TTF-type domain-containing protein

Overview
NameTTF-type domain-containing protein
Smed IDSMED30032853
Length (bp)2488
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TTF-type domain-containing protein (SMED30032853) t-SNE clustered cells

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30032853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TTF-type domain-containing protein (SMED30032853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30032853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 158.303 bits (399), Expect = 5.315e-39
Identity = 160/578 (27.68%), Postives = 267/578 (46.19%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIK-NCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDF------HNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLL--SCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            +FL KQ LP RG+ +   S    N GNF ELL + AK D   +       + + Y    +Q+D+I+ + +E+  +I  E+  +  FS+I D TI+ +  +Q+S+ +R   KS + +   ERF+ F   E          I T LQ+  +D+    GQAYD  + +    N +  + K   P A+++HC +H  +L  I       + +    T   L+  +  S   L       +     T    K +S +        + SV+ S   II  LE I    S     +   E   L  L++K+ FVF + FL ++L    +LS  LQ K IDI      I       +  R+D  F+++    +    K  C    VE    +KR  +K + + +L   +    PT+    +K   Y+  LDT++  L   F++F        +  LF   +P  ++E   +  Q   + YK D   E+ I E   +++ YA +  ++  SC +    +   F++  +   +P L+ L  I L++P+TSA+ E SFS L  +K YL +TM  E+L+G AL+++E+EL
Sbjct:  562 LFLGKQCLPLRGNDQSVSS---VNKGNFLELLEMRAK-DKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCK--KHISQSCWTVHDRTLLSVIDSLPEIIETLEVI---ASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKR--RKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEP--LNETTAKHVQ---EFYKLD---EDIIPELRFYRH-YAKLNFVIDDSC-INFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQEL 1118          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 158.303 bits (399), Expect = 5.315e-39
Identity = 160/578 (27.68%), Postives = 267/578 (46.19%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIK-NCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDF------HNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLL--SCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            +FL KQ LP RG+ +   S    N GNF ELL + AK D   +       + + Y    +Q+D+I+ + +E+  +I  E+  +  FS+I D TI+ +  +Q+S+ +R   KS + +   ERF+ F   E          I T LQ+  +D+    GQAYD  + +    N +  + K   P A+++HC +H  +L  I       + +    T   L+  +  S   L       +     T    K +S +        + SV+ S   II  LE I    S     +   E   L  L++K+ FVF + FL ++L    +LS  LQ K IDI      I       +  R+D  F+++    +    K  C    VE    +KR  +K + + +L   +    PT+    +K   Y+  LDT++  L   F++F        +  LF   +P  ++E   +  Q   + YK D   E+ I E   +++ YA +  ++  SC +    +   F++  +   +P L+ L  I L++P+TSA+ E SFS L  +K YL +TM  E+L+G AL+++E+EL
Sbjct:  562 LFLGKQCLPLRGNDQSVSS---VNKGNFLELLEMRAK-DKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCK--KHISQSCWTVHDRTLLSVIDSLPEIIETLEVI---ASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKR--RKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEP--LNETTAKHVQ---EFYKLD---EDIIPELRFYRH-YAKLNFVIDDSC-INFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQEL 1118          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 158.303 bits (399), Expect = 5.315e-39
Identity = 160/578 (27.68%), Postives = 267/578 (46.19%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIK-NCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDF------HNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLL--SCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            +FL KQ LP RG+ +   S    N GNF ELL + AK D   +       + + Y    +Q+D+I+ + +E+  +I  E+  +  FS+I D TI+ +  +Q+S+ +R   KS + +   ERF+ F   E          I T LQ+  +D+    GQAYD  + +    N +  + K   P A+++HC +H  +L  I       + +    T   L+  +  S   L       +     T    K +S +        + SV+ S   II  LE I    S     +   E   L  L++K+ FVF + FL ++L    +LS  LQ K IDI      I       +  R+D  F+++    +    K  C    VE    +KR  +K + + +L   +    PT+    +K   Y+  LDT++  L   F++F        +  LF   +P  ++E   +  Q   + YK D   E+ I E   +++ YA +  ++  SC +    +   F++  +   +P L+ L  I L++P+TSA+ E SFS L  +K YL +TM  E+L+G AL+++E+EL
Sbjct:  562 LFLGKQCLPLRGNDQSVSS---VNKGNFLELLEMRAK-DKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCK--KHISQSCWTVHDRTLLSVIDSLPEIIETLEVI---ASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKR--RKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEP--LNETTAKHVQ---EFYKLD---EDIIPELRFYRH-YAKLNFVIDDSC-INFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQEL 1118          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 158.303 bits (399), Expect = 5.315e-39
Identity = 160/578 (27.68%), Postives = 267/578 (46.19%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIK-NCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDF------HNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLL--SCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            +FL KQ LP RG+ +   S    N GNF ELL + AK D   +       + + Y    +Q+D+I+ + +E+  +I  E+  +  FS+I D TI+ +  +Q+S+ +R   KS + +   ERF+ F   E          I T LQ+  +D+    GQAYD  + +    N +  + K   P A+++HC +H  +L  I       + +    T   L+  +  S   L       +     T    K +S +        + SV+ S   II  LE I    S     +   E   L  L++K+ FVF + FL ++L    +LS  LQ K IDI      I       +  R+D  F+++    +    K  C    VE    +KR  +K + + +L   +    PT+    +K   Y+  LDT++  L   F++F        +  LF   +P  ++E   +  Q   + YK D   E+ I E   +++ YA +  ++  SC +    +   F++  +   +P L+ L  I L++P+TSA+ E SFS L  +K YL +TM  E+L+G AL+++E+EL
Sbjct:  562 LFLGKQCLPLRGNDQSVSS---VNKGNFLELLEMRAK-DKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCK--KHISQSCWTVHDRTLLSVIDSLPEIIETLEVI---ASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKR--RKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEP--LNETTAKHVQ---EFYKLD---EDIIPELRFYRH-YAKLNFVIDDSC-INFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQEL 1118          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: THAP12 (THAP domain containing 12 [Source:HGNC Symbol;Acc:HGNC:9440])

