS2 (gene:FBgn0034834 transcript:FBtr0072052)

HSP 1 Score: 325.094 bits (832), Expect = 3.163e-106
Identity = 186/401 (46.38%), Postives = 255/401 (63.59%), Query Frame = 2
Query:  260 WDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQM-----KMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLS------------------DNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNA--NFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKY 1387
            WD+PP+G++H++P  YKAM ASGQI   + + G              +H     A S + RQARRLYVGNIPFG+T+  M++ FN Q+     + K     +G+ V+  Q N++KNFAF+EFRS+DE +QAL  DG+ F+GQ LK+RRP DY P+P +S                    P +++P  V+T+V ++PNK+++G LP  L  DQVKELL SFG L+G NLV D  T L+KG+AF EY D SVTD A AGL+GM LGD++++VQR+  G K+   P  +P V       +L   G    T+ LCL+NMV  E+L+D+EE+ED+  DI  EC K+G V S++IPRP       G GK+FV+F SV D QKA+ AL+GRKF+ R+V+TSYYD +KY
Sbjct:   62 WDIPPEGYNHLTPQQYKAMLASGQIASRILSDG--------------VHGGESAAISMITRQARRLYVGNIPFGVTDEEMMQFFNHQIMALGFEAKSSHYMDGNAVLTCQTNLEKNFAFLEFRSIDEASQALNFDGMVFRGQTLKIRRPHDYQPVPSISVSAMESYRSFRVPAINVAQQPAVTLP--VTTIVPDSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLHGMLLGDRRLVVQRSIPGGKNAF-PGHLPTVLQVPGISTLQDPG--SPTETLCLLNMVRPEELLDDEEFEDIRTDIKQECAKFGEVRSIKIPRPIGQFPKRGCGKVFVQFESVEDSQKALKALSGRKFSGRIVMTSYYDPEKY 443          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 461.455 bits (1186), Expect = 3.307e-159
Identity = 248/424 (58.49%), Postives = 308/424 (72.64%), Query Frame = 2
Query:  173 AKQSRHRSRSRERYKPQK--ESLPSKKAYK----YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K+ RHR     +  PQ+     P ++  K    YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQ Q LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +V D A AGLNGMQL DKK++VQRAS+GAK+          + + +P + +N   +I  GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   60 SKERRHRRSDHTQNHPQENVSRSPHREKKKKIKKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQAQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSN--PMIQMGGI-PTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFTSVYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 454.907 bits (1169), Expect = 9.693e-157
Identity = 239/388 (61.60%), Postives = 293/388 (75.52%), Query Frame = 2
Query:  257 YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P    V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +++D A AGLNGMQLGDKK++VQRAS+G+K+  +      P+ +        S+   GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   84 YWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTTLTGINQTPVTLQVPGLMNSSVNQMGGI-PTEVLCLMNMVAPEELLDDEEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 464          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 455.292 bits (1170), Expect = 1.028e-156
Identity = 248/429 (57.81%), Postives = 308/429 (71.79%), Query Frame = 2
Query:  173 AKQSRHRSRSRERYKPQK--ESLPSKKAYK----YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVP-----GVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K+ RHR     +  PQ+     P ++  K    YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQ Q LK+RRP DY PLPG+S+NP + VP     GVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +V D A AGLNGMQL DKK++VQRAS+GAK+          + + +P + +N   +I  GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   60 SKERRHRRSDHTQNHPQENVSRSPHREKKKKIKKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQAQSLKIRRPHDYQPLPGMSENPSVYVPAVQFQGVVSTVVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSN--PMIQMGGI-PTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFTSVYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 479          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 448.743 bits (1153), Expect = 3.046e-154
Identity = 239/393 (60.81%), Postives = 293/393 (74.55%), Query Frame = 2
Query:  257 YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVP-----GVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P    V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VP     GVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +++D A AGLNGMQLGDKK++VQRAS+G+K+  +      P+ +        S+   GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   84 YWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGSLPVGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTTLTGINQTPVTLQVPGLMNSSVNQMGGI-PTEVLCLMNMVAPEELLDDEEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 469          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Match: u2af2b (U2 small nuclear RNA auxiliary factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1881])

HSP 1 Score: 230.72 bits (587), Expect = 2.276e-72
Identity = 130/225 (57.78%), Postives = 168/225 (74.67%), Query Frame = 2
Query:  659 FQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQ 1309
            FQ Q LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +V D A AGLNGMQL DKK++VQRAS+GAK+          + + +P + +N   +I  GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + + G GK+ +  A+ + C+
Sbjct:    3 FQAQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSIHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNVNDQAIAGLNGMQLADKKLLVQRASVGAKNATMTSINETPVTLQVPGLTSN--PMIQMGGI-PTEVLCLMNMVAPEELIDDEEYEEIVEDVKEECSKYGQVKSIEIPRPVDGLDIPGTGKVSLTKAARVGCK 224          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 468.003 bits (1203), Expect = 2.328e-162
Identity = 249/393 (63.36%), Postives = 299/393 (76.08%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D++EYE++V+D+  ECGKYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   34 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDF 418          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 469.159 bits (1206), Expect = 2.457e-162
Identity = 249/393 (63.36%), Postives = 299/393 (76.08%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D++EYE++V+D+  ECGKYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   71 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDF 455          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: mbp (myelin basic protein [Source:Xenbase;Acc:XB-GENE-959616])

HSP 1 Score: 460.685 bits (1184), Expect = 9.705e-159
Identity = 249/400 (62.25%), Postives = 299/400 (74.75%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPG-------VVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPG       VVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D++EYE++V+D+  ECGKYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   77 KKIRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGRNLPQLWVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDDEYEEIVEDVRDECGKYGAVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDGYHRRDF 468          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 70.8626 bits (172), Expect = 1.146e-12
Identity = 57/194 (29.38%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  449 RRLYVGNIPFGITETAMIELFNSQM----KMKGLMQAEG-DPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            R LYVGN+   +TE  ++++F SQ+      K +M   G DP           + FVEF        +LA ++G    G+++K+    ++   P  S     +   VVST+  +    VF+G L   +T D +K     FG +    +VKD  TG SKGY F  + ++   + A A + G  LG ++I    A+
Sbjct:    7 RTLYVGNLSRDVTEPLILQVF-SQLGPCKSCKMIMDTAGNDP-----------YCFVEFFEHRHAAASLAAMNGRKIMGKEVKV----NWATTPS-SQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWAT 183          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 67.3958 bits (163), Expect = 1.851e-11
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  458 YVGNIPFGITETAMIELFNSQM----KMKGLMQAEG-DPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            YVGN+   +TE  ++++F SQ+      K +M   G DP           + FVEF        +LA ++G    G+++K+    ++   P  S     +   VVST+  +    VF+G L   +T D +K     FG +    +VKD  TG SKGY F  + ++   + A A + G  LG ++I    A+
Sbjct:   19 YVGNLSRDVTEPLILQVF-SQLGPCKSCKMIMDTAGNDP-----------YCFVEFFEHRHAAASLAAMNGRKIMGKEVKV----NWATTPS-SQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWAT 192          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 469.159 bits (1206), Expect = 3.366e-162
Identity = 248/395 (62.78%), Postives = 297/395 (75.19%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAG--------GVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +  +   +N    +L   G        G   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 467.233 bits (1201), Expect = 1.830e-161
Identity = 249/393 (63.36%), Postives = 298/393 (75.83%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 470          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 370.163 bits (949), Expect = 9.536e-126
Identity = 201/308 (65.26%), Postives = 242/308 (78.57%), Query Frame = 2
Query:  497 MIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +  V     S +  GG   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:    1 MMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQ-VPGLMSSQVQMGG-HPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 306          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: U2af2 (U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 [Source:MGI Symbol;Acc:MGI:98886])

