Signal peptide peptidase like 2A

Overview
NameSignal peptide peptidase like 2A
Smed IDSMED30032870
Length (bp)1848
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Signal peptide peptidase like 2A (SMED30032870) t-SNE clustered cells

Violin plots show distribution of expression levels for Signal peptide peptidase like 2A (SMED30032870) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Signal peptide peptidase like 2A (SMED30032870) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Signal peptide peptidase like 2A (SMED30032870) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032870

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30032870SMESG000010558.1 dd_Smed_v4_3988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032870SMESG000010558.1 dd_Smed_v4_3988_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032870SMESG000010558.1 dd_Smed_v4_3988_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Match: SPPL2B (signal peptide peptidase like 2B [Source:HGNC Symbol;Acc:HGNC:30627])

HSP 1 Score: 83.5741 bits (205), Expect = 2.701e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G+SIM +VATG + S +RE++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S V +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R     W 
Sbjct:  371 KSGSSIMVEVATGPSDSATREKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIA-YGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWT 500          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Match: SPPL2B (signal peptide peptidase like 2B [Source:HGNC Symbol;Acc:HGNC:30627])

HSP 1 Score: 82.8037 bits (203), Expect = 6.460e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G+SIM +VATG + S +RE++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S V +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R     W 
Sbjct:  371 KSGSSIMVEVATGPSDSATREKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIA-YGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWT 500          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Match: SPPL2A (signal peptide peptidase like 2A [Source:HGNC Symbol;Acc:HGNC:30227])

HSP 1 Score: 80.8777 bits (198), Expect = 9.032e-16
Identity = 81/291 (27.84%), Postives = 143/291 (49.14%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDS---LSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNEN 1647
             V+++I++F +A   S+ + L   + K       I    K    N++ R I +  L +++A VW V RN +    +L + +GI  C  +     TL +   NF+  ++LL + LL DV  V+I      P ITK   + M   +       ++  GN +    ATG   +  E++P+  ++P++     +S           S++GFGD+I+PG  I+Y   F V T  S + Y    +  Y IG+++T++V    ++GQPAL++L+P  + TA ++A  ++     W  N
Sbjct:   62 LVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGK----NMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNL---IKTLKLP--NFKSCVILLGLLLLYDVFFVFIT-----PFITKNGESIMVELAAGPFGNNEKNDGNLVE---ATGQPSAPHEKLPVVIRVPKLIYFSVMSVCL-----MPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVA-YAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGN 329          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Match: SPPL2A (signal peptide peptidase like 2A [Source:HGNC Symbol;Acc:HGNC:30227])

HSP 1 Score: 80.1073 bits (196), Expect = 3.884e-15
Identity = 82/288 (28.47%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNEN 1647
             V+++I++F +A   S+ + L   + K       I    K    N++ R I +  L +++A VW V RN +    +L + +GI  C  +     TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM ++A G  G++ E++P+  ++P++     +S           S++GFGD+I+PG  I+Y   F V T  S + Y    +  Y IG+++T++V    ++GQPAL++L+P  + TA ++A  ++     W  N
Sbjct:  244 LVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGK----NMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNL---IKTLKLP--NFKSCVILLGLLLLYDVFFVFIT-----PFITKN-----------------GESIMVELAAGPFGNN-EKLPVVIRVPKLIYFSVMSVCL-----MPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVA-YAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGN 493          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Match: SPPL2C (signal peptide peptidase like 2C [Source:HGNC Symbol;Acc:HGNC:28902])

HSP 1 Score: 76.6406 bits (187), Expect = 6.692e-14
Identity = 44/137 (32.12%), Postives = 77/137 (56.20%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTA-GSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            + G SIM QVA G A  SS E +P+  K+PR+ ++   +   C   S+ +S++GFGD+++PG  ++Y   F V      V +    +  Y +GL++T++     + GQPAL++L+ S + T+L +A  ++     W 
Sbjct:  398 KTGESIMAQVALGPAESSSHERLPMVLKVPRLRVS---ALTLC---SQPFSILGFGDIVVPGFLVAYCCPFDVQVCSRQVYFVACTVA-YAVGLLVTFMAMVLMQMGQPALLYLVSSTLLTSLAVAACRQELSLFWT 527          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 64.3142 bits (155), Expect = 1.658e-10
Identity = 44/188 (23.40%), Postives = 88/188 (46.81%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGSSR-------------EEVPIRFKI-----------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNE---------NWMENPTGFVENIDDEQLIS 1704
            G S+M +VATG + +++             E VP +F +             +DM  +L           ++++G GD+++PG  +++  T    + +  ++Y    +  Y IGL++T+L     +  QPAL++L+PS +   ++LA+ +  F+ +WN          N   +P   +E+I+   +I 
Sbjct:  447 GCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGF--------QFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGEFLKIWNGVPVECSPLINSSSSPDDTMEDIESNAVID 626          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 63.5438 bits (153), Expect = 2.995e-10
Identity = 39/158 (24.68%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGSSR-------------EEVPIRFKI-----------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G S+M +VATG + +++             E VP +F +             +DM  +L           ++++G GD+++PG  +++  T    + +  ++Y    +  Y IGL++T+L     +  QPAL++L+PS +   ++LA+ +  F+ +WN
Sbjct:  447 GCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGF--------QFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGEFLKIWN 596          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 63.5438 bits (153), Expect = 2.995e-10
Identity = 39/158 (24.68%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGSSR-------------EEVPIRFKI-----------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G S+M +VATG + +++             E VP +F +             +DM  +L           ++++G GD+++PG  +++  T    + +  ++Y    +  Y IGL++T+L     +  QPAL++L+PS +   ++LA+ +  F+ +WN
Sbjct:  447 GCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGF--------QFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGEFLKIWN 596          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 63.5438 bits (153), Expect = 3.049e-10
Identity = 39/158 (24.68%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGSSR-------------EEVPIRFKI-----------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G S+M +VATG + +++             E VP +F +             +DM  +L           ++++G GD+++PG  +++  T    + +  ++Y    +  Y IGL++T+L     +  QPAL++L+PS +   ++LA+ +  F+ +WN
Sbjct:  447 GCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGF--------QFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGEFLKIWN 596          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 63.5438 bits (153), Expect = 3.049e-10
Identity = 39/158 (24.68%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGSSR-------------EEVPIRFKI-----------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G S+M +VATG + +++             E VP +F +             +DM  +L           ++++G GD+++PG  +++  T    + +  ++Y    +  Y IGL++T+L     +  QPAL++L+PS +   ++LA+ +  F+ +WN
Sbjct:  447 GCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGF--------QFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGEFLKIWN 596          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Fly
Match: Spp (gene:FBgn0031260 transcript:FBtr0078080)

HSP 1 Score: 57.7658 bits (138), Expect = 1.495e-8
Identity = 32/108 (29.63%), Postives = 61/108 (56.48%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIK 1617
            E PI+   P+  +   L+++       +++M+G GD+++PG FI+ ++ F     +   +Y    L  Y +GL+ T  V    +  QPAL++L+P+ + T LL+A+I+
Sbjct:  246 EAPIKLVFPQDLIENGLNAS-------NFAMLGLGDIVIPGIFIALLLRFDDSKKRKTRIYFYSTLIAYFLGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIR 346          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Zebrafish
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 81.6481 bits (200), Expect = 9.557e-16
Identity = 51/164 (31.10%), Postives = 90/164 (54.88%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQL--ISVDAP 1716
            ++G SIM +VA G + SS  E++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F ++   S + +    +  Y IGL+IT++     + GQPAL++L+P  + T+L +A+ ++     W  +    P   +E I+  Q    S D P
Sbjct:  364 KSGESIMVEVAAGPSDSSTHEKLPMVLKVPR------LNSSPLVLCDRPFSLLGFGDILVPGLLVAYCHRFDILMQTSQIYFLACTI-GYGIGLLITFVALTLMQMGQPALLYLVPCTLLTSLAVALWRKELPLFWTGSGFVPPPIIMEQINCTQTPGPSTDEP 520          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Zebrafish
Match: hm13 (histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB-GENE-020802-3])

HSP 1 Score: 58.5362 bits (140), Expect = 9.884e-9
Identity = 36/134 (26.87%), Postives = 67/134 (50.00%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQ 1695
            E PI+   P+  +   L ++       +++M+G GD+++PG FI+ ++ F V   K+   Y       YI GL +T  V    +  QPAL++L+P+ V   +L+A++K     ++   + E      E  + E+
Sbjct:  240 EAPIKLVFPQDLLEKGLGAS-------NFAMLGLGDIVIPGIFIALLLRFDVSLKKNTRTYFYTSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVLVALVKGELTEMF--RYEEETPSKEETTESEK 364          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Match: sppl2a (signal peptide peptidase like 2A [Source:NCBI gene;Acc:100135083])

HSP 1 Score: 84.7297 bits (208), Expect = 1.139e-16
Identity = 84/330 (25.45%), Postives = 155/330 (46.97%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGL-VLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAG-----------------SSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQLISVDAPEK 1722
             V+++I++F +A   S+ + L   +         I   NK    + + R   +    ++++  W+V RN    + +L + +GI  C        TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM +VA+G +G                 S+ E++P+  ++PR++ +   ++  CQ    S+S++GFGD+I+PG  ++Y   F V +  S + Y    +  Y +G+V+T++V    + GQPAL++L+P  + T+ ++A  ++     WN    E        +++E L S +  E+
Sbjct:  205 LVYVIIAVFCLASATSLFNCLSAIIQNIPYGKCRISCCNK----SAEVRLFFLAAFCIAVSVTWVVFRNEDRWIWILQDILGIAFCLNF---IKTLRMP--NFKACVILLGLLLLYDVFFVFIT-----PFITKN-----------------GESIMVEVASGPSGDAEKNGDTYLEVPDEPYSTNEKLPVVIRVPRLEFS---ANTLCQ---MSFSLLGFGDIIVPGLLVAYCRRFDVRSTSSMIYYICCTIA-YAVGMVLTFIVLTLMKMGQPALLYLVPCTLLTSSVIAWRRKEMKKFWNGGGYEIMEHMDNAVNEEGLTSSEQEEQ 496          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Match: sppl2a (signal peptide peptidase like 2A [Source:NCBI gene;Acc:100135083])

HSP 1 Score: 84.7297 bits (208), Expect = 1.192e-16
Identity = 84/330 (25.45%), Postives = 155/330 (46.97%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGL-VLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAG-----------------SSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQLISVDAPEK 1722
             V+++I++F +A   S+ + L   +         I   NK    + + R   +    ++++  W+V RN    + +L + +GI  C        TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM +VA+G +G                 S+ E++P+  ++PR++ +   ++  CQ    S+S++GFGD+I+PG  ++Y   F V +  S + Y    +  Y +G+V+T++V    + GQPAL++L+P  + T+ ++A  ++     WN    E        +++E L S +  E+
Sbjct:  245 LVYVIIAVFCLASATSLFNCLSAIIQNIPYGKCRISCCNK----SAEVRLFFLAAFCIAVSVTWVVFRNEDRWIWILQDILGIAFCLNF---IKTLRMP--NFKACVILLGLLLLYDVFFVFIT-----PFITKN-----------------GESIMVEVASGPSGDAEKNGDTYLEVPDEPYSTNEKLPVVIRVPRLEFS---ANTLCQ---MSFSLLGFGDIIVPGLLVAYCRRFDVRSTSSMIYYICCTIA-YAVGMVLTFIVLTLMKMGQPALLYLVPCTLLTSSVIAWRRKEMKKFWNGGGYEIMEHMDNAVNEEGLTSSEQEEQ 536          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Match: sppl2a (signal peptide peptidase like 2A [Source:NCBI gene;Acc:100135083])

HSP 1 Score: 84.3445 bits (207), Expect = 1.404e-16
Identity = 84/330 (25.45%), Postives = 155/330 (46.97%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGL-VLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAG-----------------SSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQLISVDAPEK 1722
             V+++I++F +A   S+ + L   +         I   NK    + + R   +    ++++  W+V RN    + +L + +GI  C        TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM +VA+G +G                 S+ E++P+  ++PR++ +   ++  CQ    S+S++GFGD+I+PG  ++Y   F V +  S + Y    +  Y +G+V+T++V    + GQPAL++L+P  + T+ ++A  ++     WN    E        +++E L S +  E+
Sbjct:  241 LVYVIIAVFCLASATSLFNCLSAIIQNIPYGKCRISCCNK----SAEVRLFFLAAFCIAVSVTWVVFRNEDRWIWILQDILGIAFCLNF---IKTLRMP--NFKACVILLGLLLLYDVFFVFIT-----PFITKN-----------------GESIMVEVASGPSGDAEKNGDTYLEVPDEPYSTNEKLPVVIRVPRLEFS---ANTLCQ---MSFSLLGFGDIIVPGLLVAYCRRFDVRSTSSMIYYICCTIA-YAVGMVLTFIVLTLMKMGQPALLYLVPCTLLTSSVIAWRRKEMKKFWNGGGYEIMEHMDNAVNEEGLTSSEQEEQ 532          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Match: bpi.4 (bactericidal permeability increasing protein, gene 4 [Source:Xenbase;Acc:XB-GENE-493665])

HSP 1 Score: 80.4925 bits (197), Expect = 3.265e-15
Identity = 46/150 (30.67%), Postives = 86/150 (57.33%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVEN 1680
            + G SIM +VA+G + S+ +E++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S + +    +  Y IGL++T++     ++GQPAL++L+P  + T+L +A+ ++     W        +GFV N
Sbjct:  369 KRGESIMVEVASGPSNSTTQEKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGIGLLVTFVALALMQKGQPALLYLVPCTLLTSLAVALWRKELHMFWTG------SGFVVN 505          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Match: bpi.4 (bactericidal permeability increasing protein, gene 4 [Source:Xenbase;Acc:XB-GENE-493665])

HSP 1 Score: 80.1073 bits (196), Expect = 3.345e-15
Identity = 46/150 (30.67%), Postives = 86/150 (57.33%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVEN 1680
            + G SIM +VA+G + S+ +E++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S + +    +  Y IGL++T++     ++GQPAL++L+P  + T+L +A+ ++     W        +GFV N
Sbjct:  365 KRGESIMVEVASGPSNSTTQEKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGIGLLVTFVALALMQKGQPALLYLVPCTLLTSLAVALWRKELHMFWTG------SGFVVN 501          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Match: Sppl2b (signal peptide peptidase like 2B [Source:MGI Symbol;Acc:MGI:1920468])

HSP 1 Score: 84.3445 bits (207), Expect = 8.287e-18
Identity = 45/137 (32.85%), Postives = 83/137 (60.58%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++GNSIM +VATG + SS  E++P+  K+PR++ +  LS        R +S++GFGD+++PG  ++Y   F +    S + +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R   + W 
Sbjct:  110 KSGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTS-PLSLC-----DRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWT 239          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Match: Sppl2b (signal peptide peptidase like 2B [Source:MGI Symbol;Acc:MGI:1920468])

HSP 1 Score: 85.5001 bits (210), Expect = 2.292e-17
Identity = 78/287 (27.18%), Postives = 144/287 (50.17%), Query Frame = 1
Query:  790 VWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVN-KYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            V+++I +F +A +  + S L  FV K       +   N  Y       R + + +  ++++ VW + RN +    VL +T+GI  C  +     T+ + +  F+   +LL V  + D+  V+I      P +TK                 +GNSIM +VATG + SS  E++P+  K+PR++ +  LS        R +S++GFGD+++PG  ++Y   F +    S + +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R   + W 
Sbjct:  111 VYVIIGIFCLASSTGLYSCLAPFVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGIFRNEDQWAWVLQDTLGIAFCLYM---LKTIRLPT--FKACTLLLLVLFIYDIFFVFIT-----PFLTK-----------------SGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTS-PLSLC-----DRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWT 363          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Match: Sppl2b (signal peptide peptidase like 2B [Source:MGI Symbol;Acc:MGI:1920468])

HSP 1 Score: 86.2705 bits (212), Expect = 3.014e-17
Identity = 78/290 (26.90%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  781 NVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVN-KYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +  V+++I +F +A +  + S L  FV K       +   N  Y       R + + +  ++++ VW + RN +    VL +T+GI  C  +     T+ + +  F+   +LL V  + D+  V+I      P +TK                 +GNSIM +VATG + SS  E++P+  K+PR++ +  LS        R +S++GFGD+++PG  ++Y   F +    S + +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R   + W 
Sbjct:  238 DRLVYVIIGIFCLASSTGLYSCLAPFVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGIFRNEDQWAWVLQDTLGIAFCLYM---LKTIRLPT--FKACTLLLLVLFIYDIFFVFIT-----PFLTK-----------------SGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTS-PLSLC-----DRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWT 493          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Match: Sppl2c (signal peptide peptidase 2C [Source:MGI Symbol;Acc:MGI:3045264])

HSP 1 Score: 78.1814 bits (191), Expect = 1.302e-14
Identity = 74/294 (25.17%), Postives = 136/294 (46.26%), Query Frame = 1
Query:  781 NVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFP-SYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASR----NFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTA-GSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            + FV+++I +F +  +  + S L   +    ++   ++ P  +  +T       G+  +   +  +W+++RN +    +L +T+G+  C         LFV  R     F+   + L   L  DV  V+I      P  TK                  G SIM +VA+G A  SS E +P+  K+PR      LS +     ++ +S++GFGD+++PG  ++Y   F +      V Y    +  Y +GL++T++     + GQPAL++L+ S + T+L +A  ++ F   W 
Sbjct:  284 DCFVYVMIGIFSLGASTGLYSCLAPILCHLPLWRYQWVLPGQRVSVTWPLLLLAGLCAM---VTVLWVIHRNEDHWAWLLQDTLGVAYC---------LFVLRRVRLPTFKNCTLFLLALLAFDVFFVFIT-----PLFTK-----------------TGESIMVEVASGPADSSSHERLPMVLKVPR------LSFSALTLCNQPFSILGFGDIVVPGFLVAYCHRFDMQVQSRQVYYMACTVA-YAVGLLVTFVAMILMQMGQPALLYLVSSTLLTSLAVATCRQEFTLFWT 536          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Match: Sppl2c (signal peptide peptidase 2C [Source:MGI Symbol;Acc:MGI:3045264])

HSP 1 Score: 77.7962 bits (190), Expect = 1.843e-14
Identity = 74/294 (25.17%), Postives = 137/294 (46.60%), Query Frame = 1
Query:  781 NVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFP-SYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASR----NFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTA-GSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            + FV+++I +F +  +  + S L   +    ++   ++ P  +  +T   +  + +  L   +  +W+++RN +    +L +T+G+  C         LFV  R     F+   + L   L  DV  V+I      P  TK                  G SIM +VA+G A  SS E +P+  K+PR      LS +     ++ +S++GFGD+++PG  ++Y   F +      V Y    +  Y +GL++T++     + GQPAL++L+ S + T+L +A  ++ F   W 
Sbjct:  284 DCFVYVMIGIFSLGASTGLYSCLAPILCHLPLWRYQWVLPGQRVSVT---WPLLLLAGLCAMVTVLWVIHRNEDHWAWLLQDTLGVAYC---------LFVLRRVRLPTFKNCTLFLLALLAFDVFFVFIT-----PLFTK-----------------TGESIMVEVASGPADSSSHERLPMVLKVPR------LSFSALTLCNQPFSILGFGDIVVPGFLVAYCHRFDMQVQSRQVYYMACTVA-YAVGLLVTFVAMILMQMGQPALLYLVSSTLLTSLAVATCRQEFTLFWT 536          
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Match: sp|Q3TD49|SPP2B_MOUSE (Signal peptide peptidase-like 2B OS=Mus musculus OX=10090 GN=Sppl2b PE=1 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 2.108e-16
Identity = 78/290 (26.90%), Postives = 145/290 (50.00%), Query Frame = 1
Query:  781 NVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVN-KYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +  V+++I +F +A +  + S L  FV K       +   N  Y       R + + +  ++++ VW + RN +    VL +T+GI  C  +     T+ + +  F+   +LL V  + D+  V+I      P +TK                 +GNSIM +VATG + SS  E++P+  K+PR++ +  LS        R +S++GFGD+++PG  ++Y   F +    S + +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R   + W 
Sbjct:  238 DRLVYVIIGIFCLASSTGLYSCLAPFVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGIFRNEDQWAWVLQDTLGIAFCLYM---LKTIRLPT--FKACTLLLLVLFIYDIFFVFIT-----PFLTK-----------------SGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTS-PLSLC-----DRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWT 493          
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Match: sp|Q5F383|SPP2B_CHICK (Signal peptide peptidase-like 2B OS=Gallus gallus OX=9031 GN=SPPL2B PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.288e-16
Identity = 85/316 (26.90%), Postives = 152/316 (48.10%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVN-KYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQLI--SVDAPE 1719
             V+++I +F +A +  + S L  FV +F +    I   N  Y       R + + V  +S++ VW V RN +    VL + +GI  C  +     T+ + +  F+   +LL V  + DV  V+I      P +TK                  G SIM +VA G + S + E++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S V +    +  Y IGL++T++     + GQPAL++L+P  + T+  +A+ ++     W        +GF +++    L+  SV+ P+
Sbjct:  243 LVYVIIGIFCLAASIGLYSCLSPFVRRFPLGKCRIPDNNLPYFHKRPQVRILLLAVFCISVSVVWGVFRNEDQWAWVLQDALGIAFCLYM---LKTIRLPT--FKGCTLLLLVLFVYDVFFVFIT-----PFLTK-----------------TGESIMVEVAAGPSDSATHEKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIA-YGIGLLVTFVALALMQMGQPALLYLVPCTLITSFSVALWRKELAMFWTG------SGFAKDLPQPPLVIASVNCPQ 518          
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Match: sp|Q8TCT7|SPP2B_HUMAN (Signal peptide peptidase-like 2B OS=Homo sapiens OX=9606 GN=SPPL2B PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 3.102e-15
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G+SIM +VATG + S +RE++P+  K+PR      L+S+      R +S++GFGD+++PG  ++Y   F +    S V +    +  Y +GL++T++     +RGQPAL++L+P  + T+  +A+ +R     W 
Sbjct:  371 KSGSSIMVEVATGPSDSATREKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIA-YGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWT 500          
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Match: sp|Q5PQL3|SPP2B_RAT (Signal peptide peptidase-like 2B OS=Rattus norvegicus OX=10116 GN=Sppl2b PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.868e-15
Identity = 76/290 (26.21%), Postives = 139/290 (47.93%), Query Frame = 1
Query:  781 NVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVN-KYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +  V+++I +F +A +  + S L   V K       +   N  Y       R + + +  ++++ VW V RN +    VL +T+GI  C      +    +    F+   +LL V  + D+  V+I      P +TK                 +GNSIM +VATG + SS  E++P+  K+PR++ +  LS        R +S++GFGD+++PG  ++Y   F +    S + +    +  Y +GL++T++       GQPAL++L+P  + T+  +A+ +R   + W 
Sbjct:  238 DRLVYVIIGIFCLASSTGLYSCLAPCVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGVFRNEDQWAWVLQDTLGIAFCL-----YMLRTIRLPTFKACTLLLLVLFVYDIFFVFIT-----PYLTK-----------------SGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTS-PLSLC-----DRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIA-YGLGLLVTFVALVLMRHGQPALLYLVPCTLLTSCTVALWRREMGAFWT 493          
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Match: sp|Q8TCT8|SPP2A_HUMAN (Signal peptide peptidase-like 2A OS=Homo sapiens OX=9606 GN=SPPL2A PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.865e-14
Identity = 82/288 (28.47%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNEN 1647
             V+++I++F +A   S+ + L   + K       I    K    N++ R I +  L +++A VW V RN +    +L + +GI  C  +     TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM ++A G  G++ E++P+  ++P++     +S           S++GFGD+I+PG  I+Y   F V T  S + Y    +  Y IG+++T++V    ++GQPAL++L+P  + TA ++A  ++     W  N
Sbjct:  244 LVYVMIAIFCIASAMSLYNCLAALIHKIPYGQCTIACRGK----NMEVRLIFLSGLCIAVAVVWAVFRNEDRWAWILQDILGIAFCLNL---IKTLKLP--NFKSCVILLGLLLLYDVFFVFIT-----PFITKN-----------------GESIMVELAAGPFGNN-EKLPVVIRVPKLIYFSVMSVCL-----MPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVA-YAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGN 493          
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Match: A0A1W0X2R6 (Signal peptide peptidase-like 2B OS=Hypsibius dujardini OX=232323 GN=BV898_04332 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.429e-18
Identity = 86/262 (32.82%), Postives = 134/262 (51.15%), Query Frame = 1
Query:  898 VNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATG------TAGSS-REEVPIRFKIPRIDMNYKLSSARCQNY--SRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWME 1656
            V++Y   ++D R + +F++  SLA  W+V RN+  G +L + +G  L   V +G     +   N +   + L++  + DV  V+I      P  TK                  G S+M  VATG       +GS  RE +P  FK+P I      + A C++     SYS++GFGDV++PG  ISY+  F ++T   PV YS   LF Y++ LVIT +   F   GQPAL++++P ++ T  ++A  +R   SLW  N +E
Sbjct:  302 VSRYCGPSLDIRGMVLFIVSCSLAATWVVFRNDPLGWILLDLLGSFLLVSVLIG-----IQVPNLKACTIFLSLLFIYDVFFVFI-----TPLFTKD-----------------GQSVMMTVATGGYDPTRDSGSGLREVIPAAFKVPHIP-----TGALCEDLFDDISYSLLGFGDVMVPGFLISYLRAFELVTKIRPV-YSVPALFAYLMSLVITTVALIFMRTGQPALLYIVPILLATVFVIAWRRRELSSLWRGNLVE 530          
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Match: A0A2C9K277 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078607 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.148e-17
Identity = 101/341 (29.62%), Postives = 174/341 (51.03%), Query Frame = 1
Query:  718 WIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFP-SYIHPVNKYGITN--IDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASR---NFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISL----WNENWMENPTGFVENIDDEQLISVD 1710
            W+V+I   ++   ++LLYFFY+V V+  I++F +A ++S+   L+   S  +I P SY  P+N++      +  R+  +++  L+LA  W + R++    V+ + +G   C          F+ +    N +++ VLL + LL DV  V+I      P ITK                  G+SIME VATG +  S+E +P+ F IP +  +  L+  R     RSYS++GFGD+I+PG  +SY   F + +  S ++Y       Y+ G++I  +   F   GQPAL++L+P  + T +++A+I+     L      +  ++NP     NI D + I  +
Sbjct:  231 WMVVIWFAVICAVIILLYFFYDVMVYFFIAMFCLAGSYSLYQCLLPVWS--HIVPLSYDIPLNRFPCIKMKVKLRSFLLYMPCLTLAIFWAIERHSSYAWVIQDLLGASFC--------IFFIQNLRLPNLKVIAVLLILLLLYDVFFVFIT-----PLITKD-----------------GDSIMESVATGGSSHSKESLPMVFLIPLLG-DSPLTKCR----DRSYSLLGFGDIIIPGLLVSYNAVFDIRSG-SRMVYYVLSSVAYLCGMIICMISLVFMNSGQPALLYLVPCTLITTVVIALIRGELRKLIFGSQTQTDLQNPVE--SNIKDAEEIDTN 531          
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Match: J3S558 (Signal peptide peptidase-like 2A-like OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.309e-17
Identity = 121/483 (25.05%), Postives = 218/483 (45.13%), Query Frame = 1
Query:  226 VPKEENDIKFTHLYFDPLLSFCSPSKIGFDNHPSVMVINPHYCGLVRQIRNARQANVKHLLLVSSPDYLYLPEVVK-EFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIYGSMGDNRVGDALTGVITFVIVLTSVLLIIFITXXXXXXXXXXXXXXXXSDSKNMKWIVLIAPLMMVGTXXXXXXXXNV-------FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMA-GLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNEN 1647
            +P   + I +  L        CSPS++  D     +V+    C  + +   A++   K LLLV+S   +  P   K +    PI  +  T   D  +++S+  +  +G+Y         D  + VI F+I +  V L  + +     E  ++      +DS + +  + + PL +V  +        +        V++VIS+F +A   S+   L   + K           N+     ++ R + +F+  ++L+  W V RN  +   +L N +GI  C        TL +   NF+  ++LL + LL DV  V+I      P ITK   + M   +L   +    N      A+    +  E++P+ FK+PR+D++    +  C    R +S++GFGDV++PG  ++Y   F V T+ S V Y  F    Y +G+V+T++      + QPAL++L+P  +   +L+A+ ++     WN N
Sbjct:   51 LPDSLSTIAYARLEILTPRMLCSPSEVTQDIRNKAVVVKRGNCTFLEKAEIAQRFGAK-LLLVASETSIRSPGGNKTQNLTIPIALVRDTDIKD--LEQSLGRNVNVGLYSP--PQPFFD-YSMVIIFLIAMFCVSLGGYWSGRAELEKLKRGPNPGSNDSLSDEETLTLTPLTVVIFVSFCCIMLVLMYFFYKWLVYVVISIFCIASVSSMYCCLSALLKKVPYGQCRFPCWNR----ALEVRLVFLFLFCVALSVTWAVFRNEESWAWILQNILGISFCLNF---IKTLKMP--NFKSCVILLGLLLLYDVFFVFIT-----PYITKSGESIMVEVALGPLESSEKNDGNLMDASAEQSAPHEKLPVVFKVPRLDLS---PAVLCM---RPFSLLGFGDVVIPGLLVAYCNRFDVQTSSSSV-YFIFCTIAYGVGMVLTFVCLVLMGKAQPALLYLVPCTLIPCVLIALYRKEMKKFWNGN 506          
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Match: A0A094KFR7 (Signal peptide peptidase-like 2A (Fragment) OS=Podiceps cristatus OX=345573 GN=N338_10951 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.888e-17
Identity = 86/285 (30.18%), Postives = 143/285 (50.18%), Query Frame = 1
Query:  790 VWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            V+++IS+F +A   S+ + L   + +       I   NK    NI+ R I + V  ++ A +W V RN +    +L + +G+  C        TL     NF+  ++LL + LL DV  V+I      P ITK                  G SIM +VA G  G+S E++P+  ++PR++ +   +S  C      +S++GFGD+I+PG  ++Y   F V T+ S V Y    +  Y IG+V+T++V    + GQPAL++L+P  + T+ L+A  ++     W 
Sbjct:   95 VYVIISVFCLASAMSLYNCLAALIGEIPFGQCRIACCNK----NIEVRLIFLAVFCIAAAVIWAVFRNEDRWAWILQDILGVAFCLNF---IKTL--KMPNFKSCVILLGLLLLYDVFFVFIT-----PFITKN-----------------GASIMVEVAAGPFGNS-EKLPVVIRVPRLEYS---ASTLCD---MPFSLLGFGDIIVPGLLVAYCRRFDVQTSSSSVYYISCTIA-YAIGMVLTFIVLALMKMGQPALLYLVPCTLITSSLVAWRRKEMKKFWK 340          
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Match: A0A093G722 (Signal peptide peptidase-like 2A (Fragment) OS=Dryobates pubescens OX=118200 GN=N307_09572 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.534e-17
Identity = 88/288 (30.56%), Postives = 145/288 (50.35%), Query Frame = 1
Query:  787 FVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRN-NMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNEN 1647
             V+++IS+F +A   S+ + L   V +       I   NK    +I+ R I + V  ++ A VW V RN +    +L + +G+  C        TL +   NF+  ++LL + LL DV  V+I      P ITK                  G SIM +VA G  G+S E++P+  ++PR++ +   +S  C      +S++GFGD+I+PG  ++Y   F V T+ S V Y    +  Y IG+V+T++V    + GQPAL++L+P  + T+ L+A  ++     W  N
Sbjct:  229 LVYVIISVFCLASAMSLYNCLAALVGEIPFGQCRIACCNK----SIEVRLIFLAVFCIAAAAVWAVFRNEDRWAWILQDILGVAFCLNF---IKTLKMP--NFKSCVILLGLLLLYDVFFVFIT-----PFITKN-----------------GASIMVEVAAGPFGNS-EKLPVVIRVPRLEYS---ASTLCD---MPFSLLGFGDIIVPGLLVAYCRRFDVQTSSSSVYYISCTIA-YAIGMVLTFIVLALMKMGQPALLYLVPCTLITSSLVAWRRKEMKKFWKGN 477          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:103038406])

HSP 1 Score: 81.2629 bits (199), Expect = 8.608e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G +GSS  E++P+  K+PR++ +     A C    R +S++GFGD+++PG  ++Y   F ++   S + +    +  Y IGL+IT++     + GQPAL++L+P  + T+L +A+ ++     W 
Sbjct:  339 KSGESIMVEVAAGPSGSSTHEKLPMVLKVPRLNFS---PLALC---DRPFSLLGFGDILVPGLLVAYCHRFDILMQSSRIYFLACTVG-YGIGLLITFVALALMQMGQPALLYLVPCTLLTSLAVALWRKELPLFWT 468          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:103038406])

HSP 1 Score: 81.2629 bits (199), Expect = 8.913e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G +GSS  E++P+  K+PR++ +     A C    R +S++GFGD+++PG  ++Y   F ++   S + +    +  Y IGL+IT++     + GQPAL++L+P  + T+L +A+ ++     W 
Sbjct:  342 KSGESIMVEVAAGPSGSSTHEKLPMVLKVPRLNFS---PLALCD---RPFSLLGFGDILVPGLLVAYCHRFDILMQSSRIYFLACTV-GYGIGLLITFVALALMQMGQPALLYLVPCTLLTSLAVALWRKELPLFWT 471          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:103038406])

HSP 1 Score: 81.2629 bits (199), Expect = 8.913e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G +GSS  E++P+  K+PR++ +     A C    R +S++GFGD+++PG  ++Y   F ++   S + +    +  Y IGL+IT++     + GQPAL++L+P  + T+L +A+ ++     W 
Sbjct:  342 KSGESIMVEVAAGPSGSSTHEKLPMVLKVPRLNFS---PLALCD---RPFSLLGFGDILVPGLLVAYCHRFDILMQSSRIYFLACTV-GYGIGLLITFVALALMQMGQPALLYLVPCTLLTSLAVALWRKELPLFWT 471          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:103038406])

HSP 1 Score: 81.2629 bits (199), Expect = 9.030e-16
Identity = 45/137 (32.85%), Postives = 82/137 (59.85%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGSS-REEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G +GSS  E++P+  K+PR++ +     A C    R +S++GFGD+++PG  ++Y   F ++   S + +    +  Y IGL+IT++     + GQPAL++L+P  + T+L +A+ ++     W 
Sbjct:  364 KSGESIMVEVAAGPSGSSTHEKLPMVLKVPRLNFS---PLALCD---RPFSLLGFGDILVPGLLVAYCHRFDILMQSSRIYFLACTV-GYGIGLLITFVALALMQMGQPALLYLVPCTLLTSLAVALWRKELPLFWT 493          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Match: SPPL2A (signal peptide peptidase like 2A [Source:NCBI gene;Acc:103036341])

HSP 1 Score: 72.0182 bits (175), Expect = 8.103e-13
Identity = 47/149 (31.54%), Postives = 77/149 (51.68%), Query Frame = 1
Query: 1240 GNSIMEQVATGT-AGSSR--------------EEVPIRFKIPRIDMNYKLSSARCQNYS-RSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLW 1638
            G SIM QVA G  AG  +              E++P+  ++PR        SA  QN     +S++G+GD+I+PG  ++Y   F V    S  +Y       Y +GLV+T++V   ++ GQPAL++L+P  + T+ ++A  ++ F   W
Sbjct:  361 GESIMVQVALGPGAGGEKGDVVEVSADPSPAYEKLPVVMRVPRF-------SAWAQNLCGMQFSILGYGDIIVPGLLVAYCHRFDVWINSSNRIYFISCTIAYCVGLVVTFVVMLLSKMGQPALLYLVPFTLITSAVVACSRKEFRQFW 502          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Sea Lamprey
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 77.411 bits (189), Expect = 6.702e-16
Identity = 45/135 (33.33%), Postives = 76/135 (56.30%), Query Frame = 1
Query: 1240 GNSIMEQVATGTA-GSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G SIM +VA+G +  SS+E++P+  K+PR      L+ +     S+ +S++GFGD+++PG  + Y   F V T  S + +    +  Y +GL++T++       GQPAL++L+P  V T   +A  KR   + W 
Sbjct:  158 GQSIMVEVASGPSDSSSKEKLPMVLKVPR------LAPSELSVCSQPFSLLGFGDILVPGVLVVYCHRFDVHTNSSHIYFVTSTI-AYGLGLLVTFVALVLTRMGQPALLYLVPCTVLTCTAVAAGKRQLPAFWR 285          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Sea Lamprey
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 65.0846 bits (157), Expect = 2.341e-11
Identity = 46/135 (34.07%), Postives = 74/135 (54.81%), Query Frame = 1
Query: 1240 GNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            G SIM QVATG + S S E +P+  K+PR      L++       + +S++GFGD+++PG  ++Y   F V   +S  LY       Y +GL++T+L       GQPAL++L+P  + ++LL+A  +      W 
Sbjct:  371 GESIMVQVATGPSKSTSHEMLPMVVKVPR------LAATPLSMCYQPFSLLGFGDILVPGLLVAYCHRFDVQV-QSSKLYFIACTMAYGVGLLLTFLALALMRMGQPALLYLVPCTLLSSLLVACFRGELGMFWK 498          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Sea Lamprey
Match: hm13 (histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB-GENE-020802-3])

HSP 1 Score: 57.3806 bits (137), Expect = 4.147e-9
Identity = 31/108 (28.70%), Postives = 60/108 (55.56%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIK 1617
            E PI+   P+  +   L ++       +++M+G GD+++PG FI+ ++ F +   K+   Y       YI+GL +T  V    +  QPAL++L+P+ +   +L+A++K
Sbjct:  238 EAPIKLVFPQDLLQRGLEAS-------NFAMLGLGDIVIPGIFIALLLRFDISLKKNSRTYFYVSFLAYILGLGLTIFVMHTFKHAQPALLYLVPACIGLPVLVALLK 338          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Nematostella
Match: EDO41036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M6])

HSP 1 Score: 73.9442 bits (180), Expect = 6.105e-14
Identity = 42/140 (30.00%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1237 AGNSIMEQVATGTAGS-----SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +G S+M +VATG   +      +E++P+  KIPR      L+ +     +R YS++GFGD+++PG +I +  +F  ++     +Y       Y +GL+IT+      + GQPAL++L+P ++ T + +A  +     LW 
Sbjct:  345 SGKSVMVEVATGRVTAWLMCDHKEQLPMVLKIPR------LTKSVLSVCARPYSLLGFGDILVPGLYIGFCHSFDTISKTPRKIYFVATTIAYGVGLLITFGALFLMKTGQPALLYLVPCVLLTGVAIAWYRGELKKLWT 478          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Nematostella
Match: EDO47550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM71])

HSP 1 Score: 56.9954 bits (136), Expect = 9.977e-9
Identity = 38/111 (34.23%), Postives = 67/111 (60.36%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMT--AKSPV-LYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIK 1617
            E PI+   P +D+  K  +A       +++M+G GD+++PG FI+ ++ + V    +KS V  Y+ F+   Y++GL+ T LV    +  QPAL++L+P+ V T L LA+++
Sbjct:  241 EAPIKLVFP-MDILEKGFAAN------NFAMLGLGDIVIPGIFIALLLRYDVSKHGSKSTVYFYATFMA--YLVGLITTVLVMHKFKAAQPALLYLVPACVGTPLTLALLR 342          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Nematostella
Match: EDO32795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU17])

HSP 1 Score: 55.8398 bits (133), Expect = 2.712e-8
Identity = 40/153 (26.14%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 1243 NSIMEQVATGTAGSSREEVPIRFKI------PRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAV--------MTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMEN 1659
             ++M +VAT  A +    V  +F++      P+I +  KL     Q   R +SM+G GD+++PG  + +++ +             +S + Y    L  YI+GLV   + ++  +  QPAL++L+P  +   LL+A +K     +W + ++ N
Sbjct:  217 TNVMVRVATQQANNPVAYVASKFRMNSFNSSPQISLPGKLVFPS-QERGR-FSMLGLGDIVMPGLLLCFVMRYDKYKRQQAPPTDTESRITYFHCSLVGYIVGLVTATVASEVYKAAQPALLYLVPFTLLPILLMAYLKGDLRKMWQDPFLAN 367          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:101168741])

HSP 1 Score: 80.8777 bits (198), Expect = 1.262e-15
Identity = 45/137 (32.85%), Postives = 80/137 (58.39%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G + S + E++P+  K+PR      L+S+      R +S++GFGDV++PG  + Y   F ++T  S + +    +  Y IGL++T++     + GQPAL++L+P  + T+L +A+ +R     W 
Sbjct:  364 KSGESIMVEVAAGPSDSATHEKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDVLVPGLLVVYCHRFDILTQTSRIYFVTCTVA-YGIGLLVTFVALALMQTGQPALLYLVPCTLLTSLTVALWRRELSQFWT 493          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:101168741])

HSP 1 Score: 80.8777 bits (198), Expect = 1.406e-15
Identity = 45/137 (32.85%), Postives = 80/137 (58.39%), Query Frame = 1
Query: 1234 EAGNSIMEQVATGTAGS-SREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            ++G SIM +VA G + S + E++P+  K+PR      L+S+      R +S++GFGDV++PG  + Y   F ++T  S + +    +  Y IGL++T++     + GQPAL++L+P  + T+L +A+ +R     W 
Sbjct:  364 KSGESIMVEVAAGPSDSATHEKLPMVLKVPR------LNSSPLALCDRPFSLLGFGDVLVPGLLVVYCHRFDILTQTSRIYFVTCTVA-YGIGLLVTFVALALMQTGQPALLYLVPCTLLTSLTVALWRRELSQFWT 493          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Match: ENSORLT00000015899.2 (signal peptide peptidase-like 2A [Source:NCBI gene;Acc:101156241])

HSP 1 Score: 73.9442 bits (180), Expect = 1.704e-13
Identity = 89/312 (28.53%), Postives = 156/312 (50.00%), Query Frame = 1
Query:  712 MKWIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGL-VLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYS-RSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +K ++ +A  +M G L+L+YFFYNV V+I+I++F +A   ++ S     + K     ++   V     ++   R+I +  + +S+A VW V RN    + +L + +GI  C    + F    ++  NF++ ++LL++ L+ DV  V+I      P  TK                  G SIM QVA G   S   ++P+  ++P         SA  QN     +S++G+GD+I+PG  ++Y   F V    S  +Y       Y++GL++T+ V   +  GQPAL++L+P  + T+ ++A  +R     W 
Sbjct:  220 LKVVIFVA--LMCGMLVLMYFFYNVLVYIIIAIFCLASASALFSCFDAVLDKLGC-GTFSFTVKN---SSFSARSILLAAVCISIAVVWGVYRNEERWIWLLQDILGIAFC----LNFLKT-ISLSNFKICVILLSLLLVYDVFFVFIT-----PFFTKD-----------------GVSIMVQVALGPDASG-GKLPVVMRVPWF-------SAWAQNLCWMQFSILGYGDIIVPGLLVAYCSRFDVWVGSSKRIYFISSCLAYLLGLILTFAVMLLSGMGQPALLYLVPFTLITSAVVAGCRREMKHFWT 490          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Match: ENSORLT00000015900.2 (signal peptide peptidase-like 2A [Source:NCBI gene;Acc:101156241])

HSP 1 Score: 71.633 bits (174), Expect = 1.030e-12
Identity = 91/322 (28.26%), Postives = 157/322 (48.76%), Query Frame = 1
Query:  712 MKWIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGL-VLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSRE------EVPIRFKIPR----IDMNYKLSSARCQNYS-RSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWN 1641
            +K ++ +A  +M G L+L+YFFYNV V+I+I++F +A   ++ S     + K     ++   V     ++   R+I +  + +S+A VW V RN    + +L + +GI  C    + F    ++  NF++ ++LL++ L+ DV  V+I      P  TK                  G SIM QVA G   S  +      E+P   + P     + M     SA  QN     +S++G+GD+I+PG  ++Y   F V    S  +Y       Y++GL++T+ V   +  GQPAL++L+P  + T+ ++A  +R     W 
Sbjct:  220 LKVVIFVA--LMCGMLVLMYFFYNVLVYIIIAIFCLASASALFSCFDAVLDKLGC-GTFSFTVKN---SSFSARSILLAAVCISIAVVWGVYRNEERWIWLLQDILGIAFC----LNFLKT-ISLSNFKICVILLSLLLVYDVFFVFIT-----PFFTKD-----------------GVSIMVQVALGPDASGGKTHSGGLEIPAEPQPPSEKLPVVMRVPWFSAWAQNLCWMQFSILGYGDIIVPGLLVAYCSRFDVWVGSSKRIYFISSCLAYLLGLILTFAVMLLSGMGQPALLYLVPFTLITSAVVAGCRREMKHFWT 508          
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:101171062])

HSP 1 Score: 57.7658 bits (138), Expect = 1.812e-8
Identity = 37/125 (29.60%), Postives = 65/125 (52.00%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSP--VLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENP 1662
            E PI+   P+  +   L +        +++M+G GD+++PG FI+ ++ F V   K+     YS FL   YI GL +T  V    +  QPAL++L+P+ V   +++A+ K     ++   + E P
Sbjct:  261 EAPIKLVFPQDLLEKGLEA-------NNFAMLGLGDIVIPGIFIALLLRFDVSLKKNSRTYFYSSFLA--YIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVIVALFKGELTEMF--RYEETP 374          
BLAST of Signal peptide peptidase like 2A vs. Planmine SMEST
Match: SMESG000010558.1 (SMESG000010558.1)

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 458/463 (98.92%), Postives = 459/463 (99.14%), Query Frame = 1
Query:  331 MVINPHYCGLVRQIRNARQANVKHLLLVSSPDYLYLPEVVKEFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIYGSMGDNRVGDALTGVITFVIVLTSVLLIIFITXXXXXXXXXXXXXXXXSDSKNMKWIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDEQLISVDAPE 1719
            MVINPHYCGLVRQIRNARQANVKHLLLVSSPDYLYLP+VVKEFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIYGSMGDNRVGDALTGVITFVIVLTSVLLIIFITVVFNKELFEK KVVKESDSKNMKWIVLIAPLMMVGTLLLLYFFYNVFVWIVISLFFMAM FSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRLLLVLLAVTLLIDVLMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYM TFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTG VENIDDEQLISVDAPE
Sbjct:    1 MVINPHYCGLVRQIRNARQANVKHLLLVSSPDYLYLPDVVKEFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIYGSMGDNRVGDALTGVITFVIVLTSVLLIIFITVVFNKELFEKLKVVKESDSKNMKWIVLIAPLMMVGTLLLLYFFYNVFVWIVISLFFMAMAFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRLLLVLLAVTLLIDVLMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMATFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGIVENIDDEQLISVDAPE 463          
BLAST of Signal peptide peptidase like 2A vs. Planmine SMEST
Match: SMESG000065062.1 (SMESG000065062.1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.252e-12
Identity = 123/515 (23.88%), Postives = 225/515 (43.69%), Query Frame = 1
Query:  163 SKLNSTLVDECVFTTRPKGYEVPKEENDIK-FTHLYFDPLLSFCSPSKIGFDNHPSVMVI-NPH-YCGLVRQIRNARQ-ANVKHLLLVSSPDYLYLPEVVKEFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIY-GSMGDNRVGDALTGVITFVIVLTSVLLIIFITXXXXXXXXXXXXXXXXSDSKNMKWIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFRXXXXXXXXXXXXXXXMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAGNSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFAERGQPA-LVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDD 1689
            S++ +T  D CV  +  K + +P ++++ K F +L   P  + C+ +  G +  P  +VI  P  +C +   I    Q  N+K L+++S+     L  ++  FT   ++ L+    F   +  S +N   IGIY G M  N +   L   +  V+++  +L I  I++VF++++      + + +        +   +++ G  +        F+WI I LF +    SI  FL   V     +      + K  + N D + + +  LG    ++W  NRNN+ G ++N  IGI +C E+++ F  L  A R ++             ++M++    G   TI    P  +    L + K   GNS M  +         EE P+RFKIP    N    +     + +  + V + ++I+ G+ +SY + F +   +S        +  YIIG++I +L+        P+ LV  + SI P  +++ V      SL    W  +      N +D
Sbjct:   33 SRMKATF-DICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNEN--GLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTD-SMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLIMLFIWLISIVFHQDIIHMILGIHKMEKYIAFASAIAIAILIDGVSMFHRLS---FIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYK-------------IVMIFF---GIIVTIYLLSPLILI--VLYQIKVSLGNSEMHTIF------QDEEFPMRFKIPFQMFNIFFINCGTLFWDQRVT-VTYVNIIISGSVVSYFILFYLSIKRSIKFLLTTSVMGYIIGVMIYFLLFLHLGTHLPSTLVINICSITPGIIIITV-NHQLYSLGTNKWAVSQRKEESNTED 514          
BLAST of Signal peptide peptidase like 2A vs. Planmine SMEST
Match: SMESG000016697.1 (SMESG000016697.1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.308e-9
Identity = 39/125 (31.20%), Postives = 67/125 (53.60%), Query Frame = 1
Query: 1294 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMVTFAVMTAKSPVLY--SGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENP 1662
            E PI+   PR  +    SS        +Y+M+G GD+++PG F++ ++ F     K    Y  +G++   YIIGL+ T LV    +  QPAL++L+P+ +   ++L+VI      L+   + +NP
Sbjct:  297 EAPIKLVFPRDLVMSGFSST-------NYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVA--YIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLF--KYEDNP 410          
BLAST of Signal peptide peptidase like 2A vs. Planmine SMEST
Match: SMESG000065062.1 (SMESG000065062.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.951e-7
Identity = 78/316 (24.68%), Postives = 147/316 (46.52%), Query Frame = 1
Query:  163 SKLNSTLVDECVFTTRPKGYEVPKEENDIK-FTHLYFDPLLSFCSPSKIGFDNHPSVMVI-NPH-YCGLVRQIRNARQ-ANVKHLLLVSSPDYLYLPEVVKEFTQYPIVSLLSTSTFDKIIDKSILNDSKIGIY-GSMGDNRVGDALTGVITFVIVLTSVLLIIFITXXXXXXXXXXXXXXXXSDSKNMKWIVLIAPLMMVGTXXXXXXXXNVFVWIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIGIFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNFR 1095
            S++ +T  D CV  +  K + +P ++++ K F +L   P  + C+ +  G +  P  +VI  P  +C +   I    Q  N+K L+++S+     L  ++  FT   ++ L+    F   +  S +N   IGIY G M  N +   L   +  V+++  +L I  I++VF++++      + + +        +   +++ G  +        F+WI I LF +    SI  FL   V     +      + K  + N D + + +  LG    ++W  NRNN+ G ++N  IGI +C E+++ F  L  A R ++
Sbjct:   33 SRMKATF-DICVIGSPSKSFNIPTKKSEAKYFGNLISLPHENLCNEN--GLEIGPEALVIARPDIHCDMHYHINILSQYKNIKVLVVLSNNFDKDLNYLLINFTD-SMIMLVEKKVFLDGLKLSEINSHMIGIYSGQMLTNNLYQILACFVAGVLMVLIMLFIWLISIVFHQDIIHMILGIHKMEKYIAFASAIAIAILIDGVSMFHRLS---FIWINIGLFCLFGAHSIGFFLRFLVQNVTWYRDCKWDLRKIRLKNDDLKFLILCFLGAIFCSLWFFNRNNVVGNIMNIIIGIFICLELSIIFAILLAAERKYK 341          
The following BLAST results are available for this feature:
BLAST of Signal peptide peptidase like 2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPPL2B2.701e-1632.85signal peptide peptidase like 2B [Source:HGNC Symb... [more]
SPPL2B6.460e-1632.85signal peptide peptidase like 2B [Source:HGNC Symb... [more]
SPPL2A9.032e-1627.84signal peptide peptidase like 2A [Source:HGNC Symb... [more]
SPPL2A3.884e-1528.47signal peptide peptidase like 2A [Source:HGNC Symb... [more]
SPPL2C6.692e-1432.12signal peptide peptidase like 2C [Source:HGNC Symb... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
imp-11.658e-1023.40IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-12.995e-1024.68IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-12.995e-1024.68IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-13.049e-1024.68IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-13.049e-1024.68IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Spp1.495e-829.63gene:FBgn0031260 transcript:FBtr0078080[more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sppl29.557e-1631.10signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
hm139.884e-926.87histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sppl2a1.139e-1625.45signal peptide peptidase like 2A [Source:NCBI gene... [more]
sppl2a1.192e-1625.45signal peptide peptidase like 2A [Source:NCBI gene... [more]
sppl2a1.404e-1625.45signal peptide peptidase like 2A [Source:NCBI gene... [more]
bpi.43.265e-1530.67bactericidal permeability increasing protein, gene... [more]
bpi.43.345e-1530.67bactericidal permeability increasing protein, gene... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sppl2b8.287e-1832.85signal peptide peptidase like 2B [Source:MGI Symbo... [more]
Sppl2b2.292e-1727.18signal peptide peptidase like 2B [Source:MGI Symbo... [more]
Sppl2b3.014e-1726.90signal peptide peptidase like 2B [Source:MGI Symbo... [more]
Sppl2c1.302e-1425.17signal peptide peptidase 2C [Source:MGI Symbol;Acc... [more]
Sppl2c1.843e-1425.17signal peptide peptidase 2C [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3TD49|SPP2B_MOUSE2.108e-1626.90Signal peptide peptidase-like 2B OS=Mus musculus O... [more]
sp|Q5F383|SPP2B_CHICK5.288e-1626.90Signal peptide peptidase-like 2B OS=Gallus gallus ... [more]
sp|Q8TCT7|SPP2B_HUMAN3.102e-1532.85Signal peptide peptidase-like 2B OS=Homo sapiens O... [more]
sp|Q5PQL3|SPP2B_RAT7.868e-1526.21Signal peptide peptidase-like 2B OS=Rattus norvegi... [more]
sp|Q8TCT8|SPP2A_HUMAN1.865e-1428.47Signal peptide peptidase-like 2A OS=Homo sapiens O... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W0X2R62.429e-1832.82Signal peptide peptidase-like 2B OS=Hypsibius duja... [more]
A0A2C9K2772.148e-1729.62Uncharacterized protein OS=Biomphalaria glabrata O... [more]
J3S5584.309e-1725.05Signal peptide peptidase-like 2A-like OS=Crotalus ... [more]
A0A094KFR76.888e-1730.18Signal peptide peptidase-like 2A (Fragment) OS=Pod... [more]
A0A093G7227.534e-1730.56Signal peptide peptidase-like 2A (Fragment) OS=Dry... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sppl28.608e-1632.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
sppl28.913e-1632.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
sppl28.913e-1632.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
sppl29.030e-1632.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
SPPL2A8.103e-1331.54signal peptide peptidase like 2A [Source:NCBI gene... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sppl26.702e-1633.33signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
sppl22.341e-1134.07signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
hm134.147e-928.70histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO410366.105e-1430.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475509.977e-934.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327952.712e-826.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sppl21.262e-1532.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
sppl21.406e-1532.85signal peptide peptidase like 2B [Source:NCBI gene... [more]
ENSORLT00000015899.21.704e-1328.53signal peptide peptidase-like 2A [Source:NCBI gene... [more]
ENSORLT00000015900.21.030e-1228.26signal peptide peptidase-like 2A [Source:NCBI gene... [more]
hm131.812e-829.60histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Signal peptide peptidase like 2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000010558.10.000e+098.92SMESG000010558.1[more]
SMESG000065062.14.252e-1223.88SMESG000065062.1[more]
SMESG000016697.13.308e-931.20SMESG000016697.1[more]
SMESG000065062.12.951e-724.68SMESG000065062.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032870 ID=SMED30032870|Name=Signal peptide peptidase like 2A|organism=Schmidtea mediterranea sexual|type=transcript|length=1848bp
GTTTTGAATATATAATTTTAGAAATTATTTAAACCATATCTCATGTCCTT
CACACATATTTTTATGTGGAAAATACTTTTTTCTTTGTTTCTTTTTATTT
TTACAACTGAATCAGCAAAATACAGTGATTATGATTTAAAATATAAAGTG
AAAATTATATATTCAAAACTAAATAGTACTCTAGTGGATGAATGTGTCTT
TACTACAAGACCTAAAGGTTATGAAGTTCCTAAAGAAGAAAATGATATAA
AGTTCACGCATTTGTATTTTGATCCGCTCTTGTCATTTTGCTCCCCCAGC
AAGATCGGATTTGACAACCACCCGTCTGTTATGGTTATCAATCCGCATTA
TTGTGGCCTTGTCCGGCAAATTCGTAATGCTCGTCAAGCCAATGTCAAAC
ATTTACTGTTAGTTTCATCTCCTGATTATTTATACTTGCCTGAGGTTGTG
AAGGAGTTTACCCAATACCCAATTGTTTCTCTTTTATCCACTAGTACATT
TGATAAGATCATTGACAAGAGCATATTGAATGACTCCAAGATAGGAATAT
ATGGATCGATGGGGGATAATCGGGTGGGGGATGCCTTGACTGGCGTGATA
ACCTTCGTTATCGTCCTCACATCTGTGCTGCTCATCATATTCATAACTGT
CGTGTTCAACAAAGAGCTTTTTGAAAAGTTTAAAGTAGTAAAGGAATCAG
ATTCAAAAAACATGAAATGGATCGTGCTGATTGCTCCATTGATGATGGTG
GGAACGTTGCTGTTGCTCTACTTCTTTTATAATGTGTTCGTCTGGATTGT
GATCTCATTATTTTTCATGGCCATGACGTTCTCAATAACAAGTTTCCTCA
TGCTCTTCGTGTCGAAATTCAACATTTTCCCGAGTTATATACACCCTGTC
AACAAATACGGGATAACGAATATCGATTACAGGGCCATTGGGATATTCGT
GTTGGGCCTGTCGCTGGCCACCGTTTGGATAGTCAATAGGAATAACATGG
CCGGATTGGTGTTGAATAACACTATAGGAATACTCCTATGTGGAGAAGTT
GCTGTTGGCTTTGGAACTCTTTTTGTTGCCTCCAGGAATTTCAGGTTGCT
TTTGGTGCTTCTGGCCGTGACCCTCCTGATTGACGTTCTCATGGTTTATA
TTCAAGCTCCAGGAGGCCAGCCCACTATTACTAAGCAATTGCCAGCCTTC
ATGAGAAATGATTCTCTAAGTCGAAGAAAACGCGAGGCGGGTAACAGTAT
TATGGAACAAGTAGCAACCGGTACTGCTGGAAGCTCCAGAGAAGAAGTTC
CAATAAGATTTAAAATACCTCGTATCGACATGAATTATAAATTATCATCA
GCGAGATGTCAAAATTATAGCAGAAGCTACTCAATGGTTGGATTCGGAGA
TGTCATTTTACCCGGGGCATTCATATCATATATGGTTACGTTCGCCGTGA
TGACAGCTAAATCACCCGTCCTTTATTCTGGGTTCTTGTTGTTCTGGTAT
ATTATTGGACTCGTCATCACTTATCTTGTTGCGCAGTTTGCTGAGAGGGG
TCAGCCTGCTCTGGTGTTCCTGTTGCCTAGCATTGTGCCGACCGCCCTTT
TATTGGCCGTTATTAAAAGACATTTCATTTCCCTCTGGAATGAGAATTGG
ATGGAAAATCCAACTGGGTTTGTGGAAAATATCGACGACGAGCAATTAAT
TTCCGTCGATGCTCCCGAAAAAACAAAAAGTTCAATATAATGATTTCTGA
AATTTATCTTTGAATTGATTTATGCTTATTGATTATGTATAGAATTCACT
TTGACAGTTTGATTTTAATATATTTTGGTATTTTTGTTGAAGTTAATA
back to top

protein sequence of SMED30032870-orf-1

>SMED30032870-orf-1 ID=SMED30032870-orf-1|Name=SMED30032870-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=566bp
MSFTHIFMWKILFSLFLFIFTTESAKYSDYDLKYKVKIIYSKLNSTLVDE
CVFTTRPKGYEVPKEENDIKFTHLYFDPLLSFCSPSKIGFDNHPSVMVIN
PHYCGLVRQIRNARQANVKHLLLVSSPDYLYLPEVVKEFTQYPIVSLLST
STFDKIIDKSILNDSKIGIYGSMGDNRVGDALTGVITFVIVLTSVLLIIF
ITVVFNKELFEKFKVVKESDSKNMKWIVLIAPLMMVGTLLLLYFFYNVFV
WIVISLFFMAMTFSITSFLMLFVSKFNIFPSYIHPVNKYGITNIDYRAIG
IFVLGLSLATVWIVNRNNMAGLVLNNTIGILLCGEVAVGFGTLFVASRNF
RLLLVLLAVTLLIDVLMVYIQAPGGQPTITKQLPAFMRNDSLSRRKREAG
NSIMEQVATGTAGSSREEVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVG
FGDVILPGAFISYMVTFAVMTAKSPVLYSGFLLFWYIIGLVITYLVAQFA
ERGQPALVFLLPSIVPTALLLAVIKRHFISLWNENWMENPTGFVENIDDE
QLISVDAPEKTKSSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0031293membrane protein intracellular domain proteolysis
GO:0050776regulation of immune response
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0042500aspartic endopeptidase activity, intramembrane cleaving
GO:0004190aspartic-type endopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006639Preselin/SPP
IPR007369Peptidase_A22B_SPP
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006639Presenilin/signal peptide peptidaseSMARTSM00730psh_8coord: 219..525
e-value: 1.4E-4
score: 22.5
IPR007369Peptidase A22B, signal peptide peptidasePFAMPF04258Peptidase_A22Bcoord: 228..535
e-value: 9.9E-34
score: 117.2
IPR007369Peptidase A22B, signal peptide peptidasePANTHERPTHR12174SIGNAL PEPTIDE PEPTIDASEcoord: 94..535
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.868
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 446..468
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 322..344
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
NoneNo IPR availableTMHMMTMhelixcoord: 478..500
NoneNo IPR availableTMHMMTMhelixcoord: 507..529