HSP 1 Score: 97.4413 bits (241), Expect = 4.541e-20
Identity = 133/597 (22.28%), Postives = 247/597 (41.37%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFL-LAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSN---AAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRL--------HILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFAD-MRSDKAF------ESLNVAVKSFIIKNCSLLDVETEFKEK-RIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PS---QISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGL---PNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDF 2301
            + + KQ +P  GH      +      NF+ LL   +   +  L    +    N L+     Q  +++   S I     +EV  + FFS+I D  +DI+  + + V +R V +S  + E FI F   E      A  F  +I    +K  +++  CRGQAY  +S  S     + +++    P AI+  C S A N+    ++ +     +  GT E++ +F   S P+L         +L ++ K R +     LK +  ++   R  A   +V    A++  L+ IN   +      +   A  L   ++ + F+  ++ L+ +L         LQ +  D+ FA   +    +   + M + + +      E+ N+A K         LD++ +   K R A +     +L  +       + +K       ++ ++ +L + F++ H  +    CL   PS   Q+     E  ++  D+Y++D      +   DT        R       +  E+     E    P +   PN+  L K+    PV     ER  +  K +K YLR+T+T++R S LAL++I  ++  ++D 
Sbjct:  174 ILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYEADAEILAVKFHTMI---TEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMG-VSVALGTIEEVCSFFHRS-PQLLLELDNVISVLFQNSKERGKE----LKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATK---------LDIQMKLPGKFRRAHQGNLESQLTSE-------SYYKETLSVPTVEHIIQELKDIFSEQH--LKALKCLSLVPSVMGQLKFNTSE--EHHADMYRSD------LPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDL 735          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 241.121 bits (614), Expect = 3.289e-74
Identity = 191/615 (31.06%), Postives = 300/615 (48.78%), Query Frame = 1
Query:  592 NVFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHL--------KFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYEST-VDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIF----VLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESL-NVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTT------CFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQ--------ISEENKE---FFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRR 2343
            +++LA+QG  FRG  E S S   +N GNF EL+  LA+YD  +  HL          +K     L +  QND+I SL + I + I  E+  AQ FS+++D T D+S  +Q+S  +R V +  +V ERF+   TLE++      N++++ LQ   +D+   RGQ YDGA+ MSG+  GLQ++I+  +  A++VHC +H  NLV + +   +     FF   EKLY F T S  R     + Q+S Y    V  L++LSDTR A R+ ++ ++     A+I +L D+   +  E        A    + +    F FL+    ++   +F    V S+ LQ+KD+D++ A  +     +   ++RS++ F+++   AV+        +  V      KR    K     L+    A D  T       ++ + YFT LDT+  +L  RF     T+     L   Q        +   N E     Q LC+ Y    ++EE        K  + + +        +K +L    E       P L  + K+Y T PV++AT ERSFS++++IKN LRS  + ERLS L LI+IE+++   +D    IN F  M  RR
Sbjct:  314 SLYLARQGQAFRGDDESSSS---ANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYV-RDMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKLLTDLCESDPPE------TAAGDAKMYLRAIDFEFLL--CSEITTTVFQITGVASDALQKKDLDLSTAYTITDGVLDTVKNLRSEEEFKTIFQKAVEKAEDVGIDIPTVPPGHGRKR----KVPTRYLHSATAAQDSHTFQTVEEFYRAKVYFTFLDTITEELGRRFK-VDGTMPTGKILQSFQSLTVHDNWVGTPNTEAVQAIQTLCNFY----SVEEEQQLKTELKVFHTTFK-----SSGMKSMLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAIEKDIP--VDHSEVINIFKHMAHRR 900          

HSP 2 Score: 59.3066 bits (142), Expect = 3.289e-74
Identity = 35/129 (27.13%), Postives = 61/129 (47.29%), Query Frame = 3
Query:   99 TDPGLY--INTSISSKVIRKLFEIGPCQPGLNEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPNFGVYNWKKGMEKIVKHETSNQHQSAICQY 479
            TDP      N  +S + +    ++GPCQP +     FP +  GR FQ S YT          +R WL YSP N  ++C +C +F   + E +  + +    G+  W+    K+ +H ++  H  ++ ++
Sbjct:  161 TDPAHMQTFNIDLSDRYVEMCEKVGPCQPVMT----FPKNAEGRSFQRSWYT----------DRPWLEYSPKNDAIYCFSCRIF--LREEKFKNKTAWKTLGINTWRSATGKMKEHASTEAHMMSMVRW 273          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: thap12a (THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GENE-040426-2045])

HSP 1 Score: 93.5893 bits (231), Expect = 3.847e-19
Identity = 137/620 (22.10%), Postives = 252/620 (40.65%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELL---------FLLAKYDFTLDNHLKFEKKNELYLCHDVQ-NDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTEL-QKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRY----ESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSL-LDVETEFKEKRIAKKKR-TAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPS---QISEENKEFFQNLCDIYKNDTNIEEAILEYDTF---------KYVYASIRPLLSC----ELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENID--FESTINRFASMKSRRKQ 2349
            V +  Q +P  GH +     +     NF+ LL         FL  K++ +  N         L  C   Q   +++ +   I   +  E    + FSL+VD+ ++I   + + + +R V K+  + E F+DF   E  +  A +  ++TEL +K  +D+  CRGQAY  + V +     +  KI  L P A+   C S + N+     M+      L   T +KL  F + S P L    E   S Y    E   + LK    ++   +       V    +++  ++ ++  E  +    V   A  +S  +  + +V  ++ L+  L         LQ +  ++ FA   +    +       ++ +E++ V  + +  +  +L   +E   K  R+  +KR T+GE         P T +K +    V+  ++ +L + F++ H        L P+   Q+     E  +   DIYK+D      +L  DTF         K+ + +   +L       LQL +V  FF         PN+  L K+    P+ + T ++  +  + +  YL+ T  N R   +AL  I   +  ++D   E+ +  +   +   KQ
Sbjct:  161 VMMGTQNIPLHGHSDKEPRSKSFTPSNFQALLEYRINAGDEFLRKKFEGSPVN---------LEHCSSTQLQQILEVIEKCIREELLAEAKEGRCFSLVVDNLVEIEGENYVPLFVRFVDKANCLREEFVDFLLFE-GDVEAITERLVTELTEKCGLDMKYCRGQAYLCSGVSAMKVKAMVAKIAELHPLAVLTPCSSCSLNICLANTMTFTG-VHLVMSTLKKLDAFFSKS-PLLQNQLESAISIYYQGNEEKANVLKEACGSKWTEQHDTFELAVDLLESLLLCMDSVHDNEDHKWSDEVAHNAFVISEALADFEYVMTLVVLKNTLSFTRAFGKNLQGETNEVFFASGSLTAVLHSL-----NEVYENIEVYHEFWFEEAVNLAASLEIPVKVPRLYFRKRPTSGE------EIQPETYYKDQVTIPVVSHVIKELSDLFSENHLKALKSLSLVPAIMGQLKFNTTE--ETSVDIYKDD------LLNPDTFPAELHCWKIKWKHGTKDVILPSTIYETLQLSDV-KFF---------PNVCALLKVLYNLPLFALTNDKCSTAKQRLMAYLQDTPVNHRNKSMALFYINCAIKHDLDSMVETYLKMYQESEPTEKQ 739          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 67.781 bits (164), Expect = 3.719e-12
Identity = 39/87 (44.83%), Postives = 55/87 (63.22%), Query Frame = 1
Query: 2074 EVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL-AENIDF-ESTINRFAS 2328
            ++L  F+E  +         L KI +T P+T+A AER FS LK IK +LR++MT ERL+ LA++SIE+ L  E  DF +  I +FAS
Sbjct:  136 DLLQLFMENNLEEVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLSIEKRLVTEMTDFNQKVIEKFAS 222          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: thap12b (THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-040718-429])