HSP 1 Score: 98.2117 bits (243), Expect = 2.346e-24
Identity = 47/83 (56.63%), Postives = 55/83 (66.27%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITE 490
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE
Sbjct:   19 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITE 95          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 67.3958 bits (163), Expect = 2.179e-12
Identity = 58/194 (29.90%), Postives = 90/194 (46.39%), Query Frame = 2
Query:  449 RRLYVGNIPFGITETAMIELFNSQM----KMKGLMQAEG-DPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            + LYVGN+   +TE  +++LF SQ+      K +M   G DP           + FVEF        ALA ++G    G+++K+    ++   P  S     S   VVST   +    VF+G L   +T + +K     FG +    +VKD ATG SKGY F  + ++   + A   + G  LG ++I    A+
Sbjct:    7 KTLYVGNLSRDVTEALILQLF-SQIGPCKNCKMIMDTAGNDP-----------YCFVEFHEHRHAAAALAAMNGRKIMGKEVKV----NWATTPS-SQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWAT 183          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P26369|U2AF2_MOUSE (Splicing factor U2AF 65 kDa subunit OS=Mus musculus OX=10090 GN=U2af2 PE=1 SV=3)

HSP 1 Score: 469.159 bits (1206), Expect = 2.354e-161
Identity = 248/395 (62.78%), Postives = 297/395 (75.19%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAG--------GVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +  +   +N    +L   G        G   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSLPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P26368|U2AF2_HUMAN (Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4)

HSP 1 Score: 467.233 bits (1201), Expect = 1.498e-160
Identity = 248/395 (62.78%), Postives = 296/395 (74.94%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAG--------GVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE AM++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +VTD A AGLNGMQLGDKK++VQRAS+GAK+  +      +N    +L   G        G   T+VLCLMNMV  E+L+D+EEYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV DCQKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   86 KKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF 474          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|Q24562|U2AF2_DROME (Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster OX=7227 GN=U2af50 PE=1 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 2.847e-156
Identity = 240/399 (60.15%), Postives = 295/399 (73.93%), Query Frame = 2
Query:  242 KKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS----VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +K   YWDVPP GF+HI+P  YKAMQASGQIP +V            P+ P    + +P  GS + RQARRLYVGNIPFG+TE  M+E FN QM + GL QA G PV+A QIN+DKNFAF+EFRS+DETTQA+A DGIN +GQ LK+RRP DY P+PG++D P +       GV+ST+V ++P+K+FIG LPNYL DDQVKELLLSFG LR FNLVKD ATGLSKGYAFCEYVD S+TD + AGLNGMQLGDKK+IVQRAS+GAK+          + + +P       +++ +G    T+VLCL+NMV  ++L DEEEYED+++DI  EC KYG V S+EIPRP   + V G GK+FVEF SV+DCQKA  ALTGRKF++RVVVTSY+D DKY+RREF
Sbjct:   38 RKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASV-----------VPDTP---QTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSVMLQVP----GLSNVVTSG--PPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF 416          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P90978|U2AF2_CAEEL (Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans OX=6239 GN=uaf-1 PE=2 SV=2)

HSP 1 Score: 395.586 bits (1015), Expect = 3.456e-132
Identity = 219/405 (54.07%), Postives = 276/405 (68.15%), Query Frame = 2
Query:  191 RSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
             +RSR   +PQK   P K  Y++WDVPP GF+  +P  YK MQA+GQ+P      G V              S +P  G +V  Q+RRLYVGNIPFG  E AM++ FN QM + GL QA G+P++  QIN+DKNFAF+EFRS+DETT  +A DGINF GQQLK+RRPRDY P     D   M+    VST+V ++ NK+FIG LPNYLT+DQVKELL SFGPL+ F+L  D + G SKGYAF EY+D ++TD A AGLNGMQLGDK+++VQ A   A        +P   +    +  + G G AT++LCLMNMV E++L  ++EYE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFAS  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:  118 EARSRREPEPQKPREPKK--YRFWDVPPTGFETTTPMEYKNMQAAGQVP-----RGSV-------------QSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD---MNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLAC--ANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 496          
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Match: sp|P90727|U2AF2_CAEBR (Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae OX=6238 GN=uaf-1 PE=3 SV=2)

HSP 1 Score: 387.882 bits (995), Expect = 2.692e-129
Identity = 213/399 (53.38%), Postives = 275/399 (68.92%), Query Frame = 2
Query:  215 KPQKESLPSK-KAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIG-AKHGLIPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +PQ+ + P + K Y++WDVPP GF++I+P  YK MQASG +P      G V              S +P  G +V  Q+RRLYVGNIPFG  E AM++ FN QM +  L QA G+P++  QIN+DKNFAF+EFRS+DETT  +A DGINF GQQLK+RRPRDY P     D   M+    VS++V ++ NK+FIG LPNYLT+DQVKELL SFGPL+ F+L  D + G SKGYAF EY+D ++TD A AGLNGMQLGDK+++VQ A     +H      +P   +    +  + G G AT++LCLMNMV E++L  +E+YE++++D+  EC KYG V SLEIPRP     V GVGK+FVEFA+  DCQ+A AALTGRKF NR VVTSYYD+DKY+ R+F
Sbjct:  114 EPQEPAKPREPKKYRFWDVPPTGFENITPMEYKNMQASGAVP-----RGSV-------------QSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCNLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFD---MNARMPVSSIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVD-SQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQTRHN---THLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELRSDEDYEEILEDVREECSKYGIVRSLEIPRPYDDHPVPGVGKVFVEFATTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 487          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: C4Q2F6 (U2 snRNP auxiliary factor large subunit OS=Schistosoma mansoni OX=6183 GN=Smp_019690 PE=3 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 279/421 (66.27%), Postives = 338/421 (80.29%), Query Frame = 2
Query:  176 KQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKH--GLIP---MMMP-FVNANFESLIAAGGVG------ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            K  RH SR R    P          YKYWDVPP GF+H++PA YKA+QASGQIP+NVYAAGQVPMP +APNAPL L +++PFAGSAVCRQARRLYVGNIPF  TE  M+E FN QM+ +GL+QAEG+P+IAVQIN++KNFAF+EFRSVDETTQ LALDG+ FQ Q LKLRRPRDY PLPG+S+ P + VPGVVST+VQ++P+K+F+G LPNYL +DQVKELLLSFGPL+GFNLVKDG+TGLSKGYAFCEYVD +VTD ACAGLNGMQLGDKK+IVQRAS+GAKH  G++P   + +P   +   ++   +G +        T+VLCLMNM++  +L D+EEYED+V+D+ +EC KYG V SLEIPRP P + V GVGKI+VEFAS+IDCQKA  ALTGRKFN R+VVTS++  D Y+RREF
Sbjct:  108 KSKRHHSRHRSASSP-------TLVYKYWDVPPPGFEHVTPAQYKALQASGQIPVNVYAAGQVPMPVHAPNAPLTLTTNVPFAGSAVCRQARRLYVGNIPFTATEENMMEFFNKQMRAQGLIQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGVLFQNQALKLRRPRDYAPLPGVSEQPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDANVTDHACAGLNGMQLGDKKLIVQRASVGAKHTTGVLPQTLLSLPGLEDGTVQNTTGSGNITIRSGGPPTEVLCLMNMIETSELEDDEEYEDIVEDVRAECSKYGVVRSLEIPRPIPGVEVPGVGKIYVEFASLIDCQKAATALTGRKFNQRLVVTSFFSPDNYHRREF 521          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: C1LH83 (U2 snRNP auxiliary factor large subunit OS=Schistosoma japonicum OX=6182 GN=EWB00_008591 PE=2 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 279/421 (66.27%), Postives = 338/421 (80.29%), Query Frame = 2
Query:  176 KQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKH--GLIP---MMMP-FVNANFESLIAAGGVG------ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            K  RH SR R    P          YKYWDVPP GF+H++PA YKA+QASGQIP+NVYAAGQVPMP +APNAPL L +++PFAGSAVCRQARRLYVGNIPF  TE  M+E FN QM+ +GL+QAEG+P+IAVQIN++KNFAF+EFRSVDETTQ LALDG+ FQ Q LKLRRPRDY PLPG+S+ P + VPGVVST+VQ++P+K+F+G LPNYL +DQVKELLLSFGPL+GFNLVKDG+TGLSKGYAFCEYVD +VTD ACAGLNGMQLGDKK+IVQRAS+GAKH  G++P   + +P   +   ++   +G +        T+VLCLMNM++  +L D+EEYED+V+D+ +EC KYG V SLEIPRP P + V GVGKI+VEFAS+IDCQKA  ALTGRKFN R+VVTS++  D Y+RREF
Sbjct:  105 KSKRHHSRHRSASSP-------TLVYKYWDVPPPGFEHVTPAQYKALQASGQIPVNVYAAGQVPMPVHAPNAPLTLTTNVPFAGSAVCRQARRLYVGNIPFTATEENMMEFFNKQMRAQGLIQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGVLFQNQALKLRRPRDYAPLPGVSEQPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDANVTDHACAGLNGMQLGDKKLIVQRASVGAKHTTGVLPQTLLSLPGLEDGTVQNTTGSGNITIRSGGPPTEVLCLMNMIETSELEDDEEYEDIVEDVRAECSKYGVVRSLEIPRPIPGVEVPGVGKIYVEFASLIDCQKAATALTGRKFNQRLVVTSFFSPDNYHRREF 518          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: C1LE46 (U2 snRNP auxiliary factor large subunit OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 276/425 (64.94%), Postives = 338/425 (79.53%), Query Frame = 2
Query:  179 QSRHRS-----RSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKH--GLIPMMMPFVNANFE----------SLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            +SRHR      +SR      +    S  A+KYWDVPP GF+H++PA YKA+Q SGQ+P+NVYAAGQVPMP +APNAPL L +++PFAGSAVCRQARRLYVGNIPF  TE  M+E FN QM+ +GL+QAEG+P+IAVQIN++KNFAF+EFRSVDETTQ LALDG+ FQ Q LKLRRPRDY PLPG+S+ P + VPGVVST+VQ++P+K+F+G LPNYL +DQVKELLLSFGPL+GFNLVKDG+TGLSKGYAFCEYVD +VTD ACAGLNGMQLGDKK+IVQRAS+GAKH  G++P  +  ++   E          +L    G   T+VLCLMNM++  +L D+EEYED+V+D+ +EC KYG V SLEIPRP   + V GVGKI+VEFAS+IDCQKA  ALTGRKFN R+VVTS++  + Y+RREF
Sbjct:   96 KSRHRDYSGGHKSRRHQSHHRSPSNSVSAHKYWDVPPPGFEHVTPAQYKALQTSGQVPVNVYAAGQVPMPVHAPNAPLTLTTNVPFAGSAVCRQARRLYVGNIPFTATEENMMEFFNKQMRAQGLIQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGVLFQNQALKLRRPRDYAPLPGVSEQPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDSNVTDHACAGLNGMQLGDKKLIVQRASVGAKHTTGVLPQCLLQMSGLEEGAVQNTTGSGNLTVRSGGPPTEVLCLMNMIETSELEDDEEYEDIVEDVRAECSKYGVVRSLEIPRPIRGIDVPGVGKIYVEFASLIDCQKAATALTGRKFNQRLVVTSFFSPNSYHRREF 520          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A095A3E7 (Splicing factor U2AF 65 kDa subunit OS=Schistosoma haematobium OX=6185 GN=MS3_09859 PE=4 SV=1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 272/396 (68.69%), Postives = 331/396 (83.59%), Query Frame = 2
Query:  251 YKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKH--GLIP---MMMP-FVNANFESLIAAGGVG------ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YKYWDVPP GF+H++PA YKA+QASGQIP+NVYAAGQVPMP +APNAPL L +++PFAGSAVCRQARRLYVGNIPF  TE  M+E FN QM+ +GL+QAEG+P+IAVQIN++KNFAF+EFRSVDETTQ LALDG+ FQ Q LKLRRPRDY PLPG+S+ P + VPGVVST+VQ++P+K+F+G LPNYL +DQVKELLLSFGPL+GFNLVKDG+TGLSKGYAFCEYVD +VTD ACAGLNGMQLGDKK+IVQRAS+GAKH  G++P   + +P   +   ++   +G +        T+VLCLMNM++  +L D+EEYED+V+D+ +EC KYG V SLEIPRP P + V GVGKI+VEFAS+IDCQKA  ALTGRKFN R+VVTS++  D Y+RREF
Sbjct:  690 YKYWDVPPPGFEHVTPAQYKALQASGQIPVNVYAAGQVPMPVHAPNAPLTLTTNVPFAGSAVCRQARRLYVGNIPFTATEENMMEFFNKQMRAQGLIQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGVLFQNQALKLRRPRDYAPLPGVSEQPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDANVTDHACAGLNGMQLGDKKLIVQRASVGAKHTTGVLPQTLLSLPGLEDGTVQNTTGSGNITIRSGGPPTEVLCLMNMIETSELEDDEEYEDIVEDVRAECSKYGVVRSLEIPRPIPGVEVPGVGKIYVEFASLIDCQKAATALTGRKFNQRLVVTSFFSPDNYHRREF 1085          
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Match: A0A183NIZ4 (U2 snRNP auxiliary factor large subunit OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS2080 PE=3 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 272/396 (68.69%), Postives = 331/396 (83.59%), Query Frame = 2
Query:  251 YKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKH--GLIP---MMMP-FVNANFESLIAAGGVG------ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YKYWDVPP GF+H++PA YKA+QASGQIP+NVYAAGQVPMP +APNAPL L +++PFAGSAVCRQARRLYVGNIPF  TE  M+E FN QM+ +GL+QAEG+P+IAVQIN++KNFAF+EFRSVDETTQ LALDG+ FQ Q LKLRRPRDY PLPG+S+ P + VPGVVST+VQ++P+K+F+G LPNYL +DQVKELLLSFGPL+GFNLVKDG+TGLSKGYAFCEYVD +VTD ACAGLNGMQLGDKK+IVQRAS+GAKH  G++P   + +P   +   ++   +G +        T+VLCLMNM++  +L D+EEYED+V+D+ +EC KYG V SLEIPRP P + V GVGKI+VEFAS+IDCQKA  ALTGRKFN R+VVTS++  D Y+RREF
Sbjct:  126 YKYWDVPPPGFEHVTPAQYKALQASGQIPVNVYAAGQVPMPVHAPNAPLTLTTNVPFAGSAVCRQARRLYVGNIPFTATEENMMEFFNKQMRAQGLIQAEGNPIIAVQINMEKNFAFLEFRSVDETTQGLALDGVLFQNQALKLRRPRDYAPLPGVSEQPSVIVPGVVSTVVQDSPHKIFVGGLPNYLNEDQVKELLLSFGPLKGFNLVKDGSTGLSKGYAFCEYVDANVTDHACAGLNGMQLGDKKLIVQRASVGAKHTTGVLPQTLLSLPGLEDGTVQNTTGSGNITIRSGGPPTEVLCLMNMIETSELEDDEEYEDIVEDVRAECSKYGVVRSLEIPRPIPGVEVPGVGKIYVEFASLIDCQKAATALTGRKFNQRLVVTSFFSPDNYHRREF 521          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2b (splicing factor U2AF 65 kDa subunit [Source:NCBI gene;Acc:103026862])

HSP 1 Score: 453.751 bits (1166), Expect = 1.703e-156
Identity = 237/388 (61.08%), Postives = 292/388 (75.26%), Query Frame = 2
Query:  257 YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P    V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD ++ D A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +        S+   GG+  T+VLCLMNMV  E+L+D++EYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF ++ D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   75 YWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSVHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGAKNATMTSINETPVTLQVPGLMNTSMNQMGGI-PTEVLCLMNMVAPEELLDDDEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFTTLYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 455          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2b (splicing factor U2AF 65 kDa subunit [Source:NCBI gene;Acc:103026862])

HSP 1 Score: 453.366 bits (1165), Expect = 3.229e-156
Identity = 237/388 (61.08%), Postives = 292/388 (75.26%), Query Frame = 2
Query:  257 YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P    V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD ++ D A AGLNGMQLGDKK++VQRAS+GAK+  +      P+ +        S+   GG+  T+VLCLMNMV  E+L+D++EYE++V+D+  EC KYG V S+EIPRP   + + G GKIFVEF ++ D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   82 YWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSVHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGAKNATMTSINETPVTLQVPGLMNTSMNQMGGI-PTEVLCLMNMVAPEELLDDDEYEEIVEDVRDECSKYGQVKSIEIPRPVDGLDIPGTGKIFVEFTTLYDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 462          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: u2af2a (splicing factor U2AF 65 kDa subunit-like [Source:NCBI gene;Acc:103024792])

HSP 1 Score: 449.514 bits (1155), Expect = 1.498e-154
Identity = 239/396 (60.35%), Postives = 293/396 (73.99%), Query Frame = 2
Query:  257 YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSV------PGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI--------PMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P    V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + V      PGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD +++D A AGLNGMQLGDKK++VQRAS+G+K+  +        P+ +        S+   GG+  T+VLCLMNMV  E+L+D++EYE++V+D+  EC KYG V S+EIPRP   + V G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   81 YWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPEGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGLSVPPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNISDQAIAGLNGMQLGDKKLLVQRASVGSKNTSLVGTGMNQTPVTLQVPGLMNSSMNQMGGI-PTEVLCLMNMVSPEELLDDDEYEEIVEDVREECSKYGQVKSIEIPRPVDGLEVPGTGKIFVEFMSVFDSQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 469          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:103036001])

HSP 1 Score: 68.1662 bits (165), Expect = 6.869e-12
Identity = 46/118 (38.98%), Postives = 75/118 (63.56%), Query Frame = 2
Query: 1040 MMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNR 1393
            ++ PF +  F   I    +  T VL L+N++D+  L +++EYE++++D+  EC KYG+V+SL IP+ NP     G G++FVE+A+  D ++A   LTGR F+ + VV ++Y L  Y R
Sbjct:  311 LINPFFSIPFAPHIEDLVLLPTPVLRLLNVIDDCHLHNDDEYEEIIEDMREECQKYGSVISLLIPKENP-----GKGQVFVEYANAGDSKEAQRLLTGRTFDGKFVVATFYPLSAYKR 423          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:103036001])

HSP 1 Score: 68.1662 bits (165), Expect = 6.991e-12
Identity = 46/118 (38.98%), Postives = 75/118 (63.56%), Query Frame = 2
Query: 1040 MMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNR 1393
            ++ PF +  F   I    +  T VL L+N++D+  L +++EYE++++D+  EC KYG+V+SL IP+ NP     G G++FVE+A+  D ++A   LTGR F+ + VV ++Y L  Y R
Sbjct:  311 LINPFFSIPFAPHIEDLVLLPTPVLRLLNVIDDCHLHNDDEYEEIIEDMREECQKYGSVISLLIPKENP-----GKGQVFVEYANAGDSKEAQRLLTGRTFDGKFVVATFYPLSAYKR 423          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 433.335 bits (1113), Expect = 5.170e-149
Identity = 243/387 (62.79%), Postives = 294/387 (75.97%), Query Frame = 2
Query:  260 WDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMS-VPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHG--LIPMMMPF---VNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            WDVPP GF+HI+P  YKAMQA+GQIP     A            P  +   +P  GS + RQARRLYVGNIPFG+TE AM++ FN+QMK+ GL QA G+PV+AVQIN+DKNFAF+EFRSVDETTQALA DGI FQGQ LKLRRP DY PLPG+S++P +    GVVST+VQ+TP+K+FIG LP+YLTDDQVKELL SFGPL+ FNLVKD AT  SKGYAFCEY D +VTD A AGLNGMQLGDKK+IVQRAS+GAK+    + +  P    V     S +   G+  T+VLCLMNMV  E+LVD+EEYED+++DI  ECGKYG+V S+EIPRP   + + G GKIFVEFAS++DCQ+A  AL+GRKF NRVVVT YY+L+KY+  +F
Sbjct:   77 WDVPPPGFEHITPLQYKAMQAAGQIPATALIATTTTATVAGLPNPAAM--PVPIVGSQLTRQARRLYVGNIPFGVTEEAMMDFFNNQMKLAGLAQAPGNPVLAVQINLDKNFAFLEFRSVDETTQALAFDGIIFQGQSLKLRRPHDYQPLPGMSESPALHVPVGVVSTVVQDTPHKLFIGGLPSYLTDDQVKELLTSFGPLKAFNLVKDSATCFSKGYAFCEYADVNVTDQAIAGLNGMQLGDKKLIVQRASVGAKNANPTVVVQTPVTLQVPGLASSQVQHSGL-PTEVLCLMNMVTPEELVDDEEYEDILEDIREECGKYGSVRSVEIPRPVNGLDIPGCGKIFVEFASLLDCQRAQQALSGRKFANRVVVTQYYNLEKYHCHDF 460          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 65.4698 bits (158), Expect = 1.290e-11
Identity = 74/319 (23.20%), Postives = 125/319 (39.18%), Query Frame = 2
Query:  587 KNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQET--PNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIV---------------------QRASIG-AKHGLIPMMMPFVN--------ANFESLIAAGGVG-------------------ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYN 1390
            K  A++EF  VD  + A+ L G    G  +        V       N   +     +TM + T  P ++++GSL   +T+D +K +   FG +    L+ D  TG S+GY F  + D      A   LNG +L  + + V                     +R  I     G + +M             A  ++L   GG G                   AT+ + L NM   E        +D+ DD+ +EC K+G +V + + + +P       G ++V+ +SV      V AL GR F  +++  ++  +  Y+
Sbjct:  200 KGIAYIEFVEVDSVSLAIGLTGQRLLGVPI-------IVQASQAEKNRAAAAAAAAATMQKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVGHVTERSDGSGASSFLDNDELERTGIDLGSTGRLHLMAKLAEGTGLQIPLAAQQALQMTGGFGLGTTNPVMPVLNNAAPPSIATQCIQLSNMFSPESEQSHTWDQDIRDDVITECMKHGGLVHIFVDKNSPQ------GNVYVKCSSVASAIATVNALHGRWFAGKMITAAFVPVPTYH 505          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010908.1 (pep scaffold:Pmarinus_7.0:GL483688:3845:10066:1 gene:ENSPMAG00000009884.1 transcript:ENSPMAT00000010908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 5.220e-9
Identity = 43/158 (27.22%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  452 RLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQE--TPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAF 916
            R+YVG+I + + E  + + F     +K +     DPV        K FAFVE+   +    A+  ++GI   G+ +K+ RP           N   + P ++  + +E  T N++++ S+   L+DD +K +  +FG +    L +D   G  KGY F
Sbjct:   20 RVYVGSIYYELGEDTIRQAFAPFGPIKSI-DMSFDPVTMKH----KGFAFVEYDLPEAAQLAMEQMNGITLGGRSIKVGRP----------SNIGQAQP-IIDQLAEEAKTHNRIYVASVHPDLSDDDIKSVFEAFGKITMCTLARDPVLGKHKGYGF 161          

HSP 2 Score: 50.8322 bits (120), Expect = 7.141e-8
Identity = 25/77 (32.47%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  782 KVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            +V++GS+   L +D +++    FGP++  ++  D  T   KG+AF EY       +A   +NG+ LG + I V R S
Sbjct:   20 RVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSFDPVTMKHKGFAFVEYDLPEAAQLAMEQMNGITLGGRSIKVGRPS 96          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 50.0618 bits (118), Expect = 3.378e-7
Identity = 29/96 (30.21%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  749 VVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLI 1036
            ++S     T  K+F+G LP + TD  ++    +FG +    ++ D  +G S+GY F    D++  + AC   N + +  +K  V  A IGAK  +I
Sbjct:    2 MLSMQKDTTFTKIFVGGLPYHTTDASLRAFFEAFGEIDEAVVITDRQSGKSRGYGFVTMADRASAERACKDPNPI-IDGRKANVNLAYIGAKPRVI 96          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Match: rbm34 (RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-GENE-040718-77])

HSP 1 Score: 50.0618 bits (118), Expect = 6.216e-7
Identity = 42/205 (20.49%), Postives = 90/205 (43.90%), Query Frame = 2
Query:  440 RQARRLYVGNIPFGITETAMIELFN-----SQMKMKGLMQAEGDPVIAVQI----------NIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRA 1009
            ++ R ++VGN+P  + + A+ + F        ++++ + +A  DP ++++             +KN A+V F+      QAL+ +G   Q                G      + V         +    VFIG+LP  + +D+++      GP+    +V+D  +G+ KG+ +  +       +A   L+G ++  +K+ V+R+
Sbjct:  107 KRKRTVFVGNLPMSLAKEAVKKFFRPCGVIESVRLRCIARA--DPEMSLKQAAIQGKTHPQRNNKN-AYVVFKEEQGAVQALSRNGEEIQS---------------GF----HIRVDAASGEKNHDHKRSVFIGNLPYDVEEDRIRSHFEPCGPVESVRVVRDRESGMGKGFGYILFKGTDAVLLALH-LDGSEMAGRKVRVKRS 288          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 54.6842 bits (130), Expect = 1.071e-8
Identity = 31/81 (38.27%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  752 VSTMVQETP--NKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDK 988
            V+  VQ  P    V++GS+P   T++Q+ +L  + GP+    ++ D  TG SKGYAF E+ D   +  A   LNG QLG +
Sbjct:    7 VNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSR 87          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 51.9878 bits (123), Expect = 1.539e-7
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  551 GDPVIAVQINIDKN-----FAFVEFRSVDETTQAL-ALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETP---NKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRA 1009
            GD +++ +I  D+N     F FV F       +A+ AL+G+   GQ++       YV  P LS   +        + ++ET      +++ ++ +  TD+Q +EL   FGP+   +L KD A G  KG+ F  Y        A   LN  +L  +K+ V RA
Sbjct:  150 GD-ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI-------YVA-PHLSRKER-------DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRA 294          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 48.1358 bits (113), Expect = 2.699e-6
Identity = 46/191 (24.08%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  455 LYVGNIPFGITETAMIELFN-------SQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQ 1003
            +++ N+ F  T   + + F        +Q+K K   + +G         +   F FVEFR+ ++    +A +DG    G +++L+          LS + Q S  G   T   +   K+ + +LP   T   V EL  SFG L+   + K      ++G+AF E++     + A   L+G+ L  +++++Q
Sbjct:  665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT-------LSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLK----------LS-HRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQ 836          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 46.9802 bits (110), Expect = 4.143e-6
Identity = 46/193 (23.83%), Postives = 80/193 (41.45%), Query Frame = 2
Query:  449 RRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKN-----FAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
            R LYVGN+   ITE  + + F             G P+  ++I IDKN     +AFVE+    +    +AL  +N  G+Q++     + V +     + Q S     +         +F+G L   + D+ ++     F      +++ D  TG S+GY F  +  Q     A   + G  L  + + +  A+
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQV-----------GGPIANIKIMIDKNNKNVNYAFVEYHQSHDAN--IALQTLN--GKQIE----NNIVKINWAFQSQQSSSDDTFN---------LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAA 239          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Match: IST3 (Component of the U2 snRNP; required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing; diploid mutants have a specific defect in MATa1 pre-mRNA splicing which leads to haploid gene expression in diploids [Source:SGD;Acc:S000001444])

HSP 1 Score: 43.8986 bits (102), Expect = 9.184e-6
Identity = 24/83 (28.92%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  785 VFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL 1033
            ++IG+L   LT+  +  +   +G      L +D  TG S+G+A+ +Y DQ  T +A   LNG ++G + + +       K  L
Sbjct:   33 IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSL 115          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO48329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT7])

HSP 1 Score: 378.252 bits (970), Expect = 4.850e-129
Identity = 208/331 (62.84%), Postives = 253/331 (76.44%), Query Frame = 2
Query:  434 VCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL-IPMMMPFVNANFE------SLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLV-GGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            + RQARRLYVGNIPFG+TE  MIE FN++MK   L  A G+PVIA QIN ++NFAF+E RSV+ETTQA+A DGI  QGQ LK+RRP+DY P+PG+S+N  + VPGVVST+V ++P+K+FIG LPNYL +DQVKELL SFG LR FNLVKD ATGLSKGYAFCEYVD  +TD+A  GLNGMQLGDKK+IVQRAS+GAK  L  P  M  V A  +      S+   G V AT+VL LMNMV  ++L D+EE+E++ DD+  EC KYG V S+EIPRP   ++   GVGKIFVEF+S+ D +KA AAL GRKF NRVVVTSYY  ++Y+RR F
Sbjct:    1 MTRQARRLYVGNIPFGVTENLMIEFFNAKMKEAKLNTAPGNPVIAAQINTEQNFAFIELRSVEETTQAMAFDGIILQGQALKIRRPKDYQPIPGMSENASVHVPGVVSTVVPDSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGLNGMQLGDKKLIVQRASVGAKQNLNNPQAMNMVPAQLQIPGLDISMAVPGAVAATEVLALMNMVTPDELGDDEEFEEIYDDVREECSKYGRVKSMEIPRPMEGLMEPPGVGKIFVEFSSIDDAKKAAAALGGRKFANRVVVTSYYPPEEYHRRIF 331          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO46306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK4])

HSP 1 Score: 62.003 bits (149), Expect = 3.016e-10
Identity = 54/195 (27.69%), Postives = 91/195 (46.67%), Query Frame = 2
Query:  452 RLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINID------KNFAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPN--KVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRA 1009
            R+YVG+I F + E  +   F+              P+  + ++ D      K FAFVE+   +    AL  ++G+   G+ +K+ RP         S+ PQ +   ++    QE     +++I S+   L +D +K +  +FG +   +L K+  TG  KGY F EY +Q   + A A +N   LG + + V RA
Sbjct:   65 RVYVGSINFELREEHIRTAFHP-----------FGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRP---------SNVPQAA--PLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRA 237          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO38734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC26])

HSP 1 Score: 55.8398 bits (133), Expect = 1.596e-8
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  758 TMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLN 967
            ++ QE+  +VFIG +P    +D++  LL   G +R F L  D ATGL+KG+AFC +  Q+    A   LN
Sbjct:  103 SVFQESGTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTKQTSAYQAITTLN 172          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 51.9878 bits (123), Expect = 3.224e-7
Identity = 57/243 (23.46%), Postives = 97/243 (39.92%), Query Frame = 2
Query:  776 PNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQL-------------GD-----------------------KKIIVQRASIGAKHGL-IPMMMPFVNANFESLIAAGGVG-ATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYN 1390
            P ++++GSL   +T+  VK +   FG +    L+ D  T  SKGY F ++ +      A   +NG +L             GD                       +  ++ + S G   GL +P   P V+   ++L     V   T    L NM D     D     D+ DD+  EC K+G +V + + + +P       G ++V+ A+      A  +L GR F  + ++ +   L  Y+
Sbjct:  214 PTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIGPVTERGDSSAYSFLDDEEYEKGGVELNSSARAALMAKLSQGHSAGLSVPGAPPIVSGVQQALATPVAVSLPTPCFMLTNMFDPTKERDAGWDLDIRDDVLEECNKFGPIVHIHVDKNSPQ------GIVYVKCATPDIAISASKSLHGRWFAGKQIIAAPVPLSNYH 450          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Match: EDO37342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY3])

HSP 1 Score: 51.2174 bits (121), Expect = 8.645e-7
Identity = 44/185 (23.78%), Postives = 81/185 (43.78%), Query Frame = 2
Query:  449 RRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNP-QMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIV 1000
            R++++ N+ F ITE  + + F+   K+  ++      ++       K +A+VEF +      ALA+D    +G      RP    P    + NP     P  +        + +F+ +LP    + +++EL    G ++   LV + A G  KGY + EY  +S    A   L+  ++  + I V
Sbjct:  601 RKVFISNLLFSITEDHLRDKFS---KLGEVLDVR---IVKNMAGRSKGYAYVEFNNESTVQAALAMDREKMEG------RPMFISPCVDKAKNPTTFKFPTSLD------KHTLFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNRA-GKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTISV 766          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2 [Source:NCBI gene;Acc:101165173])

HSP 1 Score: 465.307 bits (1196), Expect = 8.412e-161
Identity = 252/425 (59.29%), Postives = 312/425 (73.41%), Query Frame = 2
Query:  176 KQSRHRSRSRERYKPQKESLPSKKAYK--------YWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            K+ RHR  S   Y PQ E+  S+  ++        YWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD ++ D A AGLNGMQLGDKK++VQRAS+G+K+          + + +P +N+   S+   GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  ECGKYG V S+EIPRP   + V G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   57 KERRHRRNSPPAY-PQ-ENTASRSPHREKKKKIKKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGSKNATLTSINQTPVTLQVPGLNS---SVTQMGGL-PTEVLCLMNMVAPEELLDDEEYEEIVEDVREECGKYGQVKSIEIPRPVDGLEVPGTGKIFVEFTSVFDAQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 469          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2 [Source:NCBI gene;Acc:101165173])

HSP 1 Score: 463.766 bits (1192), Expect = 1.257e-160
Identity = 253/417 (60.67%), Postives = 311/417 (74.58%), Query Frame = 2
Query:  176 KQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGL--------IPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            K+ RHR R+R    P +E    KK  KYWDVPP GF+HI+P  YKAMQA+GQIP          +P   P+   V  + +P  GS + RQARRLYVGNIPFGITE +M++ FN+QM++ GL QA G+PV+AVQIN DKNFAF+EFRSVDETTQA+A DGI FQGQ LK+RRP DY PLPG+S+NP + VPGVVST+V ++ +K+FIG LPNYL DDQVKELL SFGPL+ FNLVKD ATGLSKGYAFCEYVD ++ D A AGLNGMQLGDKK++VQRAS+G+K+          + + +P +N+   S+   GG+  T+VLCLMNMV  E+L+D+EEYE++V+D+  ECGKYG V S+EIPRP   + V G GKIFVEF SV D QKA+  LTGRKF NRVVVT Y D D Y+RR+F
Sbjct:   38 KERRHR-RNRS---PHREK--KKKIKKYWDVPPPGFEHITPMQYKAMQAAGQIPATAL------LPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEESMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDVNLNDQAIAGLNGMQLGDKKLLVQRASVGSKNATLTSINQTPVTLQVPGLNS---SVTQMGGL-PTEVLCLMNMVAPEELLDDEEYEEIVEDVREECGKYGQVKSIEIPRPVDGLEVPGTGKIFVEFTSVFDAQKAMQGLTGRKFANRVVVTKYCDPDAYHRRDF 438          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:101158012])

HSP 1 Score: 70.4774 bits (171), Expect = 1.154e-12
Identity = 50/121 (41.32%), Postives = 76/121 (62.81%), Query Frame = 2
Query: 1040 MMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            ++ PF +  F   I    +  + VL L+N++D+  L +EEEYED+++D+  EC KYG+VVSL IP+ NP     G G++FVE+A+  D ++A   LTGR F+ + VV ++Y L  Y R  F
Sbjct:  323 LLSPFFSIPFAPHIEDLVLLPSPVLRLLNLIDDSHLHNEEEYEDIMEDMKEECQKYGSVVSLLIPKENP-----GKGQVFVEYANSSDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYF 438          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: uhmk1 (U2AF homology motif kinase 1 [Source:NCBI gene;Acc:101158012])

HSP 1 Score: 69.707 bits (169), Expect = 1.864e-12
Identity = 50/121 (41.32%), Postives = 76/121 (62.81%), Query Frame = 2
Query: 1040 MMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            ++ PF +  F   I    +  + VL L+N++D+  L +EEEYED+++D+  EC KYG+VVSL IP+ NP     G G++FVE+A+  D ++A   LTGR F+ + VV ++Y L  Y R  F
Sbjct:  290 LLSPFFSIPFAPHIEDLVLLPSPVLRLLNLIDDSHLHNEEEYEDIMEDMKEECQKYGSVVSLLIPKENP-----GKGQVFVEYANSSDSKEAQRLLTGRTFDGKFVVATFYPLSAYKRGYF 405          
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Match: ENSORLT00000003149.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125])

HSP 1 Score: 62.003 bits (149), Expect = 2.868e-10
Identity = 50/198 (25.25%), Postives = 88/198 (44.44%), Query Frame = 2
Query:  440 RQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKN----FAFVEFRSVDETTQALA-LDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNK--VFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRAS 1012
             Q + LYVGN+   +TE  ++ELF            +  P  + ++ +D      + FVEF      T  +A ++G    G+++K+    ++   P              ++  ++T +   VF+G L   +T D +K     FG +    +VKD ATG SKGY F  + ++   + A   + G  LG ++I    A+
Sbjct:    4 EQPKTLYVGNLSRDVTEALILELF-----------GQIGPCKSCKMIVDTAGHDPYCFVEFYEHRHATATIAAMNGRKILGKEVKV----NWATTP--------------TSQKKDTSSHFHVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWAT 172          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000051274.1 (SMESG000051274.1)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 2
Query:   59 MEYKWDSDSYYYQNGDAIIXXXXXXXXXXXXXXXXXXXAKQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 1402
            MEYKWDSDSYYYQNGDAIISDRHSHHRHRSRSRDRNRHAKQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVGATKVLCLMNMVDEEDLVDEEEYEDVVDDINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF
Sbjct:    1 MEYKWDSDSYYYQNGDAIISDRHSHHRHRSRSRDRNRHAKQSRHRSRSRERYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVGATKVLCLMNMVDEEDLVDEEEYEDVVDDINSECGKYGTVVSLEIPRPNPTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF 448          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000078029.1 (SMESG000078029.1)

HSP 1 Score: 407.142 bits (1045), Expect = 9.679e-138
Identity = 218/392 (55.61%), Postives = 279/392 (71.17%), Query Frame = 2
Query:  230 SLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVGA----TKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPNPTM--LVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKY 1387
            S+  KK YKYWDVPP G++H+SP+ +KAMQA+GQ+   +YA           N   ++    P  GSAV RQARR+YVGNIP G+TE  M++ FN QMK+K   QA+GDP+IAVQIN DKNFAF+EFRSV+ET+Q L LDGI + G  LKLRRPRDYVPLP   D   M    + + +VQ+TP+K+FIG LP+YL +DQVKELLL+FGPL GFNLVKD +TGLSKGYAFCEY D SVTD AC GL GMQLG+K+I+VQRAS+GAK+         + A  + L     +G     T++LCL NM+  E+L D+EEYE++V+D+  EC KYG+V SL+IPRP  +      GVGKI+VEF++  +  KA+ AL GR F+ RVVVTS+YD ++Y
Sbjct:  112 SVELKKDYKYWDVPPTGYEHMSPSEFKAMQAAGQVLPTIYAT-----ESGIVNTEQIMDQH-PSIGSAVSRQARRIYVGNIPLGVTEQGMMDFFNEQMKLKLFTQADGDPIIAVQINTDKNFAFLEFRSVEETSQGLNLDGIMYNGFPLKLRRPRDYVPLPTTMDT--MLPNSLAAGVVQDTPHKLFIGGLPHYLNEDQVKELLLTFGPLSGFNLVKDSSTGLSKGYAFCEYADHSVTDKACLGLTGMQLGEKRIVVQRASLGAKNPTTAATTALLIARQQQLGMDPSMGTCGQETEILCLHNMITPEELTDDEEYEEIVEDVKEECSKYGSVNSLQIPRPTGSEEDSRNGVGKIYVEFSNKSETVKAMKALAGRTFSGRVVVTSFYDPERY 495          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000018652.1 (SMESG000018652.1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.210e-131
Identity = 219/402 (54.48%), Postives = 276/402 (68.66%), Query Frame = 2
Query:  233 LPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVST-----MVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHG----------LIPMMM-PFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPN-PTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKY 1387
            L  KK YKYWDV P G++++S A +K + + GQ+  ++Y         N  N  L   S+ P  G+ V RQARR+YVGN+P G+TE  M+E FN Q+K+K L QA+GDP+IAVQIN DKNFAF+EFRSV+ET Q L LDGI + G  LKLRRPRDYVPLP   D       G+VS      +VQ+TP+K+F+G LP YL +DQVKELL +FGPLRGFNLVKD  TGLSKGYAFCEY D SVTD AC GL GMQLG+K+I+VQRA +GAK+             PMMM P   +N E          T+VLCL NMV  +DL D+EEYE++++D+  EC K+GTV+S++IPRP      V GVGKIFVEF +  +  KA+ AL+GR F+ +VVVTS+YDL+KY
Sbjct:   92 LELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD-------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEE---------TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000018647.1 (SMESG000018647.1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.210e-131
Identity = 219/402 (54.48%), Postives = 276/402 (68.66%), Query Frame = 2
Query:  233 LPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAGQVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIELFNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGINFQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVST-----MVQETPNKVFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHG----------LIPMMM-PFVNANFESLIAAGGVGATKVLCLMNMXXXXXXXXXXXXXXXXXXINSECGKYGTVVSLEIPRPN-PTMLVGGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKY 1387
            L  KK YKYWDV P G++++S A +K + + GQ+  ++Y         N  N  L   S+ P  G+ V RQARR+YVGN+P G+TE  M+E FN Q+K+K L QA+GDP+IAVQIN DKNFAF+EFRSV+ET Q L LDGI + G  LKLRRPRDYVPLP   D       G+VS      +VQ+TP+K+F+G LP YL +DQVKELL +FGPLRGFNLVKD  TGLSKGYAFCEY D SVTD AC GL GMQLG+K+I+VQRA +GAK+             PMMM P   +N E          T+VLCL NMV  +DL D+EEYE++++D+  EC K+GTV+S++IPRP      V GVGKIFVEF +  +  KA+ AL+GR F+ +VVVTS+YDL+KY
Sbjct:   92 LELKKNYKYWDVAPTGYENMSAAEFKQIHSGGQVLPSLYLT-----EGNVVNMGLTA-SEYPSIGNTVSRQARRIYVGNLPLGVTEEGMMEFFNEQIKLKELTQADGDPIIAVQINTDKNFAFLEFRSVEETNQGLNLDGIVYHGFALKLRRPRDYVPLPQAFD-------GIVSNSMTAGIVQDTPHKLFVGGLPQYLGEDQVKELLQTFGPLRGFNLVKDSTTGLSKGYAFCEYADHSVTDKACMGLTGMQLGEKRIVVQRACLGAKNASGIPTGPLMLTQPMMMDPTKISNVEE---------TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKY 471          
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Match: SMESG000000168.1 (SMESG000000168.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.705e-7
Identity = 32/115 (27.83%), Postives = 53/115 (46.09%), Query Frame = 2
Query:  704 PLPGLSDNPQMSVPGVVSTMVQETPNK---VFIGSLPNYLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACAGLNGMQLGDKKIIVQRASIGAKHGLIP 1039
            P+      P+ S P     +  E PN    + I +LP  +T++ + E+   FG +    L+++  +  S GYAF +Y +      A    NGM++ +KKI V+   I   H   P
Sbjct:   60 PIESTPSQPERS-PANTDAVTSENPNPRDCIGIFALPKSVTEENLHEIFKLFGEIVSVKLIRNHKSKNSLGYAFIKYENAECAKRAIESANGMEINNKKIRVEYCIIENGHAKTP 173          
The following BLAST results are available for this feature:
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2AF22.666e-16163.36U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF23.120e-16162.78U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF21.389e-12565.26U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
U2AF22.492e-2456.63U2 small nuclear RNA auxiliary factor 2 [Source:HG... [more]
TIA16.074e-1229.90TIA1 cytotoxic granule associated RNA binding prot... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uaf-11.046e-13354.07Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-11.341e-13354.07Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-12.717e-13354.07Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-14.737e-3653.79Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-14.737e-3653.79Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2af502.840e-15760.15gene:FBgn0005411 transcript:FBtr0307178[more]
U2af502.840e-15760.15gene:FBgn0005411 transcript:FBtr0074234[more]
U2af502.864e-15760.15gene:FBgn0005411 transcript:FBtr0307176[more]
U2af501.420e-14660.16gene:FBgn0005411 transcript:FBtr0307177[more]
LS23.163e-10646.38gene:FBgn0034834 transcript:FBtr0072052[more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2b3.307e-15958.49U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
u2af2a9.693e-15761.60U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
u2af2b1.028e-15657.81U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
u2af2a3.046e-15460.81U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
u2af2b2.276e-7257.78U2 small nuclear RNA auxiliary factor 2b [Source:Z... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbp2.328e-16263.36myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
mbp2.457e-16263.36myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
mbp9.705e-15962.25myelin basic protein [Source:Xenbase;Acc:XB-GENE-9... [more]
tia11.146e-1229.38TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia11.851e-1128.80TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2af23.366e-16262.78U2 small nuclear ribonucleoprotein auxiliary facto... [more]
U2af21.830e-16163.36U2 small nuclear ribonucleoprotein auxiliary facto... [more]
U2af29.536e-12665.26U2 small nuclear ribonucleoprotein auxiliary facto... [more]
U2af22.346e-2456.63U2 small nuclear ribonucleoprotein auxiliary facto... [more]
Tia12.179e-1229.90cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26369|U2AF2_MOUSE2.354e-16162.78Splicing factor U2AF 65 kDa subunit OS=Mus musculu... [more]
sp|P26368|U2AF2_HUMAN1.498e-16062.78Splicing factor U2AF 65 kDa subunit OS=Homo sapien... [more]
sp|Q24562|U2AF2_DROME2.847e-15660.15Splicing factor U2AF 50 kDa subunit OS=Drosophila ... [more]
sp|P90978|U2AF2_CAEEL3.456e-13254.07Splicing factor U2AF 65 kDa subunit OS=Caenorhabdi... [more]
sp|P90727|U2AF2_CAEBR2.692e-12953.38Splicing factor U2AF 65 kDa subunit OS=Caenorhabdi... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C4Q2F60.000e+066.27U2 snRNP auxiliary factor large subunit OS=Schisto... [more]
C1LH830.000e+066.27U2 snRNP auxiliary factor large subunit OS=Schisto... [more]
C1LE460.000e+064.94U2 snRNP auxiliary factor large subunit OS=Schisto... [more]
A0A095A3E70.000e+068.69Splicing factor U2AF 65 kDa subunit OS=Schistosoma... [more]
A0A183NIZ40.000e+068.69U2 snRNP auxiliary factor large subunit OS=Schisto... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2b1.703e-15661.08splicing factor U2AF 65 kDa subunit [Source:NCBI g... [more]
u2af2b3.229e-15661.08splicing factor U2AF 65 kDa subunit [Source:NCBI g... [more]
u2af2a1.498e-15460.35splicing factor U2AF 65 kDa subunit-like [Source:N... [more]
uhmk16.869e-1238.98U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
uhmk16.991e-1238.98U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2a5.170e-14962.79U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
RBM391.290e-1123.20RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
ENSPMAT00000010908.15.220e-927.22pep scaffold:Pmarinus_7.0:GL483688:3845:10066:1 ge... [more]
rbm24a3.378e-730.21RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
rbm346.216e-720.49RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RNA151.071e-838.27Component of the cleavage and polyadenylation fact... [more]
PAB11.539e-729.01Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
MRD12.699e-624.08Essential conserved small ribosomal subunit (40s) ... [more]
PUB14.143e-623.83Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
IST39.184e-628.92Component of the U2 snRNP; required for the first ... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483294.850e-12962.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463063.016e-1027.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387341.596e-840.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339263.224e-723.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373428.645e-723.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2af2a8.412e-16159.29U2 small nuclear RNA auxiliary factor 2 [Source:NC... [more]
u2af2a1.257e-16060.67U2 small nuclear RNA auxiliary factor 2 [Source:NC... [more]
uhmk11.154e-1241.32U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
uhmk11.864e-1241.32U2AF homology motif kinase 1 [Source:NCBI gene;Acc... [more]
ENSORLT00000003149.22.868e-1025.25nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125][more]
back to top
BLAST of U2 snRNP auxiliary factor large subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051274.10.000e+0100.00SMESG000051274.1[more]
SMESG000078029.19.679e-13855.61SMESG000078029.1[more]
SMESG000018652.13.210e-13154.48SMESG000018652.1[more]
SMESG000018647.13.210e-13154.48SMESG000018647.1[more]
SMESG000000168.11.705e-727.83SMESG000000168.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032873 ID=SMED30032873|Name=U2 snRNP auxiliary factor large subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1514bp
CAATTACAAGTTCGATATGAGAGTTATTTGGTTATTTATATTAAAATTTA
GTGGTTGAATGGAATATAAGTGGGACTCGGATAGTTACTATTATCAAAAT
GGAGATGCAATTATCAGTGACAGACACAGCCATCACAGACATCGATCAAG
AAGTCGTGATAGAAATCGACACGCTAAACAATCAAGGCATCGATCGAGGA
GTCGAGAAAGGTATAAACCACAAAAAGAAAGTTTACCTTCAAAGAAAGCT
TACAAATACTGGGATGTTCCACCTCAAGGTTTTGATCACATAAGTCCAGC
TCATTACAAAGCAATGCAAGCATCTGGTCAAATTCCAATTAATGTATACG
CTGCTGGGCAAGTGCCAATGCCAGACAATGCTCCGAACGCACCATTAGTA
TTACATAGTGATATTCCGTTCGCTGGAAGTGCTGTTTGTCGTCAAGCTAG
GAGGTTATACGTTGGAAATATTCCATTTGGTATTACAGAAACAGCTATGA
TAGAATTATTTAATTCTCAAATGAAAATGAAAGGTCTTATGCAGGCAGAA
GGAGATCCGGTGATTGCAGTTCAAATCAATATCGACAAAAATTTTGCATT
TGTTGAGTTCCGGTCGGTCGATGAAACGACGCAAGCGCTGGCATTGGATG
GAATAAATTTCCAAGGCCAACAGTTGAAGTTGCGACGTCCTCGAGATTAT
GTTCCATTGCCGGGTTTGAGTGACAATCCGCAGATGTCAGTTCCAGGAGT
CGTTTCGACAATGGTCCAGGAAACTCCGAATAAAGTTTTCATTGGATCGT
TGCCCAATTACCTAACCGATGATCAAGTAAAAGAGTTGCTGTTGAGTTTC
GGACCTTTGCGGGGTTTCAATCTCGTGAAGGATGGCGCGACCGGTCTGTC
GAAGGGTTACGCATTTTGTGAGTATGTCGACCAATCAGTGACCGATATCG
CTTGTGCCGGTCTAAACGGGATGCAATTGGGCGACAAAAAGATCATCGTA
CAGCGGGCAAGCATCGGAGCGAAACACGGGTTAATCCCGATGATGATGCC
GTTTGTGAATGCGAATTTTGAGAGTCTAATTGCAGCAGGCGGTGTCGGCG
CGACAAAGGTGCTGTGTCTGATGAATATGGTCGATGAGGAGGACCTGGTG
GACGAGGAGGAATACGAGGACGTCGTGGACGACATCAATTCCGAATGCGG
TAAGTATGGGACTGTAGTTTCACTGGAGATTCCTCGCCCGAATCCGACAA
TGCTGGTGGGAGGAGTCGGCAAAATATTCGTGGAATTTGCATCTGTTATC
GATTGCCAGAAAGCAGTAGCGGCACTGACTGGCAGGAAGTTCAATAATCG
AGTTGTTGTCACATCGTATTATGATTTGGATAAGTATAACCGCCGGGAGT
TCTAGGGCGGGATTAAGGGATGACCGCGGGAGAGGGGGAGTTGTGTACAT
ATTTATATCGATCAGTCGTCACCATCATCATTATTATCCCCAGCAGCAGC
AGCAGCAGTCATTG
back to top

protein sequence of SMED30032873-orf-1

>SMED30032873-orf-1 ID=SMED30032873-orf-1|Name=SMED30032873-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MEYKWDSDSYYYQNGDAIISDRHSHHRHRSRSRDRNRHAKQSRHRSRSRE
RYKPQKESLPSKKAYKYWDVPPQGFDHISPAHYKAMQASGQIPINVYAAG
QVPMPDNAPNAPLVLHSDIPFAGSAVCRQARRLYVGNIPFGITETAMIEL
FNSQMKMKGLMQAEGDPVIAVQINIDKNFAFVEFRSVDETTQALALDGIN
FQGQQLKLRRPRDYVPLPGLSDNPQMSVPGVVSTMVQETPNKVFIGSLPN
YLTDDQVKELLLSFGPLRGFNLVKDGATGLSKGYAFCEYVDQSVTDIACA
GLNGMQLGDKKIIVQRASIGAKHGLIPMMMPFVNANFESLIAAGGVGATK
VLCLMNMVDEEDLVDEEEYEDVVDDINSECGKYGTVVSLEIPRPNPTMLV
GGVGKIFVEFASVIDCQKAVAALTGRKFNNRVVVTSYYDLDKYNRREF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008380RNA splicing
GO:0046660female sex differentiation
GO:0006397mRNA processing
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR006529U2AF_lg
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR003954RRM_dom_euk
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003954RNA recognition motif domain, eukaryoteSMARTSM00361rrm2_1coord: 351..436
e-value: 3.3E-4
score: 30.0
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 132..209
e-value: 6.0E-12
score: 55.7
coord: 351..436
e-value: 0.034
score: 19.7
coord: 242..315
e-value: 1.0E-17
score: 74.8
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 243..312
e-value: 4.0E-15
score: 55.4
coord: 133..207
e-value: 3.9E-7
score: 29.8
coord: 374..433
e-value: 2.2E-5
score: 24.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 131..213
score: 14.334
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 350..440
score: 9.183
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 241..319
score: 14.709
IPR006529U2 snRNP auxilliary factor, large subunit, splicing factorTIGRFAMTIGR01642TIGR01642coord: 19..448
e-value: 3.2E-140
score: 466.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 347..448
e-value: 2.3E-31
score: 109.8
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 131..314
e-value: 9.3E-60
score: 203.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 217..292
e-value: 9.3E-60
score: 203.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..60
NoneNo IPR availablePANTHERPTHR23139RNA-BINDING PROTEINcoord: 18..447
NoneNo IPR availablePANTHERPTHR23139:SF9SPLICING FACTOR U2AF 65 KDA SUBUNITcoord: 18..447
NoneNo IPR availableCDDcd12232RRM3_U2AF65coord: 349..436
e-value: 6.6406E-32
score: 114.961
NoneNo IPR availableCDDcd12230RRM1_U2AF65coord: 130..211
e-value: 1.65789E-44
score: 148.073
NoneNo IPR availableCDDcd12231RRM2_U2AF65coord: 241..317
e-value: 4.07702E-48
score: 157.392
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 131..213
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 240..441