Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30032861
Length (bp)2926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30032861) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30032861) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30032861) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30032861) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032861

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30032861SMESG000056716.1 dd_Smed_v4_8986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032861SMESG000056716.1 dd_Smed_v4_8986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 173.711 bits (439), Expect = 8.409e-44
Identity = 137/517 (26.50%), Postives = 239/517 (46.23%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D   +MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +        T +     W+    +  +       LAK+IC+     LN  H+ F  +L +        +  +E +  ++  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      I + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  395 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDATNMEF-KDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLE-----WKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWD 890          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 126.331 bits (316), Expect = 5.955e-29
Identity = 121/516 (23.45%), Postives = 216/516 (41.86%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D   +MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +        T +     W+    +  +       LAK+IC+     LN  H+ F  +L +        +  +E +  ++  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      I + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+                                                   RPERL    +  W LM  CWD
Sbjct:  395 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDATNMEF-KDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLE-----WKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-----------------------------------------------TGARPERLPVFDEECWQLMEACWD 845          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K12 (mitogen-activated protein kinase kinase kinase 12 [Source:HGNC Symbol;Acc:HGNC:6851])

HSP 1 Score: 98.9821 bits (245), Expect = 2.398e-21
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  129 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 348          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K12 (mitogen-activated protein kinase kinase kinase 12 [Source:HGNC Symbol;Acc:HGNC:6851])

HSP 1 Score: 97.4413 bits (241), Expect = 6.959e-20
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  162 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 381          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K12 (mitogen-activated protein kinase kinase kinase 12 [Source:HGNC Symbol;Acc:HGNC:6851])

HSP 1 Score: 97.4413 bits (241), Expect = 6.959e-20
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  162 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 381          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: ZK622.1 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q23554])

HSP 1 Score: 89.7373 bits (221), Expect = 1.523e-18
Identity = 77/315 (24.44%), Postives = 150/315 (47.62%), Query Frame = 3
Query: 1917 LNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVE-KEMIGQGSQGTVYRCV--CNG-KEYAKKKI------IVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK--KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA-------LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWDQ 2804
            L  K D  ++  E++F+ +   +++  T+R K    +++   LL+  ++ Q   L  D ++  +M+G+G+ G VY+    C G K     K+      I    ++E + +E      ++HPN++    V V        +E++    L     ++++K  KN ++L  +LK S + +  L+Y+H    +HRD+   N L+  +N V + D+G  K L+       L +         +APE++  + Y  K D+YSFG+LLW +      P  +   +   VK  ++   +   P+R+     N+  ++++CW Q
Sbjct:   82 LQEKEDGSIVIEERKFESV---LDMVTTLRMKRLPVSANCPALLLNPINKQDWELRHDQIKLGKMLGEGAFGGVYKAAFYCKGEKRMVAVKVNKGNEKISTRAMIEDVCKEARIMRQYQHPNVVCFFGVCVEKEPIMLVMELASQGAL-----DSFLKNEKNNVSLRDKLKYSFDASKGLEYLHQHGCIHRDVAARNFLM-HKNVVKITDFGLSKQLSDLAHKYKLKDIQAKLPIRWLAPEVIVTATYTFKSDVYSFGILLWEIFMDGAIP--YPGMKLAEVKQKVKNGYRMDAPDRMPAFVRNI--MISQCWPQ 383          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 91.6633 bits (226), Expect = 1.582e-18
Identity = 63/241 (26.14%), Postives = 120/241 (49.79%), Query Frame = 3
Query: 2109 IGQGSQGTVYRCVCNGKEYAKKKII---VPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK--KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTF-----VHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLW-DLMNECW 2798
            IGQG  G VY+ + +  +  ++K++   +    +    EE      F+HPN+L LI V ++D+     I I+ Y  + K DL+++++  +N + +    + + ++A  + Y+H++  +HRDL   N LLDE   V +AD+G C+ + +    +V        V   P  + +  +    DI+SFG+++W L      P  ++N  S  + +     ++  R  +    P+ L+ D+M  CW
Sbjct:  741 IGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHLPII-ITEY--MAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFTRGSTP--YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACW 976          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 91.6633 bits (226), Expect = 1.750e-18
Identity = 63/241 (26.14%), Postives = 120/241 (49.79%), Query Frame = 3
Query: 2109 IGQGSQGTVYRCVCNGKEYAKKKII---VPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK--KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTF-----VHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLW-DLMNECW 2798
            IGQG  G VY+ + +  +  ++K++   +    +    EE      F+HPN+L LI V ++D+     I I+ Y  + K DL+++++  +N + +    + + ++A  + Y+H++  +HRDL   N LLDE   V +AD+G C+ + +    +V        V   P  + +  +    DI+SFG+++W L      P  ++N  S  + +     ++  R  +    P+ L+ D+M  CW
Sbjct:  741 IGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHLPII-ITEY--MAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFTRGSTP--YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACW 976          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 91.6633 bits (226), Expect = 1.750e-18
Identity = 63/241 (26.14%), Postives = 120/241 (49.79%), Query Frame = 3
Query: 2109 IGQGSQGTVYRCVCNGKEYAKKKII---VPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK--KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTF-----VHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLW-DLMNECW 2798
            IGQG  G VY+ + +  +  ++K++   +    +    EE      F+HPN+L LI V ++D+     I I+ Y  + K DL+++++  +N + +    + + ++A  + Y+H++  +HRDL   N LLDE   V +AD+G C+ + +    +V        V   P  + +  +    DI+SFG+++W L      P  ++N  S  + +     ++  R  +    P+ L+ D+M  CW
Sbjct:  741 IGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHLPII-ITEY--MAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFTRGSTP--YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACW 976          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 91.2781 bits (225), Expect = 1.965e-18
Identity = 63/241 (26.14%), Postives = 120/241 (49.79%), Query Frame = 3
Query: 2109 IGQGSQGTVYRCVCNGKEYAKKKII---VPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK--KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTF-----VHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLW-DLMNECW 2798
            IGQG  G VY+ + +  +  ++K++   +    +    EE      F+HPN+L LI V ++D+     I I+ Y  + K DL+++++  +N + +    + + ++A  + Y+H++  +HRDL   N LLDE   V +AD+G C+ + +    +V        V   P  + +  +    DI+SFG+++W L      P  ++N  S  + +     ++  R  +    P+ L+ D+M  CW
Sbjct:  741 IGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHLPII-ITEY--MAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFTRGSTP--YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACW 976          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 95.9005 bits (237), Expect = 1.636e-20
Identity = 75/254 (29.53%), Postives = 129/254 (50.79%), Query Frame = 3
Query: 2100 KEMIGQGSQGTVYRCVC--NGKEYAKKKIIV----------PTDLLETISEEVY-YSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLK-ISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSN--YSFVGTFVHIAPEIVR------QSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            KE++G+G   TV RC+    GKE+A K I +          P  +LE   +E+     +  HP ++ L  V  +D   F   E+       K +L +Y+   +   E++ + I  ++   ++YIH ++I+HRDLK  NILLDE +NV + D+GF K L       +  GT  ++APE ++         Y Q++DI++ G++++ L  G C PP +   Q   ++ ++E       PE   +I ++  DL+ +C
Sbjct:   26 KEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELC-----PKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVG-C-PPFWHRKQMVMLRNIMEGKYSFTSPE-WADISEDPKDLIRKC 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 95.9005 bits (237), Expect = 1.636e-20
Identity = 75/254 (29.53%), Postives = 129/254 (50.79%), Query Frame = 3
Query: 2100 KEMIGQGSQGTVYRCVC--NGKEYAKKKIIV----------PTDLLETISEEVY-YSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLK-ISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSN--YSFVGTFVHIAPEIVR------QSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            KE++G+G   TV RC+    GKE+A K I +          P  +LE   +E+     +  HP ++ L  V  +D   F   E+       K +L +Y+   +   E++ + I  ++   ++YIH ++I+HRDLK  NILLDE +NV + D+GF K L       +  GT  ++APE ++         Y Q++DI++ G++++ L  G C PP +   Q   ++ ++E       PE   +I ++  DL+ +C
Sbjct:   26 KEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELC-----PKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVG-C-PPFWHRKQMVMLRNIMEGKYSFTSPE-WADISEDPKDLIRKC 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 95.5153 bits (236), Expect = 1.722e-20
Identity = 75/254 (29.53%), Postives = 129/254 (50.79%), Query Frame = 3
Query: 2100 KEMIGQGSQGTVYRCVC--NGKEYAKKKIIV----------PTDLLETISEEVY-YSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLK-ISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSN--YSFVGTFVHIAPEIVR------QSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            KE++G+G   TV RC+    GKE+A K I +          P  +LE   +E+     +  HP ++ L  V  +D   F   E+       K +L +Y+   +   E++ + I  ++   ++YIH ++I+HRDLK  NILLDE +NV + D+GF K L       +  GT  ++APE ++         Y Q++DI++ G++++ L  G C PP +   Q   ++ ++E       PE   +I ++  DL+ +C
Sbjct:   26 KEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELC-----PKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVG-C-PPFWHRKQMVMLRNIMEGKYSFTSPE-WADISEDPKDLIRKC 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 94.7449 bits (234), Expect = 1.605e-19
Identity = 53/134 (39.55%), Postives = 78/134 (58.21%), Query Frame = 3
Query: 2403 EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNY---SFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            EV   L Y+H++  +HRD+K AN+LL EQ +V LAD+G    L  +     +FVGT   +APE+++QS+YD K DI+S G+    LAKG  EPP   N +   ++VL  +  KN  P+  G+   +  D +  C
Sbjct:  116 EVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKG--EPP---NSELHPMRVLFLIP-KNNPPQLTGSYTKSFKDFVEAC 243          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301501)

HSP 1 Score: 94.3597 bits (233), Expect = 1.625e-19
Identity = 77/256 (30.08%), Postives = 131/256 (51.17%), Query Frame = 3
Query: 2100 KEMIGQGSQGTVYRCVC--NGKEYAKKKIIV----------PTDLLETISEEVY-YSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLK-ISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA----LSNYSFVGTFVHIAPEIVR------QSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            KE++G+G   TV RC+    GKE+A K I +          P  +LE   +E+     +  HP ++ L  V  +D   F   E+       K +L +Y+   +   E++ + I  ++   ++YIH ++I+HRDLK  NILLDE +NV + D+GF K L     L+N    GT  ++APE ++         Y Q++DI++ G++++ L  G C PP +   Q   ++ ++E       PE   +I ++  DL+ +C
Sbjct:   26 KEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFEL-----CPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTN--LCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVG-C-PPFWHRKQMVMLRNIMEGKYSFTSPE-WADISEDPKDLIRKC 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 154.836 bits (390), Expect = 5.373e-38
Identity = 135/536 (25.19%), Postives = 243/536 (45.34%), Query Frame = 3
Query: 1254 VDFTNENLDEIF-TMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLM------KDSVEKEMIGQGSQGTVYRC-VCNGKEYAKKKIIVPTD--LLETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            +++T E   E+F ++  +  R   ++K  I  +   + ++L++   N           ++F   I+    +  + K+ K C   I DLI   L+  + N       ++++     LE C  +      + K    SC  +  S +   L++ L   Y  ++      + +   W  +K II  +   +    T +     W+    +  +       LAK+IC+     LN  H+ F  +L +  +     +  +E +  ++  + +      +  L L+S+ L       K  + +E+ G+G  G VY C    G+     K +VP D      ++ E +Y+  L +H  L+ L    ++ +      I + +    +  DL   +K   L+L+++L I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WYL  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  351 LEYTREKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQN-----------LDFTDIIMSSNGEPVSSKDIKVCISQIQDLIVNRLNQAVANKLTNSVDYLRESFVGTLERCLGS------LEKSTPESCAHNVTSNH---LKQILNAAYHVEVTFHSGSSVTRLFWEQIKQIIHRITWVNPPAITAE-----WKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAP----RLARLSLESRSLRDILLHGKPKLGREL-GRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHGSVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAG-LSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASK--DQLWTNVKKGCRPERLPVFDEECWQLMEACWN 852          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 148.673 bits (374), Expect = 3.702e-36
Identity = 99/319 (31.03%), Postives = 163/319 (51.10%), Query Frame = 3
Query: 1881 LAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLM------KDSVEKEMIGQGSQGTVYRC-VCNGKEYAKKKIIVPTD--LLETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            LAK+IC+     LN  H+ F  +L +  +     +  +E +  ++  + +      +  L L+S+ L       K  + +E+ G+G  G VY C    G+     K +VP D      ++ E +Y+  L +H  L+ L    ++ +      I + +    +  DL   +K   L+L+++L I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WYL  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  515 LAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPR----LARLSLESRSLRDILLHGKPKLGREL-GRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHGSVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAG-LSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASK--DQLWTNVKKGCRPERLPVFDEECWQLMEACWN 824          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mos (v-mos Moloney murine sarcoma viral oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040428-3])