HSP 1 Score: 67.781 bits (164), Expect = 3.651e-11
Identity = 73/348 (20.98%), Postives = 134/348 (38.51%), Query Frame = 1
Query:  595 VFLAKQGLPF----RGHREHSGSDRCSNTGNFRELLF-LLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNN---------DAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFA 1596
            + + +Q  PF    R     S  +   N GNF+ LL   +   D  L    +    NE Y     Q  L+      +   I ++V   +FFS++    +D    + + + LR V +   + E FI+F + E         +    ++   + +  CRGQAY G+ ++      +  ++K   P A+     + A N+     MSL            +  FF  S  L T L +++  L      ++S        LK  S +      +     V     ++  ++ I+  E  +    V ++A  +S  +  + F+  ++ L+  L         LQ + ID+ FA
Sbjct:  165 ILIGRQSFPFSSNAREDEMRSREEWLFNPGNFQALLENRINAGDEFLRRRFESAAVNEEYCPAVQQRQLLDVCEKCVREEILQQVRECRFFSIVTGELVDFPEGEHLPIFLRFVDQDNTLREEFIEFLSFEGEEVTVAERLESRLMKGWGLSMEHCRGQAYAGSGILGTKMKVITAQLKEKYPMAVITPTSTCALNVHLANGMSLTGVQVVMSVLKKSNAFFRASPLLQTELDNAISILCQGNLEKES-------ILKEGSRSTWTDLHNLFEMAVDLLEPLLLCMDSIHDNEDLKWSDQVTSDAYAISEALADFEFIVTLVILKNALSFTRAFGKNLQGETIDVFFA 505          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 1.533e-64
Identity = 184/592 (31.08%), Postives = 296/592 (50.00%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLK----FEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILI-TKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN-CSLLDVETEFKEKRIAKKKRTAGELNRDERAD-DPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD-PSQISEENKEFFQNLCDI---YKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRR 2343
            L+ +GLPFRG  E  GS      GN+  LL  +A++D  L  H+K        +  YL   V  + I  +AS +   I  E   A+++S+ VDST D+S  DQ++  +  V   G   ERFI F       A    + ++  L++ +IDI  CRGQ+YD AS MSG  +GLQ +IK ++P A+++ C +H+ NLV  +A     +A  FF   ++LY F ++S  R  +L  H K +  +TV  +K LS TR ++R  A                       +E+  N  + +   S+L+   + F+  +    K+L  +   +  LQ K I I  A +++   R+ F +MR       ++V    F  ++ C  L++   F +KR  K K  A   + DE A       F+  +   + D L+  L  +     +T   F  L  P+ ++ E  +  +   D+   Y  D +  E   E ++F++   +I P       L ++     +  +A   PN+   ++I+LT PVT A+ +RSFS+LK+IKNYLRS+M  ERLS L+++SIE E+A  IDF+  I+ FA+MK+R+
Sbjct:  164 LSSRGLPFRGTDEKFGS---LTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRK--ATV--VKNLSTTRWSARSDAY---------------------IRENSSNSDSVSTAQSLLLQVDFHFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQEMR------VISVDEIYFYARDVCEKLEIPATFPQKRKRKVKARASYESADEGASLSAGDNFRI-SLNQIFDVLISDLTWKSKTLMDTSVDFEFLSCPALVTFELSQLQKAASDLALKYSKDLDASELCSEIESFRHQVEAILPDAKSATPL-DLCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKIDFDDVIDHFAAMKARK 719          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 165.622 bits (418), Expect = 2.060e-42
Identity = 170/605 (28.10%), Postives = 281/605 (46.45%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELL-FLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV---LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMR--SDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC----FKCETYFTVLDTLVIQLDERFNDFHNTV--ALFSCLDPSQIS----EENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELA-ENID--FESTINRFASMKSRRKQF 2352
            VF     +  RG        + S +GN + L  F +   D  L NHLK    N L LC D+  + I S A+           ++  FS+I D + DIS  +Q+S+ +R V   +   ++ E F+ F TL+  +A + +N+I+ +  K  ++I    GQ YDG S M+G + G+Q KIK   P AIFVHC SH  NLV +  ++   + +   G+ + +  F   S  R             S +  +  L +TR  ++  ++     +F  I   L D+    S +    +  EA  L    +  +F+F ++ +      +  L+  LQ  ++DIA A   +      F + R  +++ F+ + V V++   +     D+E     +R  ++K           ++ P +     ++   Y   LD+++  L  RF D HN     LFS L P Q++    +E KE  + +  IY  D    EA+  +D +     S +     +  L ++LP+     + P +   AIL  I LT PVT+ T ERSFS ++ +K +LRSTMT  RLSGL ++S+ R++  EN        +++FA    RR QF
Sbjct:   84 VFCGTHDIALRG--------KTSTSGNVQALYDFRIESGDEILKNHLKNAPVNAL-LCEDILRERIISAAN-----------NSVGFSVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKAFDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLV-VNNLNAVPEIRNAIGSVKAIIKFFRESPKR------------RSLIPNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGK----ISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQMFLNHRQQAEEHFKDILVNVQNIAERT----DIELSLP-RRCGRQK---------HHSNVPGSTVEEYYRRAIYVPYLDSVIASLKTRF-DCHNITNFNLFS-LHPHQMAKIKQQEFKEKIKQITSIYNIDNLDAEALTWFDLW-----SGKEKQDFQNGLLDLLPY---TDLIPAVRQ-AIL--IALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNRLSGLCMMSLHRDIVNENRPQFIHEVVDKFAQ-DHRRLQF 623          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 109.383 bits (272), Expect = 3.237e-24
Identity = 97/358 (27.09%), Postives = 161/358 (44.97%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELL-FLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV---LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFA----KQLIYVARNKFADMRS 1644
            VF     +  RG        + S +GN + L  F +   D  L NHLK    N  Y    V+N+LI              V+S   FS+I D + DIS  +Q+S+ +R V   +   ++ E F+ F TL+  +A + +N+I+ +  K  +++    GQ YDG S M+G + G+Q KIK   P AIFV+C SH  NLV +  +    D +   G+ + +  F   S  R             S +  +  L +TR  ++  ++     +F  I   L D+    S +    +  EA  L    +  +F+F ++ +      +  L+  LQ  ++DIA A    ++LI + + K   + S
Sbjct:  138 VFCGTHDIALRG--------KTSTSGNVQALFDFCIESGDEILKNHLKNAPVNARYTSVRVENELI--------------VLSG--FSVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKAVDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLV-VNDLKAVPDIRNAIGSGKAIIKFFRESPKR------------RSLIPNVPLLCETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGK----ISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQIIQRKIKQITS 454          

HSP 2 Score: 58.151 bits (139), Expect = 5.352e-8
Identity = 48/137 (35.04%), Postives = 72/137 (52.55%), Query Frame = 1
Query: 1951 QNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELA-ENID--FESTINRFASMKSRRKQF 2352
            + +  IY  D    EA+  +D +     S +     +  L ++LP+     + P +   AIL  I LT PVT+ T ERSFS ++ +K +LRSTMT   LSGL ++S+ R++  EN        I++FA    RR QF
Sbjct:  450 KQITSIYNIDNLAAEALTWFDVW-----SGKEKQDFQNGLLDLLPY---TDLIPAVRQ-AIL--IALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNCLSGLCMMSLHRDIVNENRPQFIHEVIDKFAQ-DHRRLQF 574          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: thap12 (THAP domain containing 12 [Source:NCBI gene;Acc:394650])

HSP 1 Score: 77.0258 bits (188), Expect = 7.644e-14
Identity = 80/341 (23.46%), Postives = 138/341 (40.47%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTG-----NFRELL-FLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHI-LEEHQKSRY---ESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDI 1587
            + + KQ +P  GH           TG     +F+ LL + +   D  L    +    N  Y     Q  +++   S I   I +EV  A FFS++++  + +   + M V +R + ++  + E F+ F   E    A   N   T  +K  +++  CRGQAY  +S +S     + +++  + P  +     + A N+    A+ +     +  G  + LY+F     P+L + LE   K  +   E   D  K +  T   SR      +VG   A I  L+ I    S +    V + A  LS  ++ + F+   + L+  L         LQ    DI
Sbjct:  169 ILMGKQNIPLEGHNSEVP------TGVFIPDSFQALLEYRINSGDDLLRKRFETTAVNLEYCSRTQQRHMLEICESCIRDEILREVRDANFFSVVMEDAVSLGGEEHMPVFVRFIDETNNLREEFLGFLPCEGDAKALALNFHTTMTEKWGLNMEFCRGQAYVTSSGLSANMKFVASQLLEMYPQVVHTLSSTCALNIWLAKAIPVAG-VSIVLGAMKDLYSFFQKQ-PQLKVELERTIKVLFQGNEEKADDYKNVIQTEWISRHDTFEIIVGLLQAFILCLDKITSDNSFKCNTKVTSRAFILSSALSDFDFIVTNVILKNALSFTRAFGKNLQGLTSDI 501          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: znf385c (zinc finger protein 385C [Source:NCBI gene;Acc:779834])

HSP 1 Score: 51.2174 bits (121), Expect = 7.016e-6
Identity = 108/555 (19.46%), Postives = 219/555 (39.46%), Query Frame = 1
Query:  682 ELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVM-SAQFFSLIVDSTIDISRVDQMSV-SLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFI--IKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMK 2334
            +L  LL    F L   L   + NE Y    V+   +Q+   ++  + D++ +  + F  L++D T+DI     + V +  +    GQ+   F+  + L +  A   ++ +L  L + ++ +      + DG+S+M    NG+  K++++ P    +HC  H   L+          A  +    + +Y    +        +E Q      ++D L         S   AV ++  S+  ++ +LE          +      A GL   + K+ FV     L  +L     L+ + Q +++D++    ++  ++   A + + K+    N   + F+  +      D E+ F  K +     +  +L   E+  +      C +      + V+++   F+   N     S LD   I    +E  ++L   + +    E A  ++  FK +  S+  L   ++ +K +       +M    P+  +L  I L  P+ SA  ++      + K   R    +  LS +  ISI+      +DF   I+ F  M+
Sbjct:  156 KLCSLLELQKFNLCEALLSSEHNEYYHPSSVRE--MQAAIVKVLHHEDRQRLKESPFIGLVIDETVDIVEHRNLVVFATSVSPCDGQLHITFLGRFELPSGEANCINDKVLEVLNEFHVPLKKVAWLSSDGSSLMIDRVNGVGEKLRSICPLMTQLHCIFHRRALLPAENFLSAEYASKYESIMDAVYRLYGNKNGENQTFQELQNVLQFCSID-LNSADAVHWTSILPAVETIDSSWPTLVLLLES---------ESTTSPIANGLCAELKKFWFVAFTKVLLDILPIFQKLNQFFQIEELDVSMVNPIVSASQ---ATLLAQKSTSGQN--FQEFLNELNEHPGEDNESRFYYKGVELADCSKSKLKSFEQLKEACLENVCRSLQDRFPSNVLKVISSFSIVFNPKCYPSSLD--DIGTYGEEELRHLLQSFSHMLVAERASNDFALFKRIVFSLSHLTFRDICVKLI---HSSSEMHELFPDFTVLAAIVLVLPLGSALYDKINRAEDLWKQSHRQGGADGGLSDVLKISIDGPALNELDFARAIDYFEDMR 688          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 132.88 bits (333), Expect = 2.537e-31
Identity = 156/594 (26.26%), Postives = 260/594 (43.77%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFT----LDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTL-----KRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSL-LDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEE--------NKEFFQNLCDIYKNDTNIEEAIL---EYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENI 2295
            +FL KQ L  +G+ +        N G+F ELL L A+        + +H+ F      Y    VQ ++I+ +  E+  +I  E+ ++  FS+I +     +   Q+SV +R   K+   V   ERF+ F T E          I   LQ+  +D     GQAYD A+  +   N +  + K   P A++VHC +H    + +A +S   + +      E L+T L S    +H+ EE   S       +L     K  S +   +  H + +V      ++ +L  ++    +     V AE   L  ++TK+ F+F + FL ++L    +LS   Q + +DI      I       +  R+D  F+++         K  S   DVE    +KR  K +RT    N  E    PT+    +K   Y+  LDT++  L   F++F             QISE         N+   +++ + YK D +I   +    +Y  F ++           L   ++   F++  +   +P +  L  I L++P+TSA  E+SFS L  +K YL  TM  E+LS LALI++E+EL   +
Sbjct:  306 LFLGKQCLLLKGNDQSVSP---MNKGSFLELLELRARDRGEVFQLMSSHVDF------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAH---FLELAVISFCKEVKEL---REALHT-LCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVS---RRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEICKKITSKGFDVEKPSFQKR-RKVQRTVDPGN-SEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKM-------KQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAEDG------SLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKL 865          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 132.88 bits (333), Expect = 3.189e-31
Identity = 156/594 (26.26%), Postives = 260/594 (43.77%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFT----LDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTL-----KRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSL-LDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEE--------NKEFFQNLCDIYKNDTNIEEAIL---EYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENI 2295
            +FL KQ L  +G+ +        N G+F ELL L A+        + +H+ F      Y    VQ ++I+ +  E+  +I  E+ ++  FS+I +     +   Q+SV +R   K+   V   ERF+ F T E          I   LQ+  +D     GQAYD A+  +   N +  + K   P A++VHC +H    + +A +S   + +      E L+T L S    +H+ EE   S       +L     K  S +   +  H + +V      ++ +L  ++    +     V AE   L  ++TK+ F+F + FL ++L    +LS   Q + +DI      I       +  R+D  F+++         K  S   DVE    +KR  K +RT    N  E    PT+    +K   Y+  LDT++  L   F++F             QISE         N+   +++ + YK D +I   +    +Y  F ++           L   ++   F++  +   +P +  L  I L++P+TSA  E+SFS L  +K YL  TM  E+LS LALI++E+EL   +
Sbjct:  404 LFLGKQCLLLKGNDQSVSP---MNKGSFLELLELRARDRGEVFQLMSSHVDF------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAH---FLELAVISFCKEVKEL---REALHT-LCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVS---RRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEICKKITSKGFDVEKPSFQKR-RKVQRTVDPGN-SEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKM-------KQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAEDG------SLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKL 963          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 132.88 bits (333), Expect = 3.189e-31
Identity = 156/594 (26.26%), Postives = 260/594 (43.77%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFT----LDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTL-----KRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSL-LDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEE--------NKEFFQNLCDIYKNDTNIEEAIL---EYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENI 2295
            +FL KQ L  +G+ +        N G+F ELL L A+        + +H+ F      Y    VQ ++I+ +  E+  +I  E+ ++  FS+I +     +   Q+SV +R   K+   V   ERF+ F T E          I   LQ+  +D     GQAYD A+  +   N +  + K   P A++VHC +H    + +A +S   + +      E L+T L S    +H+ EE   S       +L     K  S +   +  H + +V      ++ +L  ++    +     V AE   L  ++TK+ F+F + FL ++L    +LS   Q + +DI      I       +  R+D  F+++         K  S   DVE    +KR  K +RT    N  E    PT+    +K   Y+  LDT++  L   F++F             QISE         N+   +++ + YK D +I   +    +Y  F ++           L   ++   F++  +   +P +  L  I L++P+TSA  E+SFS L  +K YL  TM  E+LS LALI++E+EL   +
Sbjct:  404 LFLGKQCLLLKGNDQSVSP---MNKGSFLELLELRARDRGEVFQLMSSHVDF------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAH---FLELAVISFCKEVKEL---REALHT-LCSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLPEVVEVLASVS---RRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERNDTYFKNIWDGADEICKKITSKGFDVEKPSFQKR-RKVQRTVDPGN-SEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKM-------KQISELLLKWNEPLNEATAKHIQEFYKLDADIIPELRFYRQYAGFNFIAEDG------SLSFIDLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQELVNKL 963          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Thap12 (THAP domain containing 12 [Source:MGI Symbol;Acc:MGI:1920231])

HSP 1 Score: 91.2781 bits (225), Expect = 2.345e-18
Identity = 129/595 (21.68%), Postives = 243/595 (40.84%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELL-FLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRL--------HILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRN-VRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFAD-MRSDKAF------ESLNVAVKSFIIKNCSLLDVETEFKEK-RIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PS---QISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGL---PNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDF 2301
            V + KQ +P  GH      +      NF+ LL   +   +  L    +    N L+     Q  +++   S I     +EV  + FFS+I D  +DI+  + + V +R V  +  + E F+ F   E            T  +K  +++  CRGQAY  +S  S     + +++    P A++  C S A N     ++ +     +  GT E++ +F   S P+L         +L ++ + R +     LK +  ++   R  A   +V    A++  L+ I   ++     N +   A  L   +T + F+  ++ L+ +L         LQ +  D+ FA   +    +   + M + + +      E+ N+A K         LD++ +   K R A++     +L  +    D  +          ++ ++ +L + F++ H  +    CL   PS   Q+     E  ++  D+Y++D      +   DT        R       +  E+     E    P +   PN+  L K+    PV     ER  +  K +K YLR+T+T++R S LAL++I  ++  ++D 
Sbjct:  170 VLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSGEEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLREEFVGFLPYEADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIG-VSVALGTIEEVCSFFHRS-PQLLLELDSVISVLFQNSEERAKE----LKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEATNLATK---------LDIQMKLPGKFRRAQQGNLESQLTSESYYKDTLS-------VPTVEHIIQELKDIFSEQH--LKALKCLSLVPSVMGQLKFNTSE--EHHADMYRSD------LPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDL 732          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.552e-38
Identity = 160/578 (27.68%), Postives = 267/578 (46.19%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVV---ERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIK-NCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTC---FKCETYFTVLDTLVIQLDERFNDF------HNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLL--SCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            +FL KQ LP RG+ +   S    N GNF ELL + AK D   +       + + Y    +Q+D+I+ + +E+  +I  E+  +  FS+I D TI+ +  +Q+S+ +R   KS + +   ERF+ F   E          I T LQ+  +D+    GQAYD  + +    N +  + K   P A+++HC +H  +L  I       + +    T   L+  +  S   L       +     T    K +S +        + SV+ S   II  LE I    S     +   E   L  L++K+ FVF + FL ++L    +LS  LQ K IDI      I       +  R+D  F+++    +    K  C    VE    +KR  +K + + +L   +    PT+    +K   Y+  LDT++  L   F++F        +  LF   +P  ++E   +  Q   + YK D   E+ I E   +++ YA +  ++  SC +    +   F++  +   +P L+ L  I L++P+TSA+ E SFS L  +K YL +TM  E+L+G AL+++E+EL
Sbjct:  562 LFLGKQCLPLRGNDQSVSS---VNKGNFLELLEMRAK-DKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNIYRLSQNKTCK--KHISQSCWTVHDRTLLSVIDSLPEIIETLEVI---ASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKVEKPSLQKR--RKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEP--LNETTAKHVQ---EFYKLD---EDIIPELRFYRH-YAKLNFVIDDSC-INFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQEL 1118          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O43422|P52K_HUMAN (52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 2.181e-19
Identity = 133/597 (22.28%), Postives = 247/597 (41.37%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFL-LAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSN---AAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRL--------HILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFAD-MRSDKAF------ESLNVAVKSFIIKNCSLLDVETEFKEK-RIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PS---QISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGL---PNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDF 2301
            + + KQ +P  GH      +      NF+ LL   +   +  L    +    N L+     Q  +++   S I     +EV  + FFS+I D  +DI+  + + V +R V +S  + E FI F   E      A  F  +I    +K  +++  CRGQAY  +S  S     + +++    P AI+  C S A N+    ++ +     +  GT E++ +F   S P+L         +L ++ K R +     LK +  ++   R  A   +V    A++  L+ IN   +      +   A  L   ++ + F+  ++ L+ +L         LQ +  D+ FA   +    +   + M + + +      E+ N+A K         LD++ +   K R A +     +L  +       + +K       ++ ++ +L + F++ H  +    CL   PS   Q+     E  ++  D+Y++D      +   DT        R       +  E+     E    P +   PN+  L K+    PV     ER  +  K +K YLR+T+T++R S LAL++I  ++  ++D 
Sbjct:  174 ILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYEADAEILAVKFHTMI---TEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMG-VSVALGTIEEVCSFFHRS-PQLLLELDNVISVLFQNSKERGKE----LKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATK---------LDIQMKLPGKFRRAHQGNLESQLTSE-------SYYKETLSVPTVEHIIQELKDIFSEQH--LKALKCLSLVPSVMGQLKFNTSE--EHHADMYRSD------LPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDL 735          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CUX1|P52K_MOUSE (52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.640e-17
Identity = 129/595 (21.68%), Postives = 243/595 (40.84%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELL-FLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRL--------HILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRN-VRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFAD-MRSDKAF------ESLNVAVKSFIIKNCSLLDVETEFKEK-RIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PS---QISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGL---PNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDF 2301
            V + KQ +P  GH      +      NF+ LL   +   +  L    +    N L+     Q  +++   S I     +EV  + FFS+I D  +DI+  + + V +R V  +  + E F+ F   E            T  +K  +++  CRGQAY  +S  S     + +++    P A++  C S A N     ++ +     +  GT E++ +F   S P+L         +L ++ + R +     LK +  ++   R  A   +V    A++  L+ I   ++     N +   A  L   +T + F+  ++ L+ +L         LQ +  D+ FA   +    +   + M + + +      E+ N+A K         LD++ +   K R A++     +L  +    D  +          ++ ++ +L + F++ H  +    CL   PS   Q+     E  ++  D+Y++D      +   DT        R       +  E+     E    P +   PN+  L K+    PV     ER  +  K +K YLR+T+T++R S LAL++I  ++  ++D 
Sbjct:  170 VLMGKQNIPLDGHEADEVPEGLFAPDNFQALLECRINSGEEVLRKRFEATAVNTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLREEFVGFLPYEADAEILAVKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIG-VSVALGTIEEVCSFFHRS-PQLLLELDSVISVLFQNSEERAKE----LKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMENIEVYHEFWFEEATNLATK---------LDIQMKLPGKFRRAQQGNLESQLTSESYYKDTLS-------VPTVEHIIQELKDIFSEQH--LKALKCLSLVPSVMGQLKFNTSE--EHHADMYRSD------LPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDL 732          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QPH9|ZMYM5_BOVIN (Zinc finger MYM-type protein 5 OS=Bos taurus OX=9913 GN=ZMYM5 PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.773e-6
Identity = 47/162 (29.01%), Postives = 70/162 (43.21%), Query Frame = 3
Query:   54 SDILQEQL--------LTQSDFATDPGLYINTSISSKVIRKLFEIGPCQPGLNEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPNFGVYNWKKGMEKIVKHETSNQHQSAICQYLLAKYRISNEKL 515
            +D LQEQL        +  +  + DPG +    +S K    L E  P Q      F FP D  GRKF  + YT+    G  K  R+WL+YS +   + C  C LF + K +  ++       G  +W+     + KHE S  H +   +Y   K  +   K+
Sbjct:  497 ADKLQEQLGEKPSEDSIIPAVLSADPGTWPRI-LSIKQRDTLVENDPPQV---RNFNFPKDSTGRKFSETYYTRILANGE-KTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNEN------GCRDWQHLSHILSKHEESEMHINNSVKYSKLKSDLKTSKI 647          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: H3ACH6 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 2.157e-157
Identity = 260/581 (44.75%), Postives = 360/581 (61.96%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEF----FQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFA 2325
            +FLA+QGL FRGHRE+S   +  N GN+ ELL LLAKYD  L  ++K  K  E YL H +QND I +LA+E+ + I  EV  A+FFS+IVDSTI+I  VDQ S+SLR V  +GQ VE FI F+ L  S+   F +I+ + L+  NI++  CRGQAYDGAS MSG  +GLQ+ +K +SP A+FVHCC+H  NLV +AA S   +AQLFFGT E +YTFLT SLP L IL++ Q+ + ++ V  LK+ SDT+ A RK AV++VV S  A+ + L+ I  G     K  V ++A GL   I  + F F+++F + +L+ I+ LS +LQ    ++  A   +    +    +RSD++F S    +   + K C        F EKR  KKK+   E   D    D    FK ETYF +LD    QL ERFNDF    + F+ L+P    +++ E      ++L   Y ND N E+ + EY +F+ V+ +I    +  L + EVL F +   M    PN+ ILY+IY+T PV+SA AERSFSR K+IKNYLR++M+ ERLS LAL+SIER+LA+ +D+E  I+ FA
Sbjct:  259 LFLAQQGLAFRGHREYSCGSQ--NEGNYLELLKLLAKYDALLAQYIKTSKHKETYLSHHIQNDFIHALATEVLSAIKHEVQEAKFFSVIVDSTIEIGHVDQFSLSLRYVNATGQAVEHFITFHDLPESSVEDFFSILKSSLETVNINMAYCRGQAYDGASTMSGNISGLQSGVKEVSPTALFVHCCAHNLNLVLMAAASCCTNAQLFFGTIESVYTFLTGSLPHLRILKDEQE-KLDTVVHVLKKHSDTQWACRKRAVDAVVQSLPALHNALDRIVSGGVPNCKPKVVSDAQGLLSTIETFEFKFMLIFWRNVLNKIYTLSTFLQSSTFNLVTALNFLDTCLSDVEALRSDESF-SFFEDIAQQLAKECG---TTVSFHEKRAKKKKKFHDENLEDCPMKDAQQKFKVETYFCLLDVFSRQLKERFNDFRMVASKFNALNPKTFDDKHAEINIDAIKDLALFYNNDINEEDLLEEYISFRSVFKNIFSTGTV-LPMNEVLSFLLANDMKKVFPNVCILYQIYMTLPVSSANAERSFSRSKLIKNYLRNSMSEERLSDLALLSIERDLADKLDYEKVIDVFA 831          

HSP 2 Score: 126.716 bits (317), Expect = 2.157e-157
Identity = 62/123 (50.41%), Postives = 75/123 (60.98%), Query Frame = 3
Query:  144 IRKLFEIGPCQPGLNEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPNFGVYNWKKGMEKIVKHETSNQHQSAICQYLLAKYRISNEK 512
            IR+L EIGPCQPGL + F FP DE  R+F    Y+K  G GS K ER WL+YSP   ++ C  CWLFAD         W DP  G  N KKG+EKI KHE SN H++A  + LL K+R   +K
Sbjct:  116 IRRLIEIGPCQPGLKDDFTFPYDESHRRFSRDWYSKTVGNGSCKVERGWLIYSPRLHRLFCFVCWLFADT--------WVDPKCGFSNLKKGVEKIEKHENSNVHRNAEKELLLTKHRFFQDK 230          

HSP 3 Score: 33.113 bits (74), Expect = 2.157e-157
Identity = 15/34 (44.12%), Postives = 23/34 (67.65%), Query Frame = 2
Query:  500 FK*KTVISGLISQERYQVEKNREVFK*MVDATFF 601
            F+ KTV     S+ER Q++KNR++ K ++DA  F
Sbjct:  227 FQDKTVCRTPESKEREQIQKNRQILKRLIDAVLF 260          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A452GX58 (Uncharacterized protein OS=Gopherus agassizii OX=38772 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.872e-139
Identity = 255/593 (43.00%), Postives = 360/593 (60.71%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSG-SDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERAD-DPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENK----EFFQNL-CDIYKNDTNIEEAILEY-DTFKYVYAS---IRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSR 2340
            +FL  QGL FRGH E+ G     +N GNF EL+ LLAK D  L+ HL    +N  YL  D+QNDLIQSL++E+ + I  E+  A++F+LIVDSTIDISR D  S+SLR V  +G  VERFI F  L  ++A  F N++L+ ++   + IT+C GQ+YDGAS MSG  + LQT+I+ ++PNA+F+HCC+H  NL+ I A+S N   +LFFGT E+LYTF + SLPRL IL+E Q +  ES   TLK+L DTR ASRK AV +V+ +  A++  L+ I  GE K       +EA G+   +  Y F+ L++F  K+L+  F LS YLQ+  +D+  A  LI +  N   ++RS+  FES    +++   K     D+ T++K+ RI K+KR   E+   E    D    F  E+Y   L++++    +RF  F N    FS LDP      N     EF  ++  D+  + T I E  L + D +K + ++   ++  +   L +  VL F +   M    PNL+ LY I+LT P++SA AER FSRLK+IK+YLRSTM  +RLSGLAL+SIER+LA  +D+   I+ FA MK R
Sbjct:   54 LFLGIQGLAFRGHCEYRGLGSPSTNEGNFLELIKLLAKNDTLLEQHLLQSDRNATYLSPDIQNDLIQSLSAELLSKIVAELKVAKYFALIVDSTIDISRTDPFSLSLRYVTVNGDAVERFIQFSELPGASAEDFFNVLLSAIKNLGLSITMCYGQSYDGASTMSGEISSLQTRIREIAPNALFMHCCAHDFNLILIDALSSNIQTRLFFGTLERLYTFFSGSLPRLSILKEEQCNLIESFALTLKKLCDTRWASRKSAVEAVLQNLPALVIALQTIVDGEIKTCTPKQLSEAKGILATLDTYEFLVLLIFWSKVLEKAFRLSTYLQKSSLDLVTASHLIQIFENDMKNIRSE--FESEFKQIENEATKLARKCDITTDYKQHRIRKRKRFHEEIAEGEEEIFDAREKFIVESYLVSLESVINSTSKRFEHFKNVADKFSGLDPKHFDNVNNVNKLEFLADMYSDVIDSQTTIVEEFLSFKDMYKEIMSTSSRVKSSVDERLTINSVLKFMIANDMCSIYPNLSRLYHIFLTLPISSAVAERPFSRLKLIKSYLRSTMGEDRLSGLALLSIERQLATEVDYNKVIDNFARMKFR 644          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: W4YS26 (TTF-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 1.150e-128
Identity = 239/592 (40.37%), Postives = 345/592 (58.28%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCS-NTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVD-TLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKE-FFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEV---LPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            +FLAKQ L FRGHRE+  S     N GNF EL+ L++KYD  L  HL  ++ + +YL   +QN+LIQ L + + + I +EV  A  F++I DS IDIS  D +S++LR V   G VVERFI F  L ++ ++     I    +KRNI +  C GQAYDGA+ MSG  +GLQ +IK +S NA++VHCC+H  NLV   A  ++  A+ FFG  EKLY FLT+S PRL   +E ++   +   D  LKRL DTR + R  +V +V  ++ AI+  LEDI   E  E K    AEA GL   ++K  F+ LM   ++LL     LS YLQ   ID+  A  +I          R+++ FE L    +    K     +++ +    R  K+K  +GE   D+  +DP + F+ E ++ V D+++ Q  +RF+DF  TV  FS L P   ++ N E   + L + YK+  + E+ + EY TF+ +  +     + ++ +K +   L F ++  +    PNL  LY+I  T P++SATAERSFSR+KIIK+YLRSTM  ERLSGLA+ISIE+E+A ++D+   I+ FA M  RR  F
Sbjct:  156 LFLAKQNLAFRGHRENMRSAETERNDGNFLELVRLISKYDSVLAAHLSEQRSHSMYLSPRIQNELIQCLRNSVESVIMEEVHEAGCFTIIADSAIDISHTDLLSITLRYVTSDGDVVERFICFQELPSTKSSVLFEQINEFAKKRNISLKDCVGQAYDGAANMSGSLSGLQQRIKEVSNNALYVHCCAHNLNLVISNAACVSPVAKDFFGILEKLYVFLTNSHPRLEKFKEAKRKLSKEVQDIQLKRLVDTRWSCRIESVRAVKATYPAILDTLEDI---EESEGKPTEAAEARGLINALSKVDFLLLMNMWEELLSTTDSLSKYLQSSKIDLISAGGVITATSEAIGKNRTEEHFEELYRKARVEAEKQ----EIDPDLTTVRQRKRKVLSGEQAEDQPINDPVSRFRVEVFYKVYDSVLQQFKDRFSDFMETVRDFSALMPEHFNDLNAERRVKKLAEKYKDVVDTEQLMAEYRTFRPLVQNTDVFDNNDIYVKTINGLLKFLIKNSLESAYPNLTKLYRIIATLPISSATAERSFSRVKIIKSYLRSTMKEERLSGLAIISIEKEIACSVDYSDVIDHFARMHRRRIDF 740          

HSP 2 Score: 93.2041 bits (230), Expect = 1.150e-128
Identity = 49/127 (38.58%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  141 VIRKLFEIGPCQPGL--NEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPN-FGVYNWKKGMEKIVKHETSNQHQSAICQYLLAKYRISNEK 512
            V+R++ E+GPCQP    N+ F FP    GR F+   Y +       K  R WL+YSP+   + C +CWLFAD   +NY   WS  +  G  NWKK   +I +HE S+ H  A  Q  L + R+   K
Sbjct:    2 VVRQILEMGPCQPNFDANDEFSFPRKH-GRGFRREWYFRHLKDEKKKVPRKWLIYSPSRDSLFCLSCWLFADRHKKNYDPTWSKVSGSGFSNWKKATLRIEQHEQSSLHMEAEGQLSLTRLRLDKGK 127          

HSP 3 Score: 24.6386 bits (52), Expect = 1.150e-128
Identity = 12/31 (38.71%), Postives = 17/31 (54.84%), Query Frame = 2
Query:  509 KTVISGLISQERYQVEKNREVFK*MVDATFF 601
            K V +  +     QV+KNR+V   +VD T F
Sbjct:  127 KAVDAEQVRAHECQVQKNRKVLSRLVDVTLF 157          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: W4YYX4 (TTF-type domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.369e-128
Identity = 239/592 (40.37%), Postives = 345/592 (58.28%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCS-NTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVD-TLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKE-FFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEV---LPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            +FLAKQ L FRGHRE+  S     N GNF EL+ L++KYD  L  HL  ++ + +YL   +QN+LIQ L + + + I +EV  A  F++I DS IDIS  D +SV+LR V   G VVERFI F  L ++ ++     I    +KRNI +  C GQAYDGA+ MSG  +GLQ +IK +S NA++VHCC+H  NLV   A  ++  A+ FFG  EKLY FLT+S PRL   +E ++   +   D  LKRL DTR + R  +V +V  ++ AI+  LEDI   E  E K    AEA GL   ++K  F+ LM   ++LL     LS YLQ   ID+  A  +I          R+++ FE L    +    K     +++ +    R  K+K  +GE   D+  +DP + F+ E ++ V D+++ Q  +RF+DF  TV  FS L P   ++ N E   + L + YK+  + E+ + EY TF+ +  +     + ++ +K +   L F ++  +    PNL  LY+I  T P++SATAERSFSR+KIIK+YLRSTM  ERLSGLA+ISIE+++A ++D+   I+ FA M  RR  F
Sbjct:  156 LFLAKQNLAFRGHRENMRSAETERNDGNFLELVRLISKYDSVLAAHLSEQRSHSMYLSPRIQNELIQCLRNSVESVIMEEVHEAGCFTIIADSAIDISHTDLLSVTLRYVTSDGDVVERFICFQELPSTKSSVLFEQINEFAKKRNISLKDCVGQAYDGAANMSGSLSGLQQRIKEVSNNALYVHCCAHNLNLVISNAACVSPVAKDFFGILEKLYVFLTNSHPRLEKFKEAKRKLSKEVQDIQLKRLVDTRWSCRIESVRAVKATYPAILDTLEDI---EESEGKPTEAAEARGLINALSKVDFLLLMNMWEELLSTTDSLSKYLQSSKIDLISAGGVITATSEAIGKNRTEEHFEELYRKARVEAEKQ----EIDPDLTTVRQRKRKVLSGEQAEDQPINDPVSRFRVEVFYKVYDSVLQQFKDRFSDFMETVRDFSALMPEHFNDLNAERRVKKLAEKYKDVVDTEQLMAEYRTFRPLVQNTDVFDNNDIYVKTINGLLKFLIKNSLESAYPNLTKLYRIIATLPISSATAERSFSRVKIIKSYLRSTMKEERLSGLAIISIEKDIACSVDYSDVIDHFARMHRRRIDF 740          

HSP 2 Score: 93.2041 bits (230), Expect = 1.369e-128
Identity = 49/127 (38.58%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  141 VIRKLFEIGPCQPGL--NEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPN-FGVYNWKKGMEKIVKHETSNQHQSAICQYLLAKYRISNEK 512
            V+R++ E+GPCQP    N+ F FP    GR F+   Y +       K  R WL+YSP+   + C +CWLFAD   +NY   WS  +  G  NWKK   +I +HE S+ H  A  Q  L + R+   K
Sbjct:    2 VVRQILEMGPCQPNFDANDEFSFPRKH-GRGFRREWYFRHLKDEKKKVPRKWLIYSPSRDSLFCLSCWLFADRHKKNYDPTWSKVSGSGFSNWKKATLRIEQHEQSSLHMEAEGQLSLTRLRLDKGK 127          

HSP 3 Score: 24.6386 bits (52), Expect = 1.369e-128
Identity = 12/31 (38.71%), Postives = 17/31 (54.84%), Query Frame = 2
Query:  509 KTVISGLISQERYQVEKNREVFK*MVDATFF 601
            K V +  +     QV+KNR+V   +VD T F
Sbjct:  127 KAVDAEQVRAHECQVQKNRKVLSRLVDVTLF 157          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: H3A3B1 (DUF4371 domain-containing protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 3.615e-126
Identity = 237/590 (40.17%), Postives = 330/590 (55.93%), Query Frame = 1
Query:  595 VFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEF----FQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            +FLA+QGL FRGHRE+S   +  N GN+ ELL LLAKYD  L  H+K  K NE YL   +QND I +LA+E+ + I  EV  A+FFS+IVDSTI I  VDQ S+SL+ V  +GQ +E FI F+ L  S+A  F +++ + L+  NI+I  C+GQAY GAS MSG  +GLQ ++K +SP A+FVHC +   NLV + A S   +AQLFFGT E LYTFLTSSLP L IL+E Q+ + ++ V  LK+L+                    + + L+ I  G        V ++A GL   I  + F F+++F + +LD I+ +S +LQ   ID   A   +    +    + SDK+F S    +   + K C   D    F+EK + KKK    E   D    D    FK ETYF VLD          NDF    + F+ L+P    +++ E      ++L   Y N  N E+ + EY +F+ V+ +I    +  L + EVL F +   M    PN      IY+T  V+SA A+RSFSRLKIIK +       ERLS LAL+SIER+LA  +++E  I+ FA +K +RK+ 
Sbjct:  296 LFLAQQGLAFRGHREYSCGSQ--NEGNYLELLKLLAKYDALLAQHIKTSKHNETYLSQHIQNDCIHALATEVLSAIKHEVQEAKFFSVIVDSTIHIGHVDQFSLSLQYVNATGQAIEHFIIFHDLPGSSAEDFFHMLESSLE-LNINIVHCQGQAYAGASTMSGNISGLQNRVKEVSPTALFVHCYAQNLNLVLMDAASCCTNAQLFFGTIESLYTFLTSSLPCLRILKEEQE-KLDTAVQVLKKLT--------------------LHNALDRIVSGGIPNCNPKVVSDAQGLLSTIETFEFKFMLIFWRNVLDKIYTVSTFLQSSIIDQMTALNFLDTCLSDVEALHSDKSF-SFFEDIAQQLAKEC---DTTVTFQEKHVKKKKTFHDENLEDCPIKDARQKFKVETYFYVLD----------NDFRMVASKFNALNPKTFDDKHTEININAVKDLTLFYNNCINEEDLLEEYTSFQCVFKNILSTGTV-LPMNEVLRFLLANDMKKVFPN------IYMTLSVSSANAKRSFSRLKIIKKH------EERLSDLALLSIERDLAGRLEYEKVIDTFAKLKPQRKKL 834          

HSP 2 Score: 123.635 bits (309), Expect = 3.615e-126
Identity = 66/147 (44.90%), Postives = 84/147 (57.14%), Query Frame = 3
Query:   81 TQSDFATDPGLYINTSISSKVIRKLFEIGPCQPGLNEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPNFGVYNWKKGMEKIVKHETSNQHQSAICQYLLAKYRISNEKL*Y 521
            TQ  + TDP L+  T++S  ++R L EIGPCQ GL + F FP DE  R+F  + Y+K  G GS K ER WL+Y P   ++ C A      CK E  S  W DP  G  N KKG EKI KHE S  H+SA  +  L K+R+  +K  Y
Sbjct:  130 TQVPYPTDPALFQKTALSPVLVRCLIEIGPCQLGLKDDFTFPYDESHRRFSHNWYSKTVGNGSSKVERