Impact RWD domain protein

Overview
NameImpact RWD domain protein
Smed IDSMED30032871
Length (bp)2642
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Impact RWD domain protein (SMED30032871) t-SNE clustered cells

Violin plots show distribution of expression levels for Impact RWD domain protein (SMED30032871) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Impact RWD domain protein (SMED30032871) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Impact RWD domain protein (SMED30032871) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032871

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30032871h1SMcG0001235 dd_Smed_v4_8658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30032871h1SMcG0001235 dd_Smed_v4_8658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Impact RWD domain protein vs. Ensembl Human
Match: IMPACT (impact RWD domain protein [Source:HGNC Symbol;Acc:HGNC:20387])

HSP 1 Score: 171.4 bits (433), Expect = 1.053e-46
Identity = 104/284 (36.62%), Postives = 160/284 (56.34%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPK-------------VIDNKTEIA-----------------DNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAIT 952
            Q EEIE + +IY +E  VI++  +IF I++  D+D   +++ ++   PNEYP + PP  +L  PW++G E+  + NS++++ + N+G  ++Y  VE IRD L  +QK+        V K             ++  + E +                 + L  + HG P  DR+STFQAH+A V    +V++V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL+++ ++ V+N+ VV+SRW+GGI LG DRFKHINN A++ + 
Sbjct:   12 QNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVL--IQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQ---TFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILV 290          
BLAST of Impact RWD domain protein vs. Ensembl Human
Match: IMPACT (impact RWD domain protein [Source:HGNC Symbol;Acc:HGNC:20387])

HSP 1 Score: 171.785 bits (434), Expect = 1.064e-46
Identity = 104/284 (36.62%), Postives = 160/284 (56.34%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPK-------------VIDNKTEIA-----------------DNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAIT 952
            Q EEIE + +IY +E  VI++  +IF I++  D+D   +++ ++   PNEYP + PP  +L  PW++G E+  + NS++++ + N+G  ++Y  VE IRD L  +QK+        V K             ++  + E +                 + L  + HG P  DR+STFQAH+A V    +V++V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL+++ ++ V+N+ VV+SRW+GGI LG DRFKHINN A++ + 
Sbjct:   12 QNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVL--IQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQ---TFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILV 290          
BLAST of Impact RWD domain protein vs. Ensembl Human
Match: IMPACT (impact RWD domain protein [Source:HGNC Symbol;Acc:HGNC:20387])

HSP 1 Score: 76.6406 bits (187), Expect = 2.782e-15
Identity = 54/177 (30.51%), Postives = 91/177 (51.41%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPK-----------------------------VIDNKTEIADNLFEVFHGEPFVDRKSTFQ 634
            Q EEIE + +IY +E  VI++  +IF I++  D+D   +++ ++   PNEYP + PP  +L  PW++G E+  + NS++++ + N+G  ++Y  VE IRD L  +QK+        V K                             + + +TE+ + L  + HG P  DR+STFQ
Sbjct:   12 QNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVL--IQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEV-EELPPIDHGIPITDRRSTFQ 185          
BLAST of Impact RWD domain protein vs. Ensembl Human
Match: IMPACT (impact RWD domain protein [Source:HGNC Symbol;Acc:HGNC:20387])

HSP 1 Score: 71.633 bits (174), Expect = 1.065e-13
Identity = 52/177 (29.38%), Postives = 90/177 (50.85%), Query Frame = 2
Query:  227 LHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPK-------------VIDNKTEIA-----------------DNLFEVFHGEPFVDRKSTFQAHVARV 652
            + +IY +E  VI++  +IF I++  D+D   +++ ++   PNEYP + PP  +L  PW++G E+  + NS++++ + N+G  ++Y  VE IRD L  +QK+        V K             ++  + E +                 + L  + HG P  DR+STFQAH+A V
Sbjct:    1 MAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVL--IQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPV 175          
BLAST of Impact RWD domain protein vs. Ensembl Human
Match: IMPACT (impact RWD domain protein [Source:HGNC Symbol;Acc:HGNC:20387])

HSP 1 Score: 67.781 bits (164), Expect = 3.686e-13
Identity = 28/51 (54.90%), Postives = 40/51 (78.43%), Query Frame = 2
Query:  797 DGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            DGE  A  RLL+++ ++ V+N+ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:    1 DGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNIL 51          
BLAST of Impact RWD domain protein vs. Ensembl Celegans
Match: impt-1 (pep chromosome:WBcel235:I:10966394:10970166:-1 gene:WBGene00013122.1 transcript:Y52B11A.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:impt-1)

HSP 1 Score: 162.54 bits (410), Expect = 7.842e-45
Identity = 93/250 (37.20%), Postives = 142/250 (56.80%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPD-SPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAIT 952
            +I EIE+L SI+   L    ++  +F+    FD D  +   + P +YP  SPP  EL  P++R  +K  + NS+  V ++N+G P+++  +  ++D +  L +   +        V     EI D    + HGE   DRKS FQAH+A V+++++V+ V R L +N KI  ATHNI+AYR    E NG       C DDGE  AS ++L ++  M  +N+ VV+SRW+GGI LG DRF+HINN  +  ++
Sbjct:    7 RIAEIESLASIFPDLLEETTDKQLVFK----FDRDIGMT-INLPEDYPSISPPIFELSGPYLRREQKEVLHNSLNDVYIENIGFPVIFNWISLVQDFIRDLPEEVAEPSHVADDVVTPMAEEIDD--MNIRHGEVLTDRKSAFQAHLAEVRSKEDVDRVMRILKSNTKICRATHNITAYRYMT-EINGKPIHHHDCVDDGEFGASSKMLELMDRMKADNVMVVVSRWYGGIHLGPDRFRHINNLTRQILS 248          
BLAST of Impact RWD domain protein vs. Ensembl Celegans
Match: impt-1 (pep chromosome:WBcel235:I:10968183:10970166:-1 gene:WBGene00013122.1 transcript:Y52B11A.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:impt-1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.749e-8
Identity = 30/96 (31.25%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPD-SPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRD 490
            +I EIE+L SI+   L    ++  +F  K + D+  +I   + P +YP  SPP  EL  P++R  +K  + NS+  V ++N+G P+++  +  ++D
Sbjct:    7 RIAEIESLASIFPDLLEETTDKQLVF--KFDRDIGMTI---NLPEDYPSISPPIFELSGPYLRREQKEVLHNSLNDVYIENIGFPVIFNWISLVQD 97          
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 176.022 bits (445), Expect = 1.433e-48
Identity = 108/292 (36.99%), Postives = 163/292 (55.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELA-KLQKANRKSYSATV--------------PKV-IDNKTEIADNLFE----------VFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L  K Q ++      TV              P + +   +  ++ +F           + HGE   DR+STFQ H++ V+N  +V+ V  +L  N KIA ATHNI AYRI   E N    + Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A+  +   G+
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNS---VLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGY 294          
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 176.022 bits (445), Expect = 1.433e-48
Identity = 108/292 (36.99%), Postives = 163/292 (55.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELA-KLQKANRKSYSATV--------------PKV-IDNKTEIADNLFE----------VFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L  K Q ++      TV              P + +   +  ++ +F           + HGE   DR+STFQ H++ V+N  +V+ V  +L  N KIA ATHNI AYRI   E N    + Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A+  +   G+
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNS---VLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGY 294          
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 67.3958 bits (163), Expect = 5.039e-13
Identity = 39/112 (34.82%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK 502
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L +
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTE 117          
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 67.3958 bits (163), Expect = 5.039e-13
Identity = 39/112 (34.82%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK 502
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L +
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTE 117          
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 67.3958 bits (163), Expect = 5.039e-13
Identity = 39/112 (34.82%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK 502
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L +
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTE 117          
BLAST of Impact RWD domain protein vs. Ensembl Xenopus
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:496763])

HSP 1 Score: 175.637 bits (444), Expect = 2.786e-48
Identity = 110/281 (39.15%), Postives = 158/281 (56.23%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEI-------KLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRD-ELAKLQKANRKSY--SATVPKVIDNKTEI-ADNLFEVF---------------------HGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
             I+E+E L SIY  E  VI+E +RIF I       K  + L   +I    P EYP  SPP  +L  PW+RG ++  + N+++++ L NLG  ++YQ VE IR+  L K Q ++      S +    +D+  EI A+ L E F                     HGE   DR+STFQAH+A V +  +V+++  +L  N KIA ATHNI AYRI   E N      Q C+DDGE  A +R+L+++ ++   ++ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:    8 HIDEVEALTSIYGDEWCVIDEAERIFCITVSDSSNKPTWTLCLQVI---LPAEYPASSPPLYQLNAPWLRGEDRLTLANNLEEIYLQNLGENILYQWVEKIREFLLGKSQTSDPGPCLKSTSEETDVDDDCEIPAEELNESFKNSMLFGLNDSSGVEEIPPIIHGETITDRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKERNS---FIQDCEDDGETAAGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNIL 282          
BLAST of Impact RWD domain protein vs. Ensembl Xenopus
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:496763])

HSP 1 Score: 174.866 bits (442), Expect = 9.413e-48
Identity = 110/281 (39.15%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEI-------KLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRD-ELAKLQKANRKSY--SATVPKVIDNKTEI-ADNLFEVF---------------------HGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            +I+E+E L SIY  E  VI+E +RIF I       K  + L   +I    P EYP  SPP  +L  PW+RG ++  + N+++++ L NLG  ++YQ VE IR+  L K Q ++      S +    +D+  EI A+ L E F                     HGE   DR+STFQAH+A V +  +V+++  +L  N KIA ATHNI AYRI   E N      Q C+DDGE  A +R+L+++ ++   ++ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:   58 EIDEVEALTSIYGDEWCVIDEAERIFCITVSDSSNKPTWTLCLQVI---LPAEYPASSPPLYQLNAPWLRGEDRLTLANNLEEIYLQNLGENILYQWVEKIREFLLGKSQTSDPGPCLKSTSEETDVDDDCEIPAEELNESFKNSMLFGLNDSSGVEEIPPIIHGETITDRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKERNS---FIQDCEDDGETAAGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNIL 332          
BLAST of Impact RWD domain protein vs. Ensembl Xenopus
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:496763])

HSP 1 Score: 175.252 bits (443), Expect = 1.250e-47
Identity = 110/281 (39.15%), Postives = 159/281 (56.58%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEI-------KLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRD-ELAKLQKANRKSY--SATVPKVIDNKTEI-ADNLFEVF---------------------HGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            +I+E+E L SIY  E  VI+E +RIF I       K  + L   +I    P EYP  SPP  +L  PW+RG ++  + N+++++ L NLG  ++YQ VE IR+  L K Q ++      S +    +D+  EI A+ L E F                     HGE   DR+STFQAH+A V +  +V+++  +L  N KIA ATHNI AYRI   E N      Q C+DDGE  A +R+L+++ ++   ++ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:   58 EIDEVEALTSIYGDEWCVIDEAERIFCITVSDSSNKPTWTLCLQVI---LPAEYPASSPPLYQLNAPWLRGEDRLTLANNLEEIYLQNLGENILYQWVEKIREFLLGKSQTSDPGPCLKSTSEETDVDDDCEIPAEELNESFKNSMLFGLNDSSGVEEIPPIIHGETITDRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKERNS---FIQDCEDDGETAAGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNIL 332          
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Match: Impact (impact, RWD domain protein [Source:MGI Symbol;Acc:MGI:1098233])

HSP 1 Score: 175.252 bits (443), Expect = 2.911e-48
Identity = 103/280 (36.79%), Postives = 156/280 (55.71%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK---------------------------LQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            Q EEIE + +IY +E  VI+E  +IF I++   +D   +++ ++   P+EYP + PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L +                           L+            K+ +      + L  V HG P  DR+STFQAHVA V   ++V++V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL+++ ++ V+N+ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:   12 QSEEIEAMAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDALIQKSQITEPDPDVKKKTEEVEVESEEDPILEHPPENPVKTLDLKISEETQPETEELPPVAHGVPITDRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCED---KQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNIL 288          
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Match: Impact (impact, RWD domain protein [Source:MGI Symbol;Acc:MGI:1098233])

HSP 1 Score: 98.9821 bits (245), Expect = 5.344e-23
Identity = 65/203 (32.02%), Postives = 104/203 (51.23%), Query Frame = 2
Query:  227 LHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK---------------------------LQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAY 739
            + +IY +E  VI+E  +IF I++   +D   +++ ++   P+EYP  +PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L +                           L+            K+ +      + L  V HG P  DR+STFQAHVA V   ++V++V  +L  N KIA ATHNI AY
Sbjct:    1 MAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDALIQKSQITEPDPDVKKKTEEVEVESEEDPILEHPPENPVKTLDLKISEETQPETEELPPVAHGVPITDRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAY 203          
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Match: Impact (impact, RWD domain protein [Source:MGI Symbol;Acc:MGI:1098233])

HSP 1 Score: 74.7146 bits (182), Expect = 6.298e-15
Identity = 51/174 (29.31%), Postives = 85/174 (48.85%), Query Frame = 2
Query:  227 LHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK---------------------------LQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARV 652
            + +IY +E  VI+E  +IF I++   +D   +++ ++   P+EYP + PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L +                           L+            K+ +      + L  V HG P  DR+STFQAHVA V
Sbjct:    1 MAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDALIQKSQITEPDPDVKKKTEEVEVESEEDPILEHPPENPVKTLDLKISEETQPETEELPPVAHGVPITDRRSTFQAHVAPV 174          
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Match: Impact (impact, RWD domain protein [Source:MGI Symbol;Acc:MGI:1098233])

HSP 1 Score: 62.3882 bits (150), Expect = 1.948e-11
Identity = 35/101 (34.65%), Postives = 62/101 (61.39%), Query Frame = 2
Query:  227 LHSIYDKELSVINEEDRIFEIKLEFDLDYS----IIRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKA 514
            + +IY +E  VI+E  +IF I++   +D       ++   P+EYP + PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L  +QK+
Sbjct:    1 MAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDAL--IQKS 99          
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Match: Impact (impact, RWD domain protein [Source:MGI Symbol;Acc:MGI:1098233])

HSP 1 Score: 60.8474 bits (146), Expect = 1.406e-10
Identity = 35/102 (34.31%), Postives = 65/102 (63.73%), Query Frame = 2
Query:  227 LHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKAN 517
            + +IY +E  VI+E  +IF I++   +D   +++ ++   P+EYP + PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L  +QK+ 
Sbjct:    1 MAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDAL--IQKSQ 100          
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Match: sp|Q5M8G6|IMPTA_XENTR (Protein IMPACT-A OS=Xenopus tropicalis OX=8364 GN=impact-A PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.085e-48
Identity = 112/290 (38.62%), Postives = 163/290 (56.21%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEI-------KLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRD-ELAKLQKANRKSY--SATVPKVIDNKTEI-ADNLFEVF---------------------HGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            D ++  +  QI+E+E L SIY  E  VI+E +RIF I       K  + L   +I    P EYP  SPP  +L  PW+RG ++  + N+++++ L NLG  ++YQ VE IR+  L K Q ++      S +    +D+  EI A+ L E F                     HGE   DR+STFQAH+A V +  +V+++  +L  N KIA ATHNI AYRI   E N      Q C+DDGE  A +R+L+++ ++   ++ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:    3 DTEEENLQSQIDEVEALTSIYGDEWCVIDEAERIFCITVSDSSNKPTWTLCLQVI---LPAEYPASSPPLYQLNAPWLRGEDRLTLANNLEEIYLQNLGENILYQWVEKIREFLLGKSQTSDPGPCLKSTSEETDVDDDCEIPAEELNESFKNSMLFGLNDSSGVEEIPPIIHGETITDRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKERNS---FIQDCEDDGETAAGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNIL 286          
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Match: sp|A7YY45|IMPCT_BOVIN (Protein IMPACT OS=Bos taurus OX=9913 GN=IMPACT PE=2 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 6.681e-48
Identity = 106/282 (37.59%), Postives = 161/282 (57.09%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPK-----------------------------VIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            Q EEIE + +IY +E  VI++  +IF I++  D+D   +++ ++   PNEYP + PP  +L  PW++G E+  + NS++++ + N+G  ++Y  VE IRD L  +QK+        V K                             V +N+TEI + L  + HG P  DR+STFQAH+A V    +V++V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL+++ ++ V ++ VV+SRW+GG+ LG DRFKHINN A++ +
Sbjct:   12 QNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVL--IQKSQMTEPGPDVKKKTEEEDVECEDDLVLACQPENQVKTLDFDVSENRTEI-EELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLAKLYENKKIASATHNIYAYRIYCEDKQ---TFLQDCEDDGETAAGGRLLHLMEILNVRDVMVVVSRWYGGVLLGPDRFKHINNCARNIL 287          
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Match: sp|A9UMG5|IMPTB_XENTR (Protein IMPACT-B OS=Xenopus tropicalis OX=8364 GN=impact-B PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.082e-47
Identity = 108/292 (36.99%), Postives = 163/292 (55.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELA-KLQKANRKSYSATV--------------PKV-IDNKTEIADNLFE----------VFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L  K Q ++      TV              P + +   +  ++ +F           + HGE   DR+STFQ H++ V+N  +V+ V  +L  N KIA ATHNI AYRI   E N    + Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A+  +   G+
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNS---VLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGY 294          
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Match: sp|Q642J4|IMPCT_DANRE (Protein IMPACT OS=Danio rerio OX=7955 GN=impact PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.082e-47
Identity = 108/292 (36.99%), Postives = 163/292 (55.82%), Query Frame = 2
Query:  179 DFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELA-KLQKANRKSYSATV--------------PKV-IDNKTEIADNLFE----------VFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            D D N +  QIEEIE L SIY +E  VI+E  R+F I++       +++ ++   P +YP S PP  ++   W+RG ++  + NS++++ ++N G  ++Y  VE IR+ L  K Q ++      TV              P + +   +  ++ +F           + HGE   DR+STFQ H++ V+N  +V+ V  +L  N KIA ATHNI AYRI   E N    + Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A+  +   G+
Sbjct:    6 DHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNS---VLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGY 294          
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Match: sp|O55091|IMPCT_MOUSE (Protein IMPACT OS=Mus musculus OX=10090 GN=Impact PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 2.036e-47
Identity = 103/280 (36.79%), Postives = 156/280 (55.71%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD---YSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK---------------------------LQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAI 949
            Q EEIE + +IY +E  VI+E  +IF I++   +D   +++ ++   P+EYP + PP  +L  PW++G E+  + NS++++ + N+G  ++YQ VE IRD L +                           L+            K+ +      + L  V HG P  DR+STFQAHVA V   ++V++V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL+++ ++ V+N+ VV+SRW+GGI LG DRFKHINN A++ +
Sbjct:   12 QSEEIEAMAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDALIQKSQITEPDPDVKKKTEEVEVESEEDPILEHPPENPVKTLDLKISEETQPETEELPPVAHGVPITDRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCED---KQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNIL 288          
BLAST of Impact RWD domain protein vs. TrEMBL
Match: Q09GQ0 (RWD domain-containing protein OS=Bombyx mori OX=7091 GN=767623 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.108e-52
Identity = 105/260 (40.38%), Postives = 155/260 (59.62%), Query Frame = 2
Query:  197 ISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVID-NKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQ 970
            +S Q+EEIE L SIY +EL++ +E  R + I++E +    ++  + P +YP S PP  EL  PW+    K  +  ++ ++ LDN+G  +++Q VE IR+ L  + K  +K    T PKV   + T I  N  E+ HGE   DRKS FQ H A V + D+V+ V  +L  N KI  ATHN+ AYRI +    G   + Q CDDDGE  A  R+L++L ++  +N  VV+SRW+GG++LG DRF+HINN ++  I   G  +
Sbjct:    6 LSRQVEEIEALKSIYTEELTIDSEITRSYTIRIEENKKEVLLYVTLPEDYPSSSPPKFELSAPWMDRQTKTNLHKTLHEIYLDNVGETVIFQWVEMIREVLQTVCKVEKK-IEVTEPKVDSLDLTTIEINCPEITHGEIIADRKSIFQGHAAEVHSIDDVKAVLNKLKQNRKILNATHNMYAYRIERKTAKGTN-VLQDCDDDGEAHAGGRMLHLLQVLNQKNTLVVVSRWYGGVQLGPDRFRHINNASRQVIQQAGLLK 263          
BLAST of Impact RWD domain protein vs. TrEMBL
Match: A0A194PWI8 (Protein IMPACT-B OS=Papilio xuthus OX=66420 GN=RR46_02411 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.154e-52
Identity = 107/266 (40.23%), Postives = 164/266 (61.65%), Query Frame = 2
Query:  182 FDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQ-KANRK-SYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQ 970
             D + ++ QIEE+E L SIY ++ +  +E  R + IK++ +    I+  + P+EYP  +PP  EL  PW+   EK  +  S+ +V L+N+G  ++YQ VE IR++L +++ K N+K + +  V +++D  TE+  N  E+ HGE  VDRKS+FQ H A V + D++  V  +L  N KI  ATHN+ AYRI +    G   + Q CDDDGE  A  R+L++L ++  +N  VV+SRW+GGI+LG DRF+HINN  +  I   G  +
Sbjct:    1 MDADNLTKQIEEVEALCSIYGEDWTTESEATRSYNIKIKENDHEVILYVTMPSEYPAQAPPKYELSAPWMDRKEKEKLHQSLDEVYLENVGETVIYQWVEKIREKLLQIKPKENKKITNNIHVEELLD-LTEMVINCPEITHGEVIVDRKSSFQGHAAEVHSIDDINAVLAKLKQNKKILNATHNMYAYRIERSTEKGVS-ILQDCDDDGEAHAGGRMLHLLQILDQKNTLVVVSRWYGGIQLGPDRFRHINNATRQVIQQAGLLK 264          
BLAST of Impact RWD domain protein vs. TrEMBL
Match: A0A0N1PH62 (Protein IMPACT-B OS=Papilio machaon OX=76193 GN=RR48_02910 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.992e-51
Identity = 105/266 (39.47%), Postives = 158/266 (59.40%), Query Frame = 2
Query:  182 FDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYS--ATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQ 970
             D + ++ QIEE+E L SIY ++ +  +E  R + IK++ +    I+  + P EYP  +PP  EL  PW+   EK  +  S+ +V L+N+G  ++YQ VE IR++L +++    K  +    V +++D  +E+  N  E+ HGE  VDRKS+FQ H A V   D+V  V  +L  N KI  ATHN+ AYRI +    G   + Q CDDDGE  A  R+L++L ++  +N  VV+SRW+GGI+LG DRF+HINN  +  I   G  +
Sbjct:    1 MDADNLTKQIEEVEALSSIYGEDWTTESEVTRSYNIKIKENDHEVILYVTMPLEYPGQAPPKYELSAPWMDRKEKEKLHQSLDEVYLENIGETVIYQWVEKIREKLLQIKPKEIKKINNNIQVEEILD-LSELVINCPEITHGEVIVDRKSSFQGHAAEVHTIDDVNAVLAKLKQNKKILNATHNMYAYRIERSTDKGVS-ILQDCDDDGEAHAGGRMLHLLQILDQKNTLVVVSRWYGGIQLGPDRFRHINNATRQVIQQAGLLK 264          
BLAST of Impact RWD domain protein vs. TrEMBL
Match: A0A286XFC7 (Impact RWD domain protein OS=Cavia porcellus OX=10141 GN=IMPACT PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.382e-48
Identity = 112/286 (39.16%), Postives = 157/286 (54.90%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYS----IIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEI--------------ADNLFEVF------------------HGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAIT 952
            Q EEIE L +IY +E  V+++  R+F I++  D D+      ++   PNEYP  +PP  +L  PW+RG E+  I NS++++ +DN+G  ++Y  VE IRD L       RKS  A    V++ KTE                +NL+                     HG P  DR+STFQAH+A V    +V++V  +L  N KIA ATHNI AYRI      G     Q C+DDGE  A  RLL+++ ++ V N+ VV+SRW+GGI LG DRFKHINN A++ + 
Sbjct:   12 QNEEIEALSAIYGEEWCVVDDHARVFCIRIGDDKDHPKWTICLQVMLPNEYPATAPPIYQLNAPWLRGQERVNISNSLEEIYIDNIGESILYLWVEKIRDVLI------RKSQLAEPGPVVEKKTEEEDIECEDDLFLDYDPENLYRALDYDFGENQPEIEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLAKLYENKKIASATHNIYAYRIYC---EGKQTFLQDCEDDGETAAGGRLLHLMEILNVRNVMVVVSRWYGGILLGPDRFKHINNCARNILV 288          
BLAST of Impact RWD domain protein vs. TrEMBL
Match: A0A3P8PWQ0 (Impact RWD domain protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.482e-48
Identity = 103/265 (38.87%), Postives = 151/265 (56.98%), Query Frame = 2
Query:  185 DKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD----YSIIRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            D   +  QIEE+E L SIY  E  VI+E  RIF IK+  DL+     + ++   P +YP + PP  ++   W+RG E+  + NS++ + +++ G  ++Y  VE +RD L +  +                 +E  + L  + HG P  DR+STFQ H+A V    +V++V  +L  N KIA ATHNI AYRI   + +      Q C+DDGE  A  RLL++L ++ V N+ VV+SRWFGGI LG DRFKHINN A++ +   G+
Sbjct:    9 DDEDLQTQIEEVEALSSIYGDEWCVIDEASRIFCIKISADLEEPKLTACLQIILPPDYPSAAPPIYQINAVWLRGPERAKLANSLEDIYVEHAGESILYLWVEKVRDFLVEKSQ----------------NSETDEELPPIKHGNPITDRRSTFQPHLAPVVTPRQVKMVLEKLYENKKIASATHNIYAYRIYCEDKHS---FLQDCEDDGETAAGGRLLHLLQILDVRNVMVVVSRWFGGILLGPDRFKHINNCARNILVEEGY 254          
BLAST of Impact RWD domain protein vs. Ensembl Cavefish
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:103024748])

HSP 1 Score: 172.555 bits (436), Expect = 2.054e-47
Identity = 110/287 (38.33%), Postives = 158/287 (55.05%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDL---DYSI-IRFSFPNEYPDS-PPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDEL-AKLQKANRKSYSAT---------------VPKVIDNK-----------TEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQ 970
            Q+EEIE L SIY  E  VI+E  RIF IK+  D+    +S+ ++   P +YP S PP  ++   W+RG ++  I NS++++ L+N+G  ++Y  VE IR+ L  +LQ+A+      T               VP     K           +   + L  + HGE   DR+STFQ H+A V    +V+ V  +L  N KIA ATHNI AYRI   +        Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A++ +   G+ +
Sbjct:   14 QVEEIEALSSIYGDEWCVIDEASRIFCIKISDDIYEPRWSVCLQIILPEDYPSSAPPIYQINAGWLRGPDRVKICNSLEELYLENVGESILYLWVEKIREFLIERLQRADAAEEPETGRAVATEEEDEDWGDVPDYSALKLNTEQVHLFYSSPADEELPPIKHGEAVTDRRSTFQPHLAPVVTPKQVQRVIDKLYENKKIASATHNIYAYRIYCED---KSTFLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARNILVQEGYTE 297          
BLAST of Impact RWD domain protein vs. Ensembl Sea Lamprey
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:449553])

HSP 1 Score: 165.236 bits (417), Expect = 1.087e-45
Identity = 96/292 (32.88%), Postives = 153/292 (52.40%), Query Frame = 2
Query:  206 QIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYS-----IIRFSFPNEYP-DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYS---------------ATVPKVIDNKTE-----------IADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQLKHAN 985
            + +E+E + SIY  E   ++E  R F I +    D S      ++ + P +YP  +PP  +L  PW+   +K  +   ++++   NLG  +++  VECIR+ +A   + ++  ++                 +P +++ +               D +  +FHGE   DR+STFQAHVA V    +V++V R+L+ N K+A ATH I AYRI   +        Q CDDDGE  A  RLL++L ++ V +  VV+SRW+GG+ LG DRFKHINN A+  +   G+ Q   +N
Sbjct:    3 KADEVEAMSSIYGDEWCTLDEAARSFCISVGNGQDPSRRLSVSLQITLPADYPGQAPPSYQLNGPWLTREDKRTVSARLEEIYSQNLGESVLFLWVECIREFVADASERSQPVWNRYRANQTEEDSDLVEEMLPTILNEENLRSRDLEASDEFTGDEVPPIFHGETITDRRSTFQAHVAPVVTTKQVKLVLRKLLENKKLASATHTIMAYRI---DCPVKHAFLQDCDDDGETAAGGRLLHLLQILDVRDAVVVVSRWYGGVMLGPDRFKHINNCARGVLVDNGFVQTAVSN 291          
BLAST of Impact RWD domain protein vs. Ensembl Yeast
Match: YIH1 (Negative regulator of eIF2 kinase Gcn2p; competes with Gcn2p for binding to Gcn1p; may contribute to regulation of translation in response to starvation via regulation of Gcn2p; binds to monomeric actin and to ribosomes and polyribosomes; ortholog of mammalian IMPACT [Source:SGD;Acc:S000000655])

HSP 1 Score: 125.946 bits (315), Expect = 9.200e-33
Identity = 77/255 (30.20%), Postives = 136/255 (53.33%), Query Frame = 2
Query:  209 IEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYP--DSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHG-EPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGW 964
            +EE+E + +IY   LS   E+  I  +K+    +Y  ++ SFP  YP  ++P   E+G+      +++  +    +     +   + ++   C+ D L +L              V   +++I  + FE +   +P  DR STF A  A V +E++   +   L  ++K+  A H +SA+RI++   +G+   +Q  DDDGE  A  R+L+++ +M V N+ VV++RWFGG  +G DRFKHIN+TA++A+   G+
Sbjct:    9 VEELEAVEAIYPDLLSKKQEDGSIIVVKVP-QHEYMTLQISFPTHYPSEEAPNVIEVGV-CTSLAKRDLYDTKYLQHLFQEVMDSVFHRGSVCLFDFLTELDGVLYVEPEEETEPV--QQSDIPTDPFEGWTASDPITDRGSTFMAFAAHVTSEEQAFAMLDLLKTDSKMRKANHVMSAWRIKQ---DGSAATYQDSDDDGETAAGSRMLHLITIMDVWNVIVVVARWFGGAHIGPDRFKHINSTAREAVVRAGF 256          
BLAST of Impact RWD domain protein vs. Ensembl Yeast
Match: YDL177C_mRNA (Putative protein of unknown function; similar to the mouse IMPACT gene; YDL177C is not an essential gene [Source:SGD;Acc:S000002336])

HSP 1 Score: 70.0922 bits (170), Expect = 2.508e-14
Identity = 42/154 (27.27%), Postives = 68/154 (44.16%), Query Frame = 2
Query:  602 EPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGN--------------------------------GKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWF 967
            E  VDRKS FQA    ++N+ ++  + ++L  NNK      ++  Y  R  E + N                                  + Q C D GE  A +RLL +L    + N+ V+++RW+GG  LG+ RF+HI+  A + +   G+ 
Sbjct:   16 EVLVDRKSKFQARCCPLQNQKDIPSILQELTQNNKSVSKASHMHMYAWRTAEVSNNLHLQQEQKKKGNKANKSNNSHVNKSRNITVQPKNIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAVETLKKGGFL 169          
BLAST of Impact RWD domain protein vs. Ensembl Nematostella
Match: EDO45445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSN5])

HSP 1 Score: 168.318 bits (425), Expect = 1.943e-46
Identity = 106/289 (36.68%), Postives = 160/289 (55.36%), Query Frame = 2
Query:  185 DKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD--YSI-IRFSFPNEYPD-SPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDEL-------------AKLQKANRKSYSATVPK-------------VIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCG 961
            D+N +  Q EE+E L +IY ++ + I+E  R++EI+++ + D  YS+ ++   P +YP  +PP  E+   W+   E       +  +  +N G  ++YQ VE +R+ +               +   + K + AT  K             V+D  + I     E+ HGEPF +RKSTFQ+H+A V  E EV  +  +L  N K+A ATHNI AYRI   E +      Q CDDDGE+ A  RLL++L ++ V+N+ VV+SRW+GGI LG DRFKHINN+A++ I   G
Sbjct:    7 DENLVR-QCEEVEALSAIYGEDFASIDESSRMYEIRIKSENDPLYSLTMQLLLPPQYPSQAPPVFEIHSVWMTSVEMREAMEGLYDIYKENQGEIVLYQWVEKLREMVDEKVKEKQKEETTHTVYPTDDKGFEATTSKDNSGSKFDYNSKNVLDASSSI-----EIIHGEPFTERKSTFQSHLAFVTKEAEVREMLHELKLNKKVAHATHNIMAYRIYNEERDA---FIQDCDDDGESAAGSRLLHLLEILQVKNVVVVVSRWYGGILLGPDRFKHINNSARELIKSVG 286          
BLAST of Impact RWD domain protein vs. Ensembl Nematostella
Match: EDO28189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T763])

HSP 1 Score: 67.781 bits (164), Expect = 3.446e-14
Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 2
Query:  686 QLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGI 895
            +L  N KIA ATHNI AYRI   E +      Q CDDDGE+ A  RLL++L ++ V+N+ VV+SRW+GGI
Sbjct:    4 ELKLNKKIAHATHNIMAYRIYNEERDA---FIQDCDDDGESAAGSRLLHLLEILQVKNVVVVVSRWYGGI 70          
BLAST of Impact RWD domain protein vs. Ensembl Nematostella
Match: EDO46739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPH3])

HSP 1 Score: 48.521 bits (114), Expect = 3.687e-6
Identity = 39/126 (30.95%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  191 NYISLQIEEIETLHSIYDKELSVINEE-DRIFEIKLEFDL----DYSII------RFSFPNEYPDSPPFCELGIPWIRGTEKNAIENSIQKVCL----DNLGCPMVYQIVECIRDELAKLQKANRK 523
            +Y   Q  EIE + SIY +E ++I+E     F+I LE       D +II      +F+F  +YPD PP  E  +    G E + I N + ++ +    +NLG  MV+ +V C +++L ++ +  +K
Sbjct:    3 DYEEEQRHEIEAIESIYPEEFTIISESAPHSFQIHLESSCEDKEDNTIITVSVQLQFTFVEKYPDEPPVVE--VTSSEGLEDDDI-NQLTELLVQQSEENLGMVMVFTLVSCAQEKLEEIAEGIKK 125          
BLAST of Impact RWD domain protein vs. Ensembl Medaka
Match: impact (impact RWD domain protein [Source:NCBI gene;Acc:101170579])

HSP 1 Score: 173.711 bits (439), Expect = 8.664e-48
Identity = 106/290 (36.55%), Postives = 158/290 (54.48%), Query Frame = 2
Query:  197 ISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLD----YSIIRFSFPNEYPD-SPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAK------LQKANRKSYSATVPK-------------VIDNKTEIA---------DNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWF 967
            +  QIEE+E L SIY  E  VI+E  RIF IK+  DL+     + ++   P++YP  +PP  ++   W+RG E+  + NS++ + +++ G  ++Y  VE +R+ L +       +   + S SA                  +   TE A         + L  + HG P  DR+STFQ H+A V +  +V++V  +L  N KIA ATHNI AYRI   + N      Q C+DDGE  A  RLL++L ++ V N+ VV+SRW+GGI LG DRFKHINN A++ +   G+ 
Sbjct:   13 LQAQIEEVEALSSIYGDEWCVIDEASRIFCIKISSDLEEPKLTACLQIILPSDYPSAAPPIYQINAAWLRGPERVKLANSLEDIYVEHPGESILYLWVERVREFLVEKSQCSGAEHPGKDSTSAEEGVDDDDDEEYLSDFMALKLNTENAHLFMDPGHDEELPLIKHGNPVTDRRSTFQPHLALVVSPRQVKMVLEKLYMNKKIASATHNIYAYRIYCEDKNS---FLQDCEDDGETAAGGRLLHLLQILDVRNVMVVVSRWYGGILLGPDRFKHINNCARNILVEEGYI 299          
BLAST of Impact RWD domain protein vs. Planmine SMEST
Match: SMESG000018878.1 (SMESG000018878.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 265/270 (98.15%), Postives = 269/270 (99.63%), Query Frame = 2
Query:  176 MDFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQLKHAN 985
            MDFDKNYISLQI+EIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPP CELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEI++NLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWF+LKHAN
Sbjct:    1 MDFDKNYISLQIDEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPPICELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEISENLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFKLKHAN 270          
BLAST of Impact RWD domain protein vs. Planmine SMEST
Match: SMESG000018878.1 (SMESG000018878.1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 258/270 (95.56%), Postives = 262/270 (97.04%), Query Frame = 2
Query:  176 MDFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKSTFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFQLKHAN 985
            MDFDKNYISLQI+EIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPP CELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEI++NLFEVFHGEPFVDRKSTFQ       NEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWF+LKHAN
Sbjct:    1 MDFDKNYISLQIDEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIRFSFPNEYPDSPPICELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIVECIRDELAKLQKANRKSYSATVPKVIDNKTEISENLFEVFHGEPFVDRKSTFQ-------NEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGKLFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHINNTAKDAITHCGWFKLKHAN 263          
The following BLAST results are available for this feature:
BLAST of Impact RWD domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IMPACT1.053e-4636.62impact RWD domain protein [Source:HGNC Symbol;Acc:... [more]
IMPACT1.064e-4636.62impact RWD domain protein [Source:HGNC Symbol;Acc:... [more]
IMPACT2.782e-1530.51impact RWD domain protein [Source:HGNC Symbol;Acc:... [more]
IMPACT1.065e-1329.38impact RWD domain protein [Source:HGNC Symbol;Acc:... [more]
IMPACT3.686e-1354.90impact RWD domain protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
impt-17.842e-4537.20pep chromosome:WBcel235:I:10966394:10970166:-1 gen... [more]
impt-11.749e-831.25pep chromosome:WBcel235:I:10968183:10970166:-1 gen... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Impact RWD domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
impact1.433e-4836.99impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
impact1.433e-4836.99impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
impact5.039e-1334.82impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
impact5.039e-1334.82impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
impact5.039e-1334.82impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
impact2.786e-4839.15impact RWD domain protein [Source:NCBI gene;Acc:49... [more]
impact9.413e-4839.15impact RWD domain protein [Source:NCBI gene;Acc:49... [more]
impact1.250e-4739.15impact RWD domain protein [Source:NCBI gene;Acc:49... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Impact2.911e-4836.79impact, RWD domain protein [Source:MGI Symbol;Acc:... [more]
Impact5.344e-2332.02impact, RWD domain protein [Source:MGI Symbol;Acc:... [more]
Impact6.298e-1529.31impact, RWD domain protein [Source:MGI Symbol;Acc:... [more]
Impact1.948e-1134.65impact, RWD domain protein [Source:MGI Symbol;Acc:... [more]
Impact1.406e-1034.31impact, RWD domain protein [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Impact RWD domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5M8G6|IMPTA_XENTR2.085e-4838.62Protein IMPACT-A OS=Xenopus tropicalis OX=8364 GN=... [more]
sp|A7YY45|IMPCT_BOVIN6.681e-4837.59Protein IMPACT OS=Bos taurus OX=9913 GN=IMPACT PE=... [more]
sp|A9UMG5|IMPTB_XENTR1.082e-4736.99Protein IMPACT-B OS=Xenopus tropicalis OX=8364 GN=... [more]
sp|Q642J4|IMPCT_DANRE1.082e-4736.99Protein IMPACT OS=Danio rerio OX=7955 GN=impact PE... [more]
sp|O55091|IMPCT_MOUSE2.036e-4736.79Protein IMPACT OS=Mus musculus OX=10090 GN=Impact ... [more]
back to top
BLAST of Impact RWD domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q09GQ01.108e-5240.38RWD domain-containing protein OS=Bombyx mori OX=70... [more]
A0A194PWI81.154e-5240.23Protein IMPACT-B OS=Papilio xuthus OX=66420 GN=RR4... [more]
A0A0N1PH622.992e-5139.47Protein IMPACT-B OS=Papilio machaon OX=76193 GN=RR... [more]
A0A286XFC72.382e-4839.16Impact RWD domain protein OS=Cavia porcellus OX=10... [more]
A0A3P8PWQ02.482e-4838.87Impact RWD domain protein OS=Astatotilapia callipt... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
impact2.054e-4738.33impact RWD domain protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
impact1.087e-4532.88impact RWD domain protein [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YIH19.200e-3330.20Negative regulator of eIF2 kinase Gcn2p; competes ... [more]
YDL177C_mRNA2.508e-1427.27Putative protein of unknown function; similar to t... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO454451.943e-4636.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281893.446e-1452.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467393.687e-630.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Impact RWD domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
impact8.664e-4836.55impact RWD domain protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Impact RWD domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000018878.10.000e+098.15SMESG000018878.1[more]
SMESG000018878.10.000e+095.56SMESG000018878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032871 ID=SMED30032871|Name=Impact RWD domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2642bp
AAACATTGTATTAACACTGTCAGAAATTCATCTTGGTTGGTCGAGAATTA
TTTGATTTTTAGTGATGTGGTAGATATTATTTTATTAATCAATTTTATTC
AAAACTTTCCAAGTACTATAAAAGAGATATATTTTATTTTAAATTTTAAC
CAAAGAAATTTTAATTAAATTATATATGGATTTCGATAAGAATTATATTA
GCTTACAAATCGAAGAAATTGAAACATTGCATTCAATTTATGATAAAGAA
TTGTCTGTAATTAATGAAGAGGATAGAATTTTTGAAATTAAACTGGAATT
TGATTTGGATTATTCAATTATTAGATTTTCTTTTCCAAATGAGTATCCTG
ATTCACCACCTTTTTGTGAATTAGGTATTCCTTGGATACGAGGTACTGAA
AAAAATGCAATCGAGAATTCAATTCAAAAGGTTTGTCTTGACAATCTTGG
TTGTCCGATGGTGTATCAAATAGTTGAATGTATTAGAGATGAATTAGCTA
AATTACAGAAAGCAAATAGGAAAAGTTATTCAGCAACTGTTCCTAAAGTA
ATCGATAATAAAACTGAAATTGCTGACAATTTATTTGAAGTCTTTCATGG
AGAACCTTTTGTTGATAGAAAAAGTACTTTTCAAGCTCATGTTGCTCGGG
TGAAGAATGAAGACGAAGTTGAGATCGTTAAACGACAATTAATGGCAAAT
AACAAAATAGCGGTTGCGACTCATAACATAAGTGCTTACAGAATTCGTAA
ATACGAGCCGAATGGAAACGGTAAATTGTTCCAATCATGCGATGATGATG
GAGAGAACAAGGCAAGCGAAAGGCTATTAAATATGCTCGTTCTGATGGGG
GTGGAAAACATTTATGTTGTGATTAGCCGGTGGTTCGGTGGAATCAAATT
GGGTGCCGATAGATTTAAACATATAAACAACACAGCAAAAGACGCTATCA
CTCATTGCGGTTGGTTCCAACTGAAGCATGCCAATTAATCTCTTGAAATG
TTATTTGATCTGATTTGTTTCCTAGATTGATCACAGCCATTCCTAATATT
GGCTGGTTCTAATTGTTGTTATGCTCGATAAGATGTTTATTTTTATCCTA
ATTTATTATTTGTTTGTGATATCGTGGGAGACTGGCAAAATCCCCCTCCC
TGCTTACTGACTGGTATACAACATCCTTGTCTGTTAGACCGAATATATAC
TGACATTTATTTAGAACTGTATATCGTAGTATTTAGATTAACTGAATACA
TAAACCGAGGATTATTTTCTACGTTTGGGGGGGGGGAGATTTGCTCTATT
TCGATATTGGTTTGCCGCTTATTTTGCACATTGATGACTGTAGGAAGATA
TACAATGATTTTTCTCGCATAAATATCGCGTTTCAATCAGTTCATACTGA
ATAAGATAGGATTTAGGAACCAATAGCTTTAAAAATGACTGAATTTTACA
AGCACTAAAGTAGGTTGGCATAAAAATCACTCTTATATTGTCAAATCACT
TCATTTTTAAAAAATAAATCTAAAAACTTATTTGTAGCTTTGAATGGAGA
AAACAATTATTTTATGTAAAACACTTGATTATTTTTATATTTGTTGATAC
ATTTATTAATTATGTTGGGCCAAGACAAGATTTTGTTTAAGTAAATCGGA
AACAACATGCAAACACATCAAGGCATATTCAAACCTATACTCGCCAACTA
AACACCCTAAAATATGAGAAAAAATACATAAACGATAAATCTTAATATTA
ATAGATTTTAGAAATATAGTTGCATGATGAAAATACTAAGGTATGTTGCT
TTACACTACTCAAACCATGCAATTATGTTAATTAGAAGTATACATGCGGT
CGTTAAATATATAAAATATCAAGCTTTCAGTTTTGACTTAACAGTATTAA
TTTTATTAATAATTTGGTGAATATTACAAATTTTATTTTAAATATGTTAT
CACTTATGAAATATAATTATGTTATTCTATTTGATAAACACTGAATAACT
TAGAACAATTATATTTTATGAGCATCTTTTTTCACATTAATTTAAACGTA
TTTATGAATATAGCAAATTTTCAACATATATGGATTACGTTAGTCCATGA
TTCACAATATAGATGCAATAAAAGTCCCTTTTAACAAAGACTTGACTAAT
GAATATATATTAAAAACTATGGTTTTATTAATTGATTGTAGAAATATAGT
TATGAAAAAATAGTTTACATATTATGTTGCTTAAAAGTATACCCTCGCGC
ATTTAATATATCAAGTTTTGACTAAATAAGGATATTATTTTGGCTCCCAC
CATTCGATTTCGATGAGTTGAAGTTTAAATGGATGAATTATTTGTTTTTA
TTTTTAAATATAATAATATCTTTACACTTTATTACATTTTATTTACAAGC
TGGTCGTAGGTGGCTGTAATCTTGCTAGTCTGCAAATAATTATTTTGTTA
GTAATAAACATTAATTAATTTAGTCGCTATGACGCTTTGTAGTGTCCGAG
ACAATCTAGGCTTAATTTGTGCTATGAAGCCCAGGTACTTTTTGACCCCA
CTTGGTCAGTCAAAAAATAAAGCATAAACTTCATATTGGCCTCTCTTATC
GTAAATTTTTATGTTTTTAACTATAATAGATTAAATTTTTAT
back to top

protein sequence of SMED30032871-orf-1

>SMED30032871-orf-1 ID=SMED30032871-orf-1|Name=SMED30032871-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MDFDKNYISLQIEEIETLHSIYDKELSVINEEDRIFEIKLEFDLDYSIIR
FSFPNEYPDSPPFCELGIPWIRGTEKNAIENSIQKVCLDNLGCPMVYQIV
ECIRDELAKLQKANRKSYSATVPKVIDNKTEIADNLFEVFHGEPFVDRKS
TFQAHVARVKNEDEVEIVKRQLMANNKIAVATHNISAYRIRKYEPNGNGK
LFQSCDDDGENKASERLLNMLVLMGVENIYVVISRWFGGIKLGADRFKHI
NNTAKDAITHCGWFQLKHAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0043022ribosome binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006446regulation of translational initiation
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001933negative regulation of protein phosphorylation
GO:0006417regulation of translation
GO:0007399nervous system development
GO:0030154cell differentiation
GO:0031333negative regulation of protein complex assembly
GO:0031953negative regulation of protein autophosphorylation
GO:0034198cellular response to amino acid starvation
GO:0042149cellular response to glucose starvation
GO:0045666positive regulation of neuron differentiation
GO:0060548negative regulation of cell death
GO:0060733regulation of eIF2 alpha phosphorylation by amino acid starvation
GO:0070301cellular response to hydrogen peroxide
GO:0071264positive regulation of translational initiation in response to starvation
GO:0071468cellular response to acidic pH
GO:0071494cellular response to UV-C
GO:0072755cellular response to benomyl
GO:0097201negative regulation of transcription from RNA polymerase II promoter in response to stress
GO:1990138neuron projection extension
GO:1990253cellular response to leucine starvation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR006575RWD-domain
IPR001498Impact_N
IPR016135UBQ-conjugating_enzyme/RWD
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005844polysome