HSP 1 Score: 97.4413 bits (241), Expect = 2.431e-21
Identity = 80/259 (30.89%), Postives = 127/259 (49.03%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYL----FEHPNLLPLIAVTV--------NDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYS--------FVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGN------IPDNLWDLMNECWD 2801
            E IG G  GTV+R    G+  A KK+    + L   S + +++ L      H N++ ++A T          DNI    +E +    L K+    Y   ++L +E+ +K S+++A AL+++H   ++H DLK AN+LL EQ    +AD+G C S  +S+ S          GTF H APE+++  +   ++D+YSFG+ +W L     EPP   + Q     +L  V   N+RP    N      I      L++ CWD
Sbjct:   64 EPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLA--SRQSFWAELNAAHLHHQNIVRVLAATTCTPAHLNTKDNIGTIVMEFAGNINLQKLI---YGLTDLLPVEKCIKYSIDIARALQHLHAHGVVHLDLKPANVLLSEQGVCKIADFG-C-SFKISSTSDTVTHMNEIGGTFTHRAPELLKGEEVSPRVDVYSFGITMWQLLTR--EPPYEGDRQ----YILYAVVAYNLRPSTSRNVFTQSSIGQTCQKLISRCWD 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mos (v-mos Moloney murine sarcoma viral oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040428-3])

HSP 1 Score: 97.4413 bits (241), Expect = 2.431e-21
Identity = 80/259 (30.89%), Postives = 127/259 (49.03%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYL----FEHPNLLPLIAVTV--------NDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYS--------FVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGN------IPDNLWDLMNECWD 2801
            E IG G  GTV+R    G+  A KK+    + L   S + +++ L      H N++ ++A T          DNI    +E +    L K+    Y   ++L +E+ +K S+++A AL+++H   ++H DLK AN+LL EQ    +AD+G C S  +S+ S          GTF H APE+++  +   ++D+YSFG+ +W L     EPP   + Q     +L  V   N+RP    N      I      L++ CWD
Sbjct:   64 EPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLA--SRQSFWAELNAAHLHHQNIVRVLAATTCTPAHLNTKDNIGTIVMEFAGNINLQKLI---YGLTDLLPVEKCIKYSIDIARALQHLHAHGVVHLDLKPANVLLSEQGVCKIADFG-C-SFKISSTSDTVTHMNEIGGTFTHRAPELLKGEEVSPRVDVYSFGITMWQLLTR--EPPYEGDRQ----YILYAVVAYNLRPSTSRNVFTQSSIGQTCQKLISRCWD 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: mos (v-mos Moloney murine sarcoma viral oncogene homolog [Source:ZFIN;Acc:ZDB-GENE-040428-3])

HSP 1 Score: 97.4413 bits (241), Expect = 2.431e-21
Identity = 80/259 (30.89%), Postives = 127/259 (49.03%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYL----FEHPNLLPLIAVTV--------NDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYS--------FVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGN------IPDNLWDLMNECWD 2801
            E IG G  GTV+R    G+  A KK+    + L   S + +++ L      H N++ ++A T          DNI    +E +    L K+    Y   ++L +E+ +K S+++A AL+++H   ++H DLK AN+LL EQ    +AD+G C S  +S+ S          GTF H APE+++  +   ++D+YSFG+ +W L     EPP   + Q     +L  V   N+RP    N      I      L++ CWD
Sbjct:   64 EPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLA--SRQSFWAELNAAHLHHQNIVRVLAATTCTPAHLNTKDNIGTIVMEFAGNINLQKLI---YGLTDLLPVEKCIKYSIDIARALQHLHAHGVVHLDLKPANVLLSEQGVCKIADFG-C-SFKISSTSDTVTHMNEIGGTFTHRAPELLKGEEVSPRVDVYSFGITMWQLLTR--EPPYEGDRQ----YILYAVVAYNLRPSTSRNVFTQSSIGQTCQKLISRCWD 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 151.369 bits (381), Expect = 7.182e-37
Identity = 135/521 (25.91%), Postives = 240/521 (46.07%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKV-----IQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L+  L    +  +  L D +++ L++  + +++  A+M+F K I IP+N +  + +  K C   I +LI   L+  + N       ++++     LE C  +     +    +  S  +++       L++ L   Y  ++        +  +W  +  II  +  + +S  T    +  W+    +  +       LAK+IC+     L   H+ F  +L K+ +V     ++K  +L   +R    +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ +      I + + T  +  DL   +K   L+LE +L+I+L+V   ++++HNQ ++HRD+KL N+LLD+++   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  327 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQF-KDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRS-----LEKSQQESSSHVTSNH-----LKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRI--TWVSPPTI---TPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASL-KQLEVGHSGRLEKTNDLWLRVR---KDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTG-LSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWN 823          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 151.369 bits (381), Expect = 7.881e-37
Identity = 135/521 (25.91%), Postives = 240/521 (46.07%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKV-----IQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRF-DCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L+  L    +  +  L D +++ L++  + +++  A+M+F K I IP+N +  + +  K C   I +LI   L+  + N       ++++     LE C  +     +    +  S  +++       L++ L   Y  ++        +  +W  +  II  +  + +S  T    +  W+    +  +       LAK+IC+     L   H+ F  +L K+ +V     ++K  +L   +R    +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ +      I + + T  +  DL   +K   L+LE +L+I+L+V   ++++HNQ ++HRD+KL N+LLD+++   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  306 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQF-KDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRS-----LEKSQQESSSHVTSNH-----LKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRI--TWVSPPTI---TPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASL-KQLEVGHSGRLEKTNDLWLRVR---KDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTG-LSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWN 802          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 151.754 bits (382), Expect = 8.172e-37
Identity = 135/521 (25.91%), Postives = 240/521 (46.07%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKV-----IQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L+  L    +  +  L D +++ L++  + +++  A+M+F K I IP+N +  + +  K C   I +LI   L+  + N       ++++     LE C  +     +    +  S  +++       L++ L   Y  ++        +  +W  +  II  +  + +S  T    +  W+    +  +       LAK+IC+     L   H+ F  +L K+ +V     ++K  +L   +R    +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ +      I + + T  +  DL   +K   L+LE +L+I+L+V   ++++HNQ ++HRD+KL N+LLD+++   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  390 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQF-KDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRS-----LEKSQQESSSHVTSNH-----LKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRI--TWVSPPTI---TPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASL-KQLEVGHSGRLEKTNDLWLRVR---KDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTG-LSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWN 886          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 151.369 bits (381), Expect = 8.938e-37
Identity = 135/521 (25.91%), Postives = 240/521 (46.07%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKV-----IQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L+  L    +  +  L D +++ L++  + +++  A+M+F K I IP+N +  + +  K C   I +LI   L+  + N       ++++     LE C  +     +    +  S  +++       L++ L   Y  ++        +  +W  +  II  +  + +S  T    +  W+    +  +       LAK+IC+     L   H+ F  +L K+ +V     ++K  +L   +R    +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ +      I + + T  +  DL   +K   L+LE +L+I+L+V   ++++HNQ ++HRD+KL N+LLD+++   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  391 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQF-KDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRS-----LEKSQQESSSHVTSNH-----LKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRI--TWVSPPTI---TPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASL-KQLEVGHSGRLEKTNDLWLRVR---KDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTG-LSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWN 887          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 151.369 bits (381), Expect = 9.096e-37
Identity = 135/521 (25.91%), Postives = 240/521 (46.07%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKV-----IQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L+  L    +  +  L D +++ L++  + +++  A+M+F K I IP+N +  + +  K C   I +LI   L+  + N       ++++     LE C  +     +    +  S  +++       L++ L   Y  ++        +  +W  +  II  +  + +S  T    +  W+    +  +       LAK+IC+     L   H+ F  +L K+ +V     ++K  +L   +R    +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ +      I + + T  +  DL   +K   L+LE +L+I+L+V   ++++HNQ ++HRD+KL N+LLD+++   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     K  RPERL    +  W LM  CW+
Sbjct:  374 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQF-KDIAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDYLRESFVGTLERCLRS-----LEKSQQESSSHVTSNH-----LKQILNAAYHVEVTFNSGSTVTRMVWEQIVQIIQRI--TWVSPPTI---TPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASL-KQLEVGHSGRLEKTNDLWLRVR---KDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYSYGGGSSIAVLLITERLHRDLYVGLKTG-LSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWN 870          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 176.407 bits (446), Expect = 9.450e-45
Identity = 138/517 (26.69%), Postives = 242/517 (46.81%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D  A+MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  ++      LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      + + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEF-KDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLE-----WKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWD 888          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 129.798 bits (325), Expect = 3.524e-30
Identity = 122/516 (23.64%), Postives = 219/516 (42.44%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D  A+MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  ++      LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      + + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+                                                   RPERL    +  W LM  CWD
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEF-KDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLE-----WKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-----------------------------------------------TGTRPERLPVFDEECWQLMEACWD 843          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:MGI Symbol;Acc:MGI:1346881])

HSP 1 Score: 97.0561 bits (240), Expect = 5.097e-20
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  162 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 381          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:MGI Symbol;Acc:MGI:1346881])

HSP 1 Score: 97.0561 bits (240), Expect = 5.097e-20
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  162 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 381          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:MGI Symbol;Acc:MGI:1346881])

HSP 1 Score: 97.0561 bits (240), Expect = 5.097e-20
Identity = 65/240 (27.08%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYM-----KKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    DL ET   ++ +    +HPN++    V         C +   Y  LM+   +  +         +T    +  S+ +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + PD    L+ +CW+
Sbjct:  162 QWVGSGAQGAVFLGRFHGEEVAVKKV---RDLKET---DIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YKDVDSSA--IIWGVGSNSLHLPVPSSCPDGFKILLRQCWN 381          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX0|DUSTY_CHICK (Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus OX=9031 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 9.626e-45
Identity = 160/581 (27.54%), Postives = 265/581 (45.61%), Query Frame = 3
Query: 1152 LLENFEREILT-----ATKSLIDFQMDVLTKIISRA---KQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENC-------FEAHLSP-KIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEY-AKKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            LL  F R++L      A  SL +     L   I++A   ++ +  T + L+  +T RK E  L+  L +  N  +  + D +++ L N  + +++  A+MEF K IIIPEN +  + K+ K C K I +LI   L+  + N       ++++     LE C       +E  + P + + K K  S  +++       L++ L   Y  ++        +  +W  +K II  +        T D     W+    +  +       LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L         +G+G  G VY C   G  +    K +VP D      ++ E +Y   L  H  L+ L    ++        I + +    +  DL   +K   L LE +L+I+L+V   ++Y+H+Q ++HRD+KL N+LLD++N   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     + VRPERL    +  W LM  CWD
Sbjct:  329 LLSTFSRQVLQKHLVEAATSLNEVHCRCLNIFINQAFDMQRDLQITPKRLE--YTRRK-ENELYESLMNIANRKQEEMKDMIIETLSNMKEELLEDAANMEF-KDIIIPENGEPVSSKDIKCCIKQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLKSLEESWEVSVHPARSLEKSKDVSVHITSNY-----LKQILNAAYHVEVTFHSGSTVTRMLWEQIKQIIQRITWVSPPAITSD-----WKRKVAQDAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEDGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHGKPKLGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLQSHERLVDLHGSVIDYGYGGGSSIAVLLIMERLHRDLYTGLKAG-LELETRLQIALDVVEGIRYLHSQGLVHRDIKLKNVLLDKKNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGHVKLPEAFERCASK--DHLWNNVRRGVRPERLPVFDEECWQLMEACWD 891          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4VSN4|DUSTY_CANLF (Dual serine/threonine and tyrosine protein kinase OS=Canis lupus familiaris OX=9615 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.575e-44
Identity = 140/517 (27.08%), Postives = 241/517 (46.62%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D + + L+     ++D  A+MEF K +I+PEN +A   +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  ++      LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      I + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  397 RKKENELYESLMNIANRKQEEMKDMICETLNTMKGELLDDAANMEF-KDVIVPENGEAVGTRELKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSIHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLE-----WKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLENTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWD 892          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20CR4|DUSTY_MACMU (Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta OX=9544 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 6.199e-44
Identity = 139/517 (26.89%), Postives = 240/517 (46.42%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D  A+MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +        T +     W+    +  +       LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      I + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  373 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEF-KDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAITLE-----WKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWD 868          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX1|DUSTY_MOUSE (Dual serine/threonine and tyrosine protein kinase OS=Mus musculus OX=10090 GN=Dstyk PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 6.610e-44
Identity = 138/517 (26.69%), Postives = 242/517 (46.81%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D  A+MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  ++      LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      + + +    +  DL   +K   LTLE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEF-KDVIVPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLE-----WKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWD 888          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX2|DUSTY_RAT (Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Dstyk PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.628e-43
Identity = 137/517 (26.50%), Postives = 242/517 (46.81%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPEN-KAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYA-KKKIIVPTD--LLETISEEVYY-SYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            RK E  L+  L +  N  +  + D +++ L+   + ++D  A+MEF K +I+PEN +    +  K C + I +LI   L+  + N       ++++     LE C ++      + K +  S  +++       L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  ++      LAK+IC+     LN  H+ F  +L +        +  +E +  K+  +       L + +  LQ   L +     + +G+G  G VY C   G  +    K +VP D      ++ E +Y   L +H  L+ L    ++ N      + + +    +  DL   +K   L+LE +L+I+L+V   ++++H+Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WY+  G  + P  F  C S     L     +  RPERL    +  W LM  CWD
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEF-KDVIVPENGETVGTREIKSCIRQIQELIISRLNQAVANKLISSVDYLRESFVGTLERCLQS------LEKSQDVSVHITSNY-----LKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVNPPTITLE-----WKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LSLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWD 888          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FLZ4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023032g1 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 8.006e-89
Identity = 247/834 (29.62%), Postives = 419/834 (50.24%), Query Frame = 3
Query:  393 PTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVN-IHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKT-AKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNK----IKSQETD------FHNEQFC-KFESDLNRIL---LENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAH-LSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWN---FLKNIIT--GLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKD-SVEKEM-IGQGSQGTVYRCVCNGKE--YAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVN----DNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQ-NNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEP-PLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            P I IVG  K+GKS+ +N LL    V Q+   CTAR+TR+TYS+  YV + +   +QI + + L+   I + +V+L DEDR N + ++  +  GIK +FL+ GID+IDSPGLNEN  L+ L    I+  LP++IYVID  + +      ++ ++K ++    + Y +T++D    +E   N   +   ++K +  F KLQR   I       + C+ F   S +    +  K    IK  + D        N ++  +FE    RIL    + F   I+ +   L+  Q ++LT  + RA    + +N   + ++ ++ +E+  +   KS +  ++  L+ +          LI+D +  +++ +S+I          +A   QK I      ++  LI+    D +  +  + F+ H L    +  L     +  N +P    L++ +   Y   L  LK+    F I+    F+  I+T  GL  S     +  I    W+  Q +  L   +K++L + +   +   L  +H  FL N+    ++++  + L+E  R +I +       L M T+D+ SKY  +   ++ E  +G G+QG V+R +    E   A K+I+     L+ I+ EVY+S + EH NL+ ++ V ++    D  R+    + IY  LM  D  N M+++ L + Q+LKI LE+A AL+++H+  ++HRDLKLAN+L+ E    V L+D+G  KS    N + VGT +++APE+VR   Y    D++S G+ LWYL +G  +  P +     +   +LL  +  + RP RL N+ D LWDLM  CW
Sbjct:   85 PCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITIAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANQPAQEIEEEKAERVFSKLQRLGYISPNETRDT-CNKFLCVSCWKVRGFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVRSGDELMHIQSEILTLFMDRATNIKE-SNLRKEALYQIKSLEQETYQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVI----------SADMSQKDIEKKCVDEIHALIN----DRIIASFFDFFKNHGLKGFDLKNLMAELEKDVNPTPAYQVLKKTMLMSYSVSLEELKLSCLGFIIFKIKFFVIKIVTKPGLVFS----TSTPIQDPKWKKYQAEKYLEAINKNILVERLITWLKEWLEKQHREFLDNIASSEQLVESGMKLTEEERSEIKSLFPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKPDEKRWT---VEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDLKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILL-ASALDCRPTRLPNMSDQLWDLMESCW 894          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FM29 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021056g2 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.199e-86
Identity = 247/834 (29.62%), Postives = 417/834 (50.00%), Query Frame = 3
Query:  393 PTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVN-IHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLD-TDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSE-CHNFHGASLYSYMDYCNK----IKSQETD------FHNEQFC-KFESDLNRIL---LENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKY---DLLGLKIKNSSFSIWNFLKNII--TGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKD-SVEKEM-IGQGSQGTVYRCVCNGKE--YAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVN----DNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQ-NNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEP-PLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            P I IVG  K+GKS+ +N LL    V Q+   CTAR+TR+TYS+  YV + +   +QI + + L+   I + +V+L DEDR N + ++  +  GIK +FL+ GID+IDSPGLNEN  L+ L    I+  LP++IYVID  + +      ++ ++K ++    + Y +T++D + D  +       +  ++K +  F KLQR   I  + N   E C+ F   S +    +  K    IK  + D        N ++  +FE    RIL    + F   I+++   L   Q ++LT  + +A    +        ++ ++ +E+ +H   KS +  ++  L+ +          LI+D +  +++ +S+I  +     K   K C   I  LI    D +I +F     +  L  C +     K   K+  Y   +     Y++ L++ L + Y     D L   +    F I +F++ ++   GL    LS  T  I  + W+  Q +  L    K+ L + +  ++      +H  FL N+    ++++  + L+E  R +I         L M T+D+ SKY  +   ++ E  +G G+QG V+R +    E   A K+I+     L+ I+ EVY+S + EH NL+ ++ V ++    D  R+    + IY  LM  D  N M+++ L + Q+LKI LE+A AL+++H+  ++HRD+KLAN+L+ E    V L+D+G  KS    N + VGT +++APE+VR   Y    D++S G+ LWYL +G  +  P +     +   +LL     + RP RL N+ D LWDLM  CW
Sbjct:   85 PCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYI--SPNETKEKCNKFLCVSCWEVRRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVISADMS--QKDIEKKCVDEIHALIN---DRIIASFCDFLKDGALRLCLQEFDDLK--QKVAEYEKDVEQTPAYQV-LKKTLLEGYSLSSKDFLLGPLNVIIFRIKHFVRQMVRNPGLV---LSIST-PIQDQKWKEYQAEKYLGTISKENLVECLITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKPDEKRWT---VEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILL-AGALDCRPTRLPNMSDQLWDLMESCW 900          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FZS1 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014911g1 PE=4 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 4.676e-85
Identity = 234/843 (27.76%), Postives = 413/843 (48.99%), Query Frame = 3
Query:  390 NPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVN-IHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLD-TDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKI----------KSQET----------DFHNEQFCK-FESDLNRIL---LENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKN-AKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSN-DTF---DINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSV--EKEMIGQGSQGTVYRCVCNGKE--YAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVY-LADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWDQ 2804
             P I I G  K+GKS+ +N LL    V Q+   CTAR+TR+TYS+  YV + +   +QI + + L+   I + +V+L DEDR N + ++  +  GIK +FL+ GID+IDSPGLNEN  L+ L    I+  LP++IYVID  + V      ++ +++ +     I+Y IT++D  D ++  +  +  +   +K D  F KLQR   I K     S C  F   S +    +  K           K+ E+          +  N ++ + FE    RIL    + F+  I+ A  SL      +LT  + +A    +        ++ ++ +E  +H   KS +   +   + +  +    +  LI+D +  M +  S+I   ++  ++++  K C + I  LI   +     +F++D +   L  CF      K   K+  Y   +     Y++ L++ L +   Y L    I   S +   F++NI + L R+ L + D F    +    W+  Q    L   D++ L   + +++    + +H  FL ++     +++K   +++  R +I   +    LL M    + ++Y  ++        +G G+QG VY  +    E   A KKI+     LE I+ E YYS + EHPN++ ++   + +N + +    + +Y  LM  D    M++  L+L ++L + L+++ AL+++H+  ++HRD+KLAN+L++ +  V  L+D+G  K   L  ++ VGT ++++PE+VR+  Y    DI+S G+ LWYL +G  +  P +     T  +VL   + +  RP RL    D LW LM  CWD+
Sbjct:  100 RPCIIIAGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGVTVAVQKDLQTIQKTASGAEILYLITKMDVADHLAAEMGREVAEMEAEKADHVFSKLQRLGYISKDATRQS-CRKFLCVSCWEVRRFRRKKEMIEKKMKKSKTAESGEKLMSDLVKEMENSKWVRQFEEVKRRILQFAQDQFKNLIVGAGSSLRAVHCQILTMFMDKAHDIKESNQRKKKALYQIKSLEHEIHQQSKSIVERHRGEFLAQANRFFAEKKPLILDEVRSMSYSDSVI---SEGMSQRDIEKKCIEEIHTLINDRIIATFSDFLRDNV---LRTCFTDFDDLK--EKVAEYEKDVEQTPAYQV-LKKTLLE--GYSLSSKAIVRGSVTC--FIRNIGSTL-RALLKHPDIFLGKAVQHHKWKEHQASQYLKNIDREKLVACLVSSIGEWFDKRHSDFLHSMSYSEVLVEKSYRMTDRERKEIIKLSPIVALLHMNAFAIITRYKFRNHRLDLDNCLGSGAQGRVYTVLSPTGEPVMAAKKIVTNRAGLEEIAAEAYYSSVLEHPNIVRVVGTVLLENAKHNGQWSVELYMELMHCDALTLMEQQRLSLAKRLWLGLQISKALEFLHSSQLIHRDVKLANLLVNSEATVAKLSDFGLLKGQGLVGHTLVGTPIYLSPELVRRENYGVSTDIFSLGIALWYLVEGSGQHHPDYVTNLKTVEEVLAATSERGCRPNRLPEASDQLWQLMVRCWDE 927          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8HCU5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 8.099e-85
Identity = 237/830 (28.55%), Postives = 413/830 (49.76%), Query Frame = 3
Query:  393 PTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVN-IHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLD-TDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNK----IKSQETD------FHNEQFCK-FESDLNRIL---LENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYD--LLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKD-SVEKEM-IGQGSQGTVYRCVCNGKE--YAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVN----DNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQ-NNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEP-PLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            P I IVG  K+GKS+ +N LL    V Q+   CTAR+TR+TYS+  YV + +   +QI + + L+   I + +V+L DEDR N + ++  +  GIK +FL+ GID+IDSPGLNEN  L+ L    I+  LP++IYVID  + +      ++ ++K ++    + Y +T++D + D  +       +  ++K +  F KLQR   I        +C+ F   S +    +  K    IK  + D        N ++ + FE    RIL    + F   I+++   L   Q ++LT  + +A    +        ++ ++ +E+ +H   KS +  ++  L+ +          LI+D +  +++ +S+I          +A   QK I      ++  LI++ +   + + L   + + + P  I +LK  S              R + K    D  + G+K +++S  +   +K ++ G F      + ++I  + +R     I      K+ L + +  ++      +H  FL N+    ++++  + L+E  R +I         L M T+D+ SKY  +   ++ E  +G G+QG V+R +    E   A K+I+     L+ I+ EVY+S + EH NL+ ++ V ++    D  R+    + IY  LM  D  N M+++ L + Q+LKI LE+A AL+++H+  ++HRD+KLAN+L+ E    V L+D+G  KS    N + VGT +++APE+VR   Y    D++S G+ LWYL +G  +  P +     +   +LL     + RP RL N+ D LWDLM  CW
Sbjct:   85 PCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYISPNETR-DKCNKFLCVSCWEVRRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVI----------SADMSQKDIEKKCVDEIHALINDRINCVILR-LPQRWGSEIVPTGIRRLKAES--------------RRVRKGCGTDARVPGVK-EDASRRLLVVVKGLLIGSF------ECYNIQDKAFRETDGTI-----SKENLVECLITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKPDEKRWT---VEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILL-AGALDCRPTRLPNMSDQLWDLMESCW 872          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8G8Z8 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.612e-82
Identity = 235/834 (28.18%), Postives = 404/834 (48.44%), Query Frame = 3
Query:  393 PTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVN-IHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLD-TDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSE-CHNFHGASLYSYMDYCNK----IKSQETD------FHNEQFCK-FESDLNRIL---LENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSI-----WNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKD-SVEKEM-IGQGSQGTVYRCVCNGKE--YAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVN----DNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQ-NNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEP-PLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            P I IVG  K+GKS+ +N LL    V Q+   CTAR+TR+TYS+  YV + +   +QI + + L+   I + +V+L DEDR N + ++  +  GIK +FL+ GID+IDSPGLNEN  L+ L    I+  LP++IYVID  + +      ++ ++K ++    + Y +T++D + D  +       +  ++K +  F KLQR   I  + N   E C+ F   S +    +  K    IK  + D        N ++ + FE    RIL    + F   I+++   L   Q ++LT  + +A    +        ++ ++ +E+ +H   KS +  ++  L+ +          LI+D +  +++ +S+I          +A   QK I      ++  LI++                    +II       C        RLCL+       ++D L  K+      +     +  LK  +          + + ++S+ +       +L    K+ L + +  ++      +H  FL N+    ++++  + L+E  R +I         L M T+D+ SKY  +   ++ E  +G G+QG V+R +    E   A K+I+     L+ I+ EVY+S + EH NL+ ++ V ++    D  R+    + IY  LM  D  N M+++ L + Q+LKI LE+A AL+++H+  ++HRD+KLAN+L+ E    V L+D+G  KS    N + VGT +++APE+VR   Y    D++S G+ LWYL +G  +  P +     +   +LL     + RP RL N+ D LWDLM  CW
Sbjct:   85 PCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYI--SPNETKEKCNKFLCVSCWEVRRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVI----------SADMSQKDIEKKCVDEIHALIND--------------------RIIASF----CDFLKDGALRLCLQ-------EFDDLKQKVAEYEKDVEQTPAYQVLKKTLL---------EGYSLSSKDF-------LLGTISKENLVECLITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKPDEKRWT---VEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILL-AGALDCRPTRLPNMSDQLWDLMESCW 855          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 115.931 bits (289), Expect = 6.024e-26
Identity = 132/583 (22.64%), Postives = 248/583 (42.54%), Query Frame = 3
Query: 1140 LNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVD-FTNENLD----------EIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLM------KDSVEKEMIGQGSQGTVYRCVCNGKE--YAKKKIIVPTDL-LETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMK-KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            L+R+L+  F R++LT        Q++   ++ +   + +D F N+  D           +   R+ E  L   L +  N  +  + + +++ L    + +++  A++EF   I+ P  +  T K  K C + I +LI   L+  + N       ++++     LE C  +      + K    S   +  S +   L++ L   Y  ++      + +  +W  +K II  L   +    T +     W+    +  +       LAK+IC+     LN  HD F  +L +  +     +  +E +  ++  + +      +  L L+S+ L       K  + +E+ G+G  G VY C   G++   A K ++ P D     ++ E +Y+  L +H  L+ L   +V D+       I++   + ++  + Y   K  L+L+++L+I+L+V   ++++H Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+   S                                               RPERL    +  W LM  CW+
Sbjct:  319 LHRLLVP-FARQVLTGQ------QVEAANRLNALHCRCLDLFINQAFDMQRDLQITPRRLEYTREKESELFASLMAIANRKQEEMKEMIVETLSTMKEQLLEDAANLEFTDIIVTPNGEPVTTKEIKSCIQQIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSS------LEKSTTDSSVHNVTSNH---LKQILNAAYHVEVTFHSGSSVTRLVWEQIKQIIQRLTWVNPPAITPE-----WKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHDAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPR----LARLSLESRSLRDVLLYGKPKLGREL-GRGQYGVVYLCDKWGEQNPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHG-SVIDHTYGGGSSIAVLLIMERLHRDLYTGLKAGLSLKERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGS-----------------------------------------------RPERLPTFDEECWQLMEACWN 827          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:103046562])

HSP 1 Score: 96.2857 bits (238), Expect = 7.108e-20
Identity = 68/246 (27.64%), Postives = 124/246 (50.41%), Query Frame = 3
Query: 2097 EKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISL------EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSL--ALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVR---PERLGNIPDNLWDLMNECWD 2801
            E + +G G+QG V+    +G+E A KK+    D+ ET   E+ +    +HPN++    V         C +   Y  +M+   +  + + +L   +++  SL       +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L    +  SF GT   +APE++R     +K+DI+SFG++LW +  G+     + +  S+   ++  V N +++   PE   + PD    L+ +CW+
Sbjct:  153 ELQWVGSGAQGAVFLGKFHGEEVAVKKV---RDIKET---EIKHLRKLKHPNIITFKGV---------CTQAPCYCIIMEYCAQGQLYE-VLRAGRKITPSLLVDWAMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELREKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIP---YKDVDSSA--IIWGVGNNSLQLPLPE---SCPDGFKILLKQCWN 374          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:103046562])

HSP 1 Score: 96.2857 bits (238), Expect = 7.897e-20
Identity = 66/243 (27.16%), Postives = 122/243 (50.21%), Query Frame = 3
Query: 2097 EKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISL------EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSL--ALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            E + +G G+QG V+    +G+E A KK+    D+ ET   E+ +    +HPN++    V         C +   Y  +M+   +  + + +L   +++  SL       +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L    +  SF GT   +APE++R     +K+DI+SFG++LW +  G+     + +  S+   ++  V N +++     + PD    L+ +CW+
Sbjct:  153 ELQWVGSGAQGAVFLGKFHGEEVAVKKV---RDIKET---EIKHLRKLKHPNIITFKGV---------CTQAPCYCIIMEYCAQGQLYE-VLRAGRKITPSLLVDWAMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELREKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIP---YKDVDSSA--IIWGVGNNSLQLPLPESCPDGFKILLKQCWN 374          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000008518.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:14507502:14520436:1 gene:ENSAMXG00000008289.2 transcript:ENSAMXT00000008518.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 4.945e-19
Identity = 53/134 (39.55%), Postives = 77/134 (57.46%), Query Frame = 3
Query: 2403 EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA---LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            E+   L+Y+H++  +HRD+K AN+LL EQ +V LAD+G    L    +   +FVGT   +APE+++QS YD K DI+S G+    LAKG  EPP   + +   +KVL  +  KN  P   GN    L + +  C
Sbjct:  124 EILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKG--EPP---HSELHPMKVLF-LIPKNNPPTLEGNYCKPLKEFVEAC 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 91.2781 bits (225), Expect = 5.754e-19
Identity = 50/134 (37.31%), Postives = 74/134 (55.22%), Query Frame = 3
Query: 2403 EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA---LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            E+   L Y+H++  +HRD+K AN+LL E   V LAD+G    L    +   +FVGT   +APE+++QS YD K DI+S G+    LAKG  EPP   N     ++VL  +  KN  P   G+   +  + ++ C
Sbjct:  127 EILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKRETFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKG--EPP---NSDMHPMRVLFHIP-KNTPPTLNGDFSKSFKEFVDSC 254          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.438e-19
Identity = 61/245 (24.90%), Postives = 113/245 (46.12%), Query Frame = 3
Query: 2097 EKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLE--------VANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSL--ALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            E + +G G+QG V+     G+  A KK+       E    ++ + +   HPN++    V         C     Y  +M+   +  + +    L    +IS E        +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K +    +  SF GT   +APE++R     +K+DI+SFG++LW L  G+     + +  S+   ++  V + ++      + P+    L+ +CW+
Sbjct:   16 ELQWLGSGAQGAVFLGKFRGEHVAVKKV------REQKETDIKHLHKLRHPNIITFKGV---------CTHAPCYCIIMEYCAQGQLYE---VLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIP---YRDVDSSA--IIWGVGSNSLHLPIPASCPEGFKILLTQCWN 237          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 88.9669 bits (219), Expect = 3.850e-18
Identity = 62/204 (30.39%), Postives = 110/204 (53.92%), Query Frame = 3
Query: 2103 EMIGQGSQGTVY--RCVCNGKEYAKK---KIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLK-ISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNY---SFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFAN 2687
            EMIG+GS G VY  R    G+  A K   K+      L  +  E+      +HPN++ ++     D+   D  E+ + T   + +L   ++ +    E+Q++ I+ ++ +AL Y+H+  I+HRD+K  NILL +   V L D+GF ++++++     S  GT ++++PE+V +  YD   D++S G +L+ L  G   PP + N
Sbjct:    8 EMIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKELRNLRREIDIMRGLQHPNIVQML-----DSFETD-KEVVVVTDYAEGELFQILEDDGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGT--PPFYTN 203          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 86.2705 bits (212), Expect = 5.970e-18
Identity = 56/152 (36.84%), Postives = 81/152 (53.29%), Query Frame = 3
Query: 2355 MKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLK--LANILLDEQNNVYLADYGFCKSLA---LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            +K   L   Q   I  E+   L Y+H++  +HRD+K   AN+LL EQ +V LAD+G    L    +   +FVGT   +APE+++QS YD K DI+S G+    LAKG  EPP   N +   ++VL  +  KN  P   GN      + ++ C
Sbjct:  113 IKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKG--EPP---NSELHPMRVLF-LIPKNNPPTLEGNYSKAFKEFVDSC 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 83.5741 bits (205), Expect = 7.317e-18
Identity = 59/190 (31.05%), Postives = 106/190 (55.79%), Query Frame = 3
Query: 2169 KKKIIVPTDLLE-TISEEVYYSYLFEHPNLLPLIAV-TVNDNIRFDCIEISIYTPLMKIDLENYMK-KNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNY---SFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLA------KGDCEPPLFANCQSTT 2702
            KK +++ +D +E T+ E+   S  + HP L  L +     +++ F      +   L   DL  +++ K    +++    + E+ + L+++H+Q I++RDLKL NILLD+  +V +AD+G CK   + +    +F GT  +IAPEIV   KY+  +D +SFG+LL+ +       +GD E  LF + +++ 
Sbjct:   21 KKDVVIMSDDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMF------VMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSV 204          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 83.1889 bits (204), Expect = 8.523e-18
Identity = 71/245 (28.98%), Postives = 114/245 (46.53%), Query Frame = 3
Query: 2100 KEMIGQGSQGTVYRCV--CNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKID--LENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANIL-LDEQNN---VYLADYGFCKSLALSNY-----SFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNEC 2795
            +E IG GS     RC+      EYA K II  +    +   E+   Y  +HPN++ L       ++  D   + + T LMK    L+  +++   +  +   +   +A  ++Y+H+Q ++HRDLK +NIL +DE  N   + + D+GF K L   N       +   FV  APE++++  YD   DI+S G+LL+ +  G      FAN    T  V+L            GN     WD ++E 
Sbjct:   15 REDIGVGSYSVCKRCIHKTTNMEYAVKVIIDKSKRDPSEEIEILLRY-GQHPNVITL------KDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAENGLLMTPCYTANFV--APEVLKRQGYDAACDIWSLGVLLYTMLAGHTP---FANGPDDTPGVILTRIGSGRFLLSGGN-----WDTVSEA 242          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 90.8929 bits (224), Expect = 9.665e-20
Identity = 77/274 (28.10%), Postives = 130/274 (47.45%), Query Frame = 3
Query: 2070 SKYLMKDSVEKEMIGQGSQGTVY--RCVCNGKEYA----KKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRF---DCIEISIYTPLMKIDLENYMKKNILTLEQQLKI-SLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVR---------------------PERLGNIPDNLWDLMNECW 2798
             KY ++D      +G GS G V+  R   NG+ YA    KK+I+V    +E  ++E     +  HP ++ +     +    F   D IE          +L + ++K+        K  + EV  AL+Y+H+++I++RDLK  NILLD+  ++ + D+GF K +    Y+  GT  +IAPE+V    Y++ ID +SFG+L++ +  G    P +    S T+K   ++ N  +R                      +RLGN+ +   D+ N  W
Sbjct:   80 GKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGG--------ELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYT--PFY---DSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPW 340          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 90.5077 bits (223), Expect = 1.160e-19
Identity = 81/297 (27.27%), Postives = 136/297 (45.79%), Query Frame = 3
Query: 2010 KISNETSSFTLLLMRTL----DLQSKYLMKDSVEKEMIGQGSQGTVY--RCVCNGKEYA----KKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRF---DCIEISIYTPLMKIDLENYMKKNILTLEQQLKI-SLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE--------------------PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            K+  E S+   L+ + +    D   KY + D      +G GS G V+  R   NG+ YA    KK  IV    +E  ++E     +  HP ++ +     +    F   D IE          +L + ++K+        K  + EV  AL+Y+H+++I++RDLK  NILLD+  ++ + D+GF K +    Y+  GT  +IAPE+V    Y++ +D +SFG+L++ +  G                       PP F       +K L+    +++  ERLGN+ +   D+ N  W
Sbjct:   57 KLKEEASAGICLVKKPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGG--------ELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLI---TRDLS-ERLGNLQNGSEDVKNHPW 341          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 88.9669 bits (219), Expect = 3.140e-19
Identity = 69/236 (29.24%), Postives = 116/236 (49.15%), Query Frame = 3
Query: 2043 LLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVY--RCVCNGKEYA----KKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAV---TVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKI-SLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLE 2720
            L  ++L  + KY + D      +G GS G V+  R V NG+ YA    KK+ +V    +E  ++E     L EHP L+ +        N  +  D IE          +L + ++K+        K  + EV  AL+Y+H  NI++RDLK  NILLD   ++ + D+GF K +    ++  GT  +IAPE++    Y++ +D +S G+L++ +  G    P +      T + +L+
Sbjct:   54 LPQKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGG--------ELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYT--PFYDTTPMKTYEKILQ 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 83.9593 bits (206), Expect = 6.162e-17
Identity = 42/105 (40.00%), Postives = 65/105 (61.90%), Query Frame = 3
Query: 2370 LTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA---LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPP 2675
            LT  Q   I  E    LK++H+++I+HRD+K  N+LLD +  V + D+GFC  L        + VGT   +APE+V+Q +YD+KID++S G++   + +G  EPP
Sbjct:  665 LTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEG--EPP 767          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 82.8037 bits (203), Expect = 1.020e-16
Identity = 43/101 (42.57%), Postives = 61/101 (60.40%), Query Frame = 3
Query: 2382 QQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA---LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPP 2675
            Q   I  E    LK++HN+ I+HRD+K  NILL+ Q  V + D+GFC  L        + VGT   +APEIV Q  YD+K+D++S G++L  + +G  EPP
Sbjct:  483 QMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEG--EPP 581          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW1])

HSP 1 Score: 163.31 bits (412), Expect = 3.426e-41
Identity = 165/778 (21.21%), Postives = 324/778 (41.65%), Query Frame = 3
Query:  594 IPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLD----TDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFE---------REILT-----ATKSLIDFQMDVLTKIISRA----------KQFVDFTNENLDEIF-TMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRC-VCNGKEYAKKKIIVPTD--LLETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPL-FANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            +P+  +ELNDE++++P   + +  + +    LK+G  L+ SP   E    N+  S     VLP+++Y I+ Q  +   D + +L +K   P+L I +          T+ ++E  +++ I+   +     F +L++   + +      +                  ++ +  D  N +          +L+ENF          R++L      A   + D     L+  I+ A           + +++  E  +E+F  + +   R   ++K  I ++           ++N S  I+  +  +EF       E K    K+   C   I +L+   ++  +         ++++     L+ C ++    K+ +  +  +C  ++ +   + L+  +   Y+ ++      + +  +W  +K  I       L   T       W+    + +L    +  LAK+IC      L   H+ F   +          +  +E  R K+  +       L + +  L+   L         +G+G  G VY C    G+     K +VP D      ++ E +Y+  L  H  ++ +I   ++ +        + +    ++ DL   +K   L+   ++ ++++V   ++++H+Q ++HRD+KL N+LLD +N   + D GFCK  A+ + S VGT +H+APE+     YD  +D+Y+ G+LLWY+  G    PL F  C S     L     + VRPERL N  +  W LM  CW
Sbjct:  138 VPRGDLELNDEEKADPAMASAVAEISLNHALLKAGAQLVCSPSNPEGDAENIF-SACCEDVLPILVYSIE-QDFLSDKDEAELLQIKALAPDLPIFFVKCSRKKPDLTNSMTEYAQHEAIEEFAEARTRIFEQLRKIGYLTQESPEQKK-----------------ALQHEVLDIRNAKAILDSVIPKSMLIENFSLFPCFLLFVRQVLQFHLVEAATVMNDAHCRALSLFITTAFDMARDMIITPRRLEYAKEKEEELFLALMETATRKQEEIKEVIKST-----------IENLSPQILKEVESLEFRGVECSGEQKLLNPKDLDHCTFQIQELVLGRINKAVAGNMISSVEYLRESFVGTLQRCIDS--LEKMDSDSRRNACEYTSAT---VALKHVIDAAYQVEVTYRASSSLARLLWEKMKQAI-----QTLPGKTPPKVDSAWKRKVAQDMLTSLSETRLAKHICLQFRTRLIKSHESFTSCMRMLEANHTGRLEKTEEQRMKVRKSHAPKIARLALESWSLRDVVLYGMPQLSREVGRGQYGVVYACDRWAGRHPCAIKSVVPPDDKHWNDLALEFFYTRSLPLHDRVVSIIGSVIDYSYGGGSSPAVLLVMDRLQRDLYQGIKAG-LSFRARMHVAVDVVEGIRFLHSQGLVHRDIKLKNVLLDSKNRGKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGHYDNSVDVYALGILLWYICAGTVRLPLAFEQCASK--DHLWNAVRRGVRPERLANFDEECWMLMEACW 871          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG13])

HSP 1 Score: 130.954 bits (328), Expect = 1.683e-34
Identity = 64/185 (34.59%), Postives = 113/185 (61.08%), Query Frame = 3
Query: 2244 HPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECW 2798
            HPN+LPL+   +   +  + I++ I +  M  DL   + + + +L ++L+I L+VA ALKY+H+ +++HRD+KL N+L+DE++   L D+G CK+  +   S VGT   +APE+V+Q+ Y++ +D+Y+FG+L+W + +G    P         + +L+    ++ +PERL       W+LM  CW
Sbjct:   11 HPNILPLVCTVIQPGL-CNSIKVLIVSERMASDLHRALPR-LTSLRKRLEILLDVARALKYLHSLDLIHRDVKLQNVLVDEKSQGSLTDFGLCKAEGVMENSLVGTPTSMAPEMVKQN-YNKSVDVYAFGILMWRVCEGQGNQPRNIALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCW 192          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49816 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG14])

HSP 1 Score: 125.176 bits (313), Expect = 1.803e-29
Identity = 166/674 (24.63%), Postives = 290/674 (43.03%), Query Frame = 3
Query:  111 NLRQTIQLYQNDLKNVLVIQENTKKAFQHITDIL-DPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHK------ENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIK-SQETDFHNEQFCKFESDLNRI--LLENFEREILTATKSLIDFQMDVLTKIISRAKQF----VDFTNENLDEIFTM----RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIAD-MEFPKS-------IIIPENK-AFTKKNAKFCQKHIIDLICKDLDNLIDNFV------QDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGL---------FRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIR 2006
            +L +  + ++ +  ++  I E+T K FQ I   L D   E L++ +    L +   V G+   L +I+L        + L E S  T  E  K      + P + + G    GKS+++N  L   VV    + CTAR+ R+TYSE  YV LV      +ER++LK+  IP+  +ELN +DR +   VN  +  G+   FLK+GID+IDSPG +EN VL+ L+ N +  +LP +IYV+DG          N+LS   S P           D D+   + + + ++ +K +    + KL +   I           NFHG S +   ++  ++K +   D     F ++    +R+   L +F +  LTA    ++   + LT ++SR   F     +F  +   E   M    R+ E  +H ++  +I   + L I  ++      SD I+++ ++ +E  ++        +IP N      K    C+  I +++   +   I + +      +DE    LEN          I K++  +     +S   + +   L   Y       ++  S+F  W   K IIT L         F  D+      +    W+  Q  + +   D   L +++   +L   +  H  F   L+K   V ++   L ++ R
Sbjct:    3 SLEEVFKEFRRNRSSLQQIHEDTLKCFQSIEKSLADKKHEELVQEMTT-TLASQQQVDGSDINLENIQLVTGGESIATNLSE-SLYTEAERSKVSKFLTQTPALIVTGQTNCGKSSIINEFLGARVVPTKAQPCTARIVRMTYSETPYVRLVKRDGTELERRELKSNKIPREFIELNIDDRDDEKRVNATVEAGLCVDFLKAGIDVIDSPGTSENDVLDELVRNQMKSILPFVIYVVDGH---------NLLS---SSPAKTDSSDEESDDDDNDESVKQAEPVQESKKRK--VYDKLVKKGFIIPCEGGRDAHPNFHGLSAWRIGEFNKRMKMNPAWDDSEGLFKEYMDAFHRLHTCLHDFTKSSLTAC---VENTCNTLTSVLSRCLSFFIKKANFLKQGKKETMVMINRIRQEELTVHENILRQIEKQR-LDITEVV------SDGILEIKSNVLEEARTFQYSELDFVIPANGWVHGAKAVTECRDQIWEMVFNKVRQRISSTLMAMFSHRDEFLVELEN---------RIKKIEQEAFPDGRRSTAGVTIHLMLVNCY-------EVSRSNFRFWA-TKTIITRLVDFLKRLFKFPLDVIRGKVKVGDMEWKERQASVAIEAIDVAKLVEHLMQKLLERFDECHSIFNDELDKVMAVFKQGQTLKDSQR 633          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGQ2])

HSP 1 Score: 122.865 bits (307), Expect = 1.635e-28
Identity = 193/848 (22.76%), Postives = 366/848 (43.16%), Query Frame = 3
Query:  348 VENSFRTNNEIHK------ENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKK-LKNKPIPKYIVELNDED-RSNPDEVNKLIRVGIKSKFLKSG-IDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSE--------LIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKI--------ISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSII---IPENKAFTKKNAKFCQKHIIDLICKDLDNL-------IDNFVQDELNKNLENCFE-AHLSPKIINKL---KLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMN---LEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQ-GSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIA----PEIVRQSKYDQKI--DIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRP 2744
            V N+F +  E  K      +   I +VG   +GKS+L+N LL    +  A   CT+R+ RI YS+ NYVE+   + + ++ K+    K IP+  + L+D+  RS+ + V  +++VG+ +  L+ G ++L+D+PG++EN VL+ ++   I+ +L V+IYVIDG +S++  D   + SLK  I ++ I +   ++DT+  +           ++  +   + K+   ++ L    LI        +C  FHG S +         K++    HN QF    +D   ++  +F   +  +  + + +  D+L +I        ISR     D  +   D I  ++ VE    N +   + ++   L + +   +++ S+ I+    +MEF    I   +  N+   +     C+  I  L+   + N+           +  ++ + L+ C E A     + NKL   +L+ C L+ +    +    N+     + L+     + +F  W+ LK   T +    LSN T    ++ W+    K IL+  +   ++  I   +L D    H+ F +N   +E+  K+  K+ +  + +   +     SF  ++ RT  L +  L  +    E +G+ G +GTVY C+     + K  ++           + Y S +   PN    +   +     FD             D    ++ + + L       +++  A  Y   +N+   D +L N+ LD      L D    +  ++     +  F H++    P I   +   Q    D+Y+ G+L W LA      P +A  Q+  VK + E T++   P
Sbjct:   72 VINAFISEQETQKFEEFVSKKAAILVVGQTNSGKSSLINELLGGTYLPTAEIPCTSRIVRICYSDNNYVEVQGPNGECVQGKQSFGKKRIPRDEIALDDDKKRSDAEWVRCVVKVGLNNSLLRGGHLELVDAPGMSENEVLDQIVQECIHGILQVVIYVIDGNSSLRTQDREFLFSLKERIDSIPIFFVCNKVDTNAKAAEFDRDSDDSDDDSSLDNVETKMRQAYKALVGYGLIDSDI-QLEDCAAFHGISTHEVR------KARHKKIHN-QF----TDAFEVMKSSFLTFLDNSLNANLGYTTDLLLRILQRIFDFYISRGPLRGDLESICRD-IRGIQAVERTYFNKMCEYVKSNHTKLHNVMESSVNSSSENILKEAEEMEFAPIRIGNAVKRNEIINQ-----CRDQIHKLVLLRVLNISLKEATKTLRVIAGQMKRKLDICLENAAKHDNLTNKLVTNQLHICYLNRRDIEEMI---NMGPIVNFSLM-----SRTFKTWDQLKRFATDV----LSNVTGTEVNKSWKRKIAKNILDNVNFSEVSHRIIEVILTDNQASHETFQINTRCMEQLCKMADKQSDCQQMV---VFEHAHSFAEVICRTEALMNTLLHPEVKLLEPLGRPGYRGTVYNCLVPAGRFGKCDVVA----------KQYKSVV--SPNQFLALQQCMRS---FD-----------DADQHGILRPSSIVL-------VDITEACLYCRAKNVHLIDPRLTNVKLDGDYRSML-DISKPRDDSVPYPDGMAPF-HVSAPPPPLIAFSTNTTQTAHHDVYALGILGWLLAMEKYIRPQYA--QTVDVKEIYEATSRMAHP 849          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU9])

HSP 1 Score: 97.4413 bits (241), Expect = 5.043e-21
Identity = 44/107 (41.12%), Postives = 76/107 (71.03%), Query Frame = 3
Query:  489 CTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINK-VLPVMIYVIDG 806
            CT+R+ RI+YSE N+V+LV+    +I+R+K K K +PK    L+D  + + D ++ ++ VG++ +FL+SGI+LIDSPG  E+  L+ L+   + K ++P+++YV+DG
Sbjct:   66 CTSRIVRISYSESNFVQLVDEAGNVIQREKFKRK-VPKKYAVLSDAAKESADNLSAIVEVGVEHEFLQSGIELIDSPGRCESDALDRLVDGFLEKGIVPLIVYVVDG 171          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 164.851 bits (416), Expect = 2.758e-41
Identity = 133/516 (25.78%), Postives = 236/516 (45.74%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEY--AKKKIIVPTDL-LETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCE-PPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L + L +  N  +  + + +++ L +  + +++  A++EF   I+ P  +  T K  K C   I +LI   L+  + N       ++++     LE C  +      + K  L S   +  S +   L++ L   Y  ++      + +  +W  +K II    R    N      +  W+    +  +       LA++IC+     LN  H+ F  +L +  +     +  +E +  ++  +       L + +  L+   L         +G+G  G VY C   G  Y  A K ++ P D     ++ E +Y+  L +H  L+ L    ++ +      I + +    +  DL   +K   L+L ++L+I+L+V   ++++H Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+    KYD  +D+Y+FG+L WYL  G  + P  F  C S     L     K  RPERL +  +  W LM  CW+
Sbjct:  375 REKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTPNGEPVTSKEIKSCIHLIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSS------LEKSTLDSSVHNVTSNH---LKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQII---HRITFVNPP--AITPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAG-LSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCTGSVKLPEAFEKCSSK--DQLWNNVKKGARPERLPSFDEECWQLMEACWN 872          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 116.316 bits (290), Expect = 4.689e-26
Identity = 114/515 (22.14%), Postives = 214/515 (41.55%), Query Frame = 3
Query: 1296 RKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDN-------FVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEY--AKKKIIVPTDL-LETISEEVYYSY-LFEHPNLLPLIAVTVNDNIRFDC-IEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            R+ E  L + L +  N  +  + + +++ L +  + +++  A++EF   I+ P  +  T K  K C   I +LI   L+  + N       ++++     LE C  +      + K  L S   +  S +   L++ L   Y  ++      + +  +W  +K II  +   +    T +     W+    +  +       LA++IC+     LN  H+ F  +L +  +     +  +E +  ++  +       L + +  L+   L         +G+G  G VY C   G  Y  A K ++ P D     ++ E +Y+  L +H  L+ L    ++ +      I + +    +  DL   +K   L+L ++L+I+L+V   ++++H Q ++HRD+KL N+LLD+QN   + D GFCK  A+ + S VGT +H+APE+                                                   RPERL +  +  W LM  CW+
Sbjct:  407 REKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTPNGEPVTSKEIKSCIHLIQELIVVRLNQAVANKLISSVDYLRESFVGTLERCLSS------LEKSTLDSSVHNVTSNH---LKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQIIHRITFVNPPAITPE-----WKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAG-LSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-----------------------------------------------TGARPERLPSFDEECWQLMEACWN 859          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:101162759])

HSP 1 Score: 97.8265 bits (242), Expect = 2.834e-20
Identity = 68/244 (27.87%), Postives = 124/244 (50.82%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISL------EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVR---PERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    D+ ET   E+ +    +HPN++    V         C +   Y  LM+   +  + + +L   +++  SL       +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW +  G+     + +  S+   ++  V N +++   PE   + PD    L+ +CW+
Sbjct:  167 QWVGSGAQGAVFLGKFHGEEVAVKKV---RDIKET---EIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEYCAQGQLYE-VLRAGRKITPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIP---YKDVDSSA--IIWGVGNNSLQLPIPE---SCPDGFKILLRQCWN 386          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:101162759])

HSP 1 Score: 97.4413 bits (241), Expect = 3.811e-20
Identity = 68/244 (27.87%), Postives = 124/244 (50.82%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISL------EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVR---PERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    D+ ET   E+ +    +HPN++    V         C +   Y  LM+   +  + + +L   +++  SL       +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW +  G+     + +  S+   ++  V N +++   PE   + PD    L+ +CW+
Sbjct:  167 QWVGSGAQGAVFLGKFHGEEVAVKKV---RDIKET---EIKHLRKLKHPNIITFKGV---------CTQAPCYCILMEYCAQGQLYE-VLRAGRKITPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIP---YKDVDSSA--IIWGVGNNSLQLPIPE---SCPDGFKILLRQCWN 386          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: MAP3K12 (mitogen-activated protein kinase kinase kinase 12 [Source:NCBI gene;Acc:101160549])

HSP 1 Score: 95.1301 bits (235), Expect = 1.741e-19
Identity = 62/241 (25.73%), Postives = 123/241 (51.04%), Query Frame = 3
Query: 2103 EMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISL------EVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLA--LSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
            + +G G+QG V+    +G+E A KK+    ++ ET   ++ +    +HPN++    +         C +   Y  +M+   +  + + +L   +++  SL       +A  + Y+H   I+HRDLK  N+L+   + V ++D+G  K L+   +  SF GT   +APE++R     +K+DI+SFG++LW +  G+     + +  S+   ++  V N +++     + PD+   L+ +CW+
Sbjct:  160 QWVGSGAQGAVFLGKLHGQEVAVKKV---RNIKET---DIKHLRKLKHPNIITFKGI---------CTQAPCYCIIMEYCAQGQLYE-VLRAGRKITPSLLMDWAMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDAVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEVP---YKDVDSSA--IIWGVGNNSLQLPVPDSCPDSFKLLLRQCWN 379          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056716.1 (SMESG000056716.1)

HSP 1 Score: 1814.66 bits (4699), Expect = 0.000e+0
Identity = 929/933 (99.57%), Postives = 929/933 (99.57%), Query Frame = 3
Query:   84 MMNIESFHENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWDQXXXXXXXXXXXXXXXQDLLSEIFEKK 2882
            MMNIESFHENLRQTIQLYQNDLKNVLVIQENTK AFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRIL ENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKN ENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERL NIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLLSEIFEKK
Sbjct:    1 MMNIESFHENLRQTIQLYQNDLKNVLVIQENTKTAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILSENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNFENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLENIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLLSEIFEKK 933          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056716.1 (SMESG000056716.1)

HSP 1 Score: 1813.12 bits (4695), Expect = 0.000e+0
Identity = 928/932 (99.57%), Postives = 928/932 (99.57%), Query Frame = 3
Query:   87 MNIESFHENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWDQXXXXXXXXXXXXXXXQDLLSEIFEKK 2882
            MNIESFHENLRQTIQLYQNDLKNVLVIQENTK AFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRIL ENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKN ENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERL NIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLLSEIFEKK
Sbjct:    1 MNIESFHENLRQTIQLYQNDLKNVLVIQENTKTAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILSENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNFENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLENIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLLSEIFEKK 932          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056697.1 (SMESG000056697.1)

HSP 1 Score: 865.144 bits (2234), Expect = 0.000e+0
Identity = 444/909 (48.84%), Postives = 626/909 (68.87%), Query Frame = 3
Query:  105 HENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENK-AFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSF---------SIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWD 2801
             +NL Q I  Y+ + + +L IQ +TK+AF  IT+IL P +  LLEC+N+DN+ +I +  G      + E+ ISA  + +  +      N ++   NP IAIVG VKAGKST VN+LLRKNVV QA++ CTARLTR+TYS +NYVE+++ + +++ERKKL    IPK  ++LNDEDR+   E+NK++R GIKS+FL+ GID+IDSPGL+EN  L  L  N+I  +LP+MIYVIDG+TSVKQTDI+++L LK ++P L IIYFI++LDTDD +E   +D IK A+ K++  F+KLQ +N IP +F H+SEC  FHGASLY YMDY    +++E  FH + F KFE  L   L+ NF+ +I  A  S+++FQMDVLTKII+RA+   DFT ENL+ IFT+RK+EE L   +K  I++SK  LI RL++RL++ES+ II+ I D+E+P SI +PEN     K+  + CQ  I+  +C+ L+N+I  FV+ EL +   +  E  ++ ++ +++ ++  +   K+PYR+ LER L   YK++ L   + N+            I N +K   + LF +D   ++ D+ S  W+  Q K  L  CD   LA+ +C +++ D   KH+ FL+ LE E + + K+I++SE IR +++ +   F  LLM TLD++ +Y+++  V  E IGQG+QG VYRC CNG+E AKK + +P + L  I+EEVYYSYLF+HP LLPLIAV++ D+   D  +ISI+ PLMK D+  Y+K+N ++++++LKI+L+VA AL+Y+H Q IMHRDLKLANILLD+ NNV+LADYGFCKS+ALSN+SFVGT VHIAPEIVR++ YD K+DIYS+GMLLWYLA+G    P FA  QS   +VL   T  N+RPERL  I D LW+LM  CWD
Sbjct:   10 RQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTE-EIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLDTDDTTETEFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLMINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLT-ALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENRFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWD 916          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056718.1 (SMESG000056718.1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 413/928 (44.50%), Postives = 583/928 (62.82%), Query Frame = 3
Query:   96 ESFHENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENLLECINLDNLLNIF---------NVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSEL------IENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNA-KFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDL-LGLKIKNSSFSIWNFLKNIITG-------LFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKI-SNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDLMNECWDQ 2804
            E F   + Q  Q Y+ + K ++ IQ  T+ AF ++TDIL P +  LLECIN+++L   F         NV  N + + D+E  +S                      NP IAIVG VKA KST++N+LLRK VV QA   CTAR+TR+TYSEENYVEL +    +++RK L+   IP   V LN+ DRSN  E+ K ++ GI  KFL SGIDLID+PGLNE+ +L+ L    +  +LP+MIYVIDG TSVKQTD+S++L LK +IP+L IIYFI++LD+D  +E       IE   I+ + +KL   F++LQ  N IPKT+NH+SEC  FHGASLY  MDY N  +S E  F+ E F +FE++L+  LL +FE  I TA  SLI F MDVL KIISR  +  D + EN ++I  ++++EE L  ++K+ +++ K  L + L+K+   ESD I  L+ D E+P SI +P++      N  + CQK I+ +IC  L+ LI+ FV+DEL     +  E H +  +  KL   + + S ++PY +CL + LT+ YK +  +  K      S+   + NI++        +F  +      D+ S+ W+  Q K  L  CD   LA N+C N++ +L   H+ F + LE E K  QK I +S+ I+  +  N    F++LLM TLD++ +Y+MKD    E IGQGSQ +VYRC  NGKE A K   V  D L  IS+EVYYSYLFEH +LLP IA+++   ++++  ++SI+TPLMK D  +++ +N ++L ++L I+L+ A AL+Y+HNQ+IMHRDLKLANILLD ++NVYLADYG CKS A++N + VGT +H+APE++ Q+ YD KIDIYSFG+LLWYL +G    P   +  S   +VL    +K+VRPERL N+PD LWDLM+ CWD+
Sbjct:    9 EQFCFKINQASQEYRENRKALIDIQTRTRTAFLNLTDILKPSTAELLECININDLSEAFAEFTLVQNENV-PNDKYVPDVEKNVSC---------------------NPAIAIVGQVKAAKSTMINVLLRKTVVCQAFSRCTARITRLTYSEENYVELFDSDGTLLKRKLLRAPKIPARFVRLNENDRSNIKEIRKEVKAGINCKFLMSGIDLIDTPGLNEHSLLSNLSKETVKNILPIMIYVIDGNTSVKQTDLSDLLELKNAIPDLKIIYFISKLDSDISTEQLSDPEEIEKMKIELSIEKLSIAFKRLQNQNFIPKTYNHWSECPYFHGASLYKIMDYFNHQQSPEILFNLELFNRFENELSLFLLVHFENIITTAAYSLIYFHMDVLAKIISRGIKIKDSSEENQNQIERIKRIEEELFENIKNVLSSQKLYLKEILIKKFKTESDSIYKLVQDCEYPSSIRVPDSGITIDNNTIRLCQKFIVSIICFGLEQLIERFVEDELFSKYRSKVENHFNDNMDKKLYGKNSKFSGRNPYDMCLRKILTENYKCNFKVNPKNLEDMSSMRKLINNILSSIKIFLWKIFEVNSLKGCKDVKSQKWKHNQVKYCLLNCDFSKLADNVCINLIENLQNCHEAFNLALEIERKHFQKSIQISDNIKQSLKKNHWPVFSVLLMETLDIKGRYMMKDVKRHEEIGQGSQASVYRCTVNGKELAMKTRYVKADKLSEISDEVYYSYLFEHRHLLPFIAISI--KLQYNSAQVSIFTPLMKSDALDFIIQNEVSLVKRLMIALQTAEALQYLHNQSIMHRDLKLANILLDNEDNVYLADYGCCKSTAIANNTIVGTPIHMAPEVI-QNSYDDKIDIYSFGILLWYLVEGKGNHPKHLSVHSEVFRVLYLAAHKDVRPERLENMPDELWDLMSACWDK 911          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056719.1 (SMESG000056719.1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 392/844 (46.45%), Postives = 561/844 (66.47%), Query Frame = 3
Query:  108 ENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTXXXXXXXXXXXXQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENKAFTKKNA-KFCQKHIIDLICKDLDNLIDNFVQDELNKNLENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKY----DLLGLKIKNSSFSIWNFLKNIITGLFRSDL----SNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQK 2612
            ENL + I+ Y+ + + ++ IQ +TKK F  IT+IL   + +LL+C++ +NL NI    GN E  +DI      L  +   +++ F    EI   NP IA+VG VK+GKST VN LLRKNVV QA + CTAR+TR+TYS +N+VE+++    I++RK L    IPK  ++L +  R + +E+NK I+ GI S FLK GID+IDSPGL+EN  LN L  N+I  +LPVMIYVIDG+TSVKQTDIS++L LK ++PNL IIYF+++LDTDD+SE    D IK A+ K+D  F+KLQ +N IP TF+H+SEC+ FHG SLY++MDY    ++ ET FH   FCKFE +L+  LL+NF  +I      LIDFQM+V+TKII+RA+   DF   N DEI  ++++EE+L+  +KS + +SK  L   L+KRL NESD+I+  I+++ +P  + IP +   ++K   K CQ  II  +C+ L+N+I  FV++EL +      +A +  ++ NK+   S   S K+ Y LCL+R + + YK+    +L  L   N+     N +++ I G   + L    S  + D+    W++ Q K  L  CD  +LA  +C N+L +   KH+ FL  ++ E   +QK+I LS+ IR K++ +   F  LLM +LD++ KY +++  EKE IG GSQGT++RC+C+GKE AKKK IV  D +E I+EE+YYSY FEHP+LLP +AV + D    D  E++IY+PLMK DL NY+  N   L  ++ I++++A AL+Y+H+ NIMHRDLKLANILL+E N+V+LADYGFCKS AL++YSFVGT +HIAPEI+ ++ YD K
Sbjct:   13 ENLTRVIKDYRQNRERLVKIQSSTKKTFDQITEILKSDTGSLLDCVDSNNLNNIAADLGNFED-SDI------LADEQFYLKSVFEKQVEIG--NPAIAVVGQVKSGKSTFVNTLLRKNVVPQAFERCTARITRVTYSMKNFVEIISNEGVILKRKSLNTTTIPKRFLQLKENVRIDEEEINKQIKAGIHSNFLKCGIDIIDSPGLSENETLNNLSKNMIKSILPVMIYVIDGRTSVKQTDISDLLELKNAVPNLQIIYFVSKLDTDDLSETENADPIKLAELKMDIAFKKLQFNNFIPLTFSHWSECNYFHGCSLYAFMDYTQNSRTPETLFHYNLFCKFEENLHHYLLQNFRNKIEEVCNFLIDFQMEVMTKIINRAQMLSDFNRINFDEINRIKRIEEKLYKKIKSAVKDSKIHLKSCLIKRLKNESDVIVKPISEIIYPNHLNIPLDGIVSEKQQIKQCQSIIISNVCQGLENVIKRFVEEELFQKYLEAIQAQIPFRMKNKI---SVTKSGKTNYGLCLDRRMAEIYKFNISNNLSNLDGNNTIMKFMNVIRSSIKGFLMTGLKIEFSQKSVDVKDPKWKMKQAKKCLERCDFKILADEVCKNLLEEFYKKHNEFLAVMDLENFYVQKKIELSDEIRQKLAEKAPIFAELLMLSLDVKGKYFLQNVEEKEEIGSGSQGTIHRCICDGKELAKKKYIVNIDSIEEIAEEIYYSYSFEHPHLLPFLAVAIIDTEEIDSKEVAIYSPLMKTDLYNYLCHNKTKLSHRISIAIQIAEALQYLHSHNIMHRDLKLANILLNEDNSVFLADYGFCKSTALTHYSFVGTPLHIAPEIIMKNNYDYK 844          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DSTYK8.409e-4426.50dual serine/threonine and tyrosine protein kinase ... [more]
DSTYK5.955e-2923.45dual serine/threonine and tyrosine protein kinase ... [more]
MAP3K122.398e-2127.08mitogen-activated protein kinase kinase kinase 12 ... [more]
MAP3K126.959e-2027.08mitogen-activated protein kinase kinase kinase 12 ... [more]
MAP3K126.959e-2027.08mitogen-activated protein kinase kinase kinase 12 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK622.11.523e-1824.44Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
svh-21.582e-1826.14Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.750e-1826.14Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.750e-1826.14Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.965e-1826.14Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma1.636e-2029.53gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma1.636e-2029.53gene:FBgn0011754 transcript:FBtr0343648[more]
PhKgamma1.722e-2029.53gene:FBgn0011754 transcript:FBtr0343587[more]
GckIII1.605e-1939.55gene:FBgn0266465 transcript:FBtr0083399[more]
PhKgamma1.625e-1930.08gene:FBgn0011754 transcript:FBtr0301501[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk5.373e-3825.19dual serine/threonine and tyrosine protein kinase ... [more]
dstyk3.702e-3631.03dual serine/threonine and tyrosine protein kinase ... [more]
mos2.431e-2130.89v-mos Moloney murine sarcoma viral oncogene homolo... [more]
mos2.431e-2130.89v-mos Moloney murine sarcoma viral oncogene homolo... [more]
mos2.431e-2130.89v-mos Moloney murine sarcoma viral oncogene homolo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk7.182e-3725.91dual serine/threonine and tyrosine protein kinase ... [more]
dstyk7.881e-3725.91dual serine/threonine and tyrosine protein kinase ... [more]
dstyk8.172e-3725.91dual serine/threonine and tyrosine protein kinase ... [more]
dstyk8.938e-3725.91dual serine/threonine and tyrosine protein kinase ... [more]
dstyk9.096e-3725.91dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dstyk9.450e-4526.69dual serine/threonine and tyrosine protein kinase ... [more]
Dstyk3.524e-3023.64dual serine/threonine and tyrosine protein kinase ... [more]
Map3k125.097e-2027.08mitogen-activated protein kinase kinase kinase 12 ... [more]
Map3k125.097e-2027.08mitogen-activated protein kinase kinase kinase 12 ... [more]
Map3k125.097e-2027.08mitogen-activated protein kinase kinase kinase 12 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XUX0|DUSTY_CHICK9.626e-4527.54Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q4VSN4|DUSTY_CANLF5.575e-4427.08Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q20CR4|DUSTY_MACMU6.199e-4426.89Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX1|DUSTY_MOUSE6.610e-4426.69Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX2|DUSTY_RAT1.628e-4326.50Dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FLZ48.006e-8929.62Protein kinase domain-containing protein OS=Macros... [more]
A0A267FM291.199e-8629.62Protein kinase domain-containing protein OS=Macros... [more]
A0A267FZS14.676e-8527.76Protein kinase domain-containing protein (Fragment... [more]
A0A1I8HCU58.099e-8528.55Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8G8Z82.612e-8228.18Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk6.024e-2622.64dual serine/threonine and tyrosine protein kinase ... [more]
map3k127.108e-2027.64mitogen-activated protein kinase kinase kinase 12 ... [more]
map3k127.897e-2027.16mitogen-activated protein kinase kinase kinase 12 ... [more]
ENSAMXT00000008518.24.945e-1939.55pep primary_assembly:Astyanax_mexicanus-2.0:19:145... [more]
stk265.754e-1937.31serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008193.11.438e-1924.90pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
STK363.850e-1830.39serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
stk25a5.970e-1836.84serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
PRKCD7.317e-1831.05protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
RPS6KA38.523e-1828.98ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK19.665e-2028.10cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.160e-1927.27cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK23.140e-1929.24cAMP-dependent protein kinase catalytic subunit; p... [more]
CLA46.162e-1740.00Cdc42p-activated signal transducing kinase; member... [more]
SKM11.020e-1642.57Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444583.426e-4121.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498151.683e-3434.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498161.803e-2924.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495801.635e-2822.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339025.043e-2141.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk2.758e-4125.78dual serine/threonine and tyrosine protein kinase ... [more]
dstyk4.689e-2622.14dual serine/threonine and tyrosine protein kinase ... [more]
map3k122.834e-2027.87mitogen-activated protein kinase kinase kinase 12 ... [more]
map3k123.811e-2027.87mitogen-activated protein kinase kinase kinase 12 ... [more]
MAP3K121.741e-1925.73mitogen-activated protein kinase kinase kinase 12 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056716.10.000e+099.57SMESG000056716.1[more]
SMESG000056716.10.000e+099.57SMESG000056716.1[more]
SMESG000056697.10.000e+048.84SMESG000056697.1[more]
SMESG000056718.10.000e+044.50SMESG000056718.1[more]
SMESG000056719.10.000e+046.45SMESG000056719.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032861 ID=SMED30032861|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2926bp
GATTTTATTAATATCAGATTAACCGTAATAAAGGTCAATTAATTGATATA
TAAATAAATGTGCCCAAGTTTTAACCAATCTTTATGATGAATATAGAATC
ATTTCACGAAAACCTGAGACAAACAATTCAGCTGTATCAAAATGATCTGA
AAAATGTTTTAGTTATACAAGAAAACACAAAAAAGGCATTCCAACATATC
ACTGATATTTTAGATCCGATTTCAGAAAATTTATTAGAATGCATTAATCT
GGACAATTTACTCAATATTTTTAATGTTTGTGGAAATACCGAAACCTTAA
ATGATATTGAATTAGCAATAAGTGCGTTAAGATACGATTCTGGATTGGTG
GAAAATTCATTTCGTACTAACAACGAAATTCACAAAGAAAATCCTACTAT
TGCGATTGTTGGAAGTGTCAAAGCAGGAAAAAGTACATTGGTTAATTTGT
TATTAAGGAAAAACGTTGTCCGTCAAGCACATAAAACATGTACAGCCAGA
CTGACTAGGATAACTTACAGTGAAGAAAATTATGTAGAATTAGTCAATAT
TCATGATCAGATAATCGAAAGAAAGAAATTGAAAAATAAGCCCATACCAA
AATATATAGTAGAATTAAACGATGAAGACAGAAGCAATCCAGACGAAGTA
AACAAACTCATTAGAGTTGGAATTAAATCAAAATTCTTAAAATCAGGAAT
CGATTTAATTGATTCGCCCGGATTAAATGAGAATCATGTTTTAAACCTTT
TAATTTCAAATATAATTAACAAAGTCTTACCCGTTATGATTTACGTAATC
GATGGCCAAACATCAGTTAAACAGACGGATATTTCCAATATATTATCTTT
AAAAGTCAGTATTCCGAATCTTAATATCATATATTTCATTACCAGATTGG
ACACTGACGATGTTTCAGAATTGATTGAAAATGATCATATAAAAACTGCA
AAAGATAAATTAGATTTTACTTTCAGAAAATTACAAAGAAGCAATTTAAT
TCCCAAAACATTCAATCATTATTCAGAATGCCACAATTTTCATGGGGCAT
CATTATACTCGTACATGGATTATTGCAATAAAATCAAGTCTCAGGAAACT
GATTTTCACAACGAGCAATTCTGTAAATTTGAATCAGATTTAAATCGTAT
CTTGTTAGAGAATTTTGAAAGGGAAATCCTCACTGCAACTAAATCTTTAA
TTGATTTCCAAATGGATGTACTGACGAAAATCATATCTCGCGCCAAACAA
TTCGTTGATTTTACAAATGAAAATCTTGATGAAATATTTACGATGCGAAA
GGTCGAAGAACGACTTCATAATGATTTGAAATCAGAAATTAACAATTCCA
AACCTTTGCTAATCGATCGGCTAATGAAACGATTGGATAACGAATCAGAT
TTGATTATAGATTTAATAGCAGACATGGAATTTCCAAAATCAATTATTAT
TCCAGAAAATAAAGCATTTACCAAGAAAAATGCAAAGTTTTGCCAAAAAC
ATATTATAGATCTCATTTGTAAAGATTTAGATAATTTAATTGATAATTTT
GTTCAAGACGAATTAAATAAAAACTTAGAAAATTGTTTTGAAGCTCATTT
ATCACCGAAGATAATTAATAAGCTGAAATTGTATTCCTGTAGGTTATCAA
ATAAAAGTCCGTATAGATTATGCCTGGAGAGAAATTTAACTAAATACTAC
AAATACGATTTATTGGGTTTGAAAATTAAAAATTCTTCATTTTCGATATG
GAATTTTTTGAAAAATATTATAACCGGATTATTTCGGTCAGATTTATCAA
ATGACACTTTTGATATTAATTCCCGCCATTGGAGAATAGGACAAACTAAA
ATTATTCTTAATTTGTGCGACAAAGATTTACTAGCTAAGAATATATGCAA
TAATATGCTCCATGATTTGAATGTAAAGCATGATCGATTTTTGATGAACC
TGGAGAAGGAATTTAAAGTCATTCAAAAAGAAATAAATTTATCAGAGACA
ATTCGTGATAAAATTTCCAATGAAACTTCATCTTTTACGCTTTTATTGAT
GAGAACATTAGATTTACAAAGCAAATATTTGATGAAAGATTCGGTTGAAA
AGGAAATGATTGGACAAGGATCTCAAGGTACGGTCTATAGATGTGTTTGT
AATGGTAAAGAATATGCTAAAAAGAAGATAATTGTACCAACAGATTTATT
AGAAACTATTTCCGAAGAAGTTTATTATTCATATTTATTTGAACATCCGA
ATTTATTGCCGTTGATTGCAGTAACAGTTAATGACAATATCAGATTTGAT
TGTATAGAAATATCCATTTATACCCCCCTGATGAAAATCGACCTGGAAAA
TTATATGAAAAAAAACATCTTAACTTTAGAGCAGCAACTGAAGATCAGTT
TGGAAGTCGCAAATGCTTTAAAATACATTCACAACCAAAATATAATGCAC
AGAGATTTGAAATTAGCAAATATTTTGTTAGATGAACAAAATAACGTTTA
TTTGGCGGACTATGGTTTCTGTAAATCACTGGCTTTGAGCAATTACTCGT
TTGTTGGGACTTTTGTTCACATCGCCCCAGAAATCGTGAGACAGTCAAAA
TATGATCAGAAAATTGATATTTATTCGTTTGGAATGCTATTGTGGTATTT
AGCAAAAGGTGATTGTGAACCACCACTGTTTGCAAATTGCCAATCAACGA
CAGTAAAGGTACTTTTAGAAGTTACAAATAAAAATGTGCGACCCGAACGT
TTGGGAAATATTCCAGATAATCTGTGGGATCTAATGAATGAATGTTGGGA
TCAAAACCCATCAAATAGGCCAAACATCAACTCAATTATTAGCACAATAC
AAGATTTATTATCAGAAATATTCGAGAAAAAATAAATTCTTTATTTCATA
TATTTTATATGCGCCTATTTATTTGG
back to top

protein sequence of SMED30032861-orf-1

>SMED30032861-orf-1 ID=SMED30032861-orf-1|Name=SMED30032861-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=934bp
MMNIESFHENLRQTIQLYQNDLKNVLVIQENTKKAFQHITDILDPISENL
LECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIH
KENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENY
VELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSK
FLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDI
SNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKL
QRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFE
SDLNRILLENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDE
IFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEF
PKSIIIPENKAFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNLEN
CFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKN
SSFSIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLL
AKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSS
FTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKII
VPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLM
KIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLD
EQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFG
MLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLGNIPDNLWDL
MNECWDQNPSNRPNINSIISTIQDLLSEIFEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 670..926
e-value: 2.6E-39
score: 146.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 672..919
e-value: 2.1E-44
score: 151.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 670..926
score: 35.665
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 106..325
e-value: 3.6E-18
score: 67.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 665..738
e-value: 1.2E-6
score: 30.5
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 753..933
e-value: 1.9E-47
score: 163.4
NoneNo IPR availablePANTHERPTHR46392FAMILY NOT NAMEDcoord: 10..930
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 106..254
e-value: 1.6E-17
score: 64.1
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 787..799
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 672..920
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 98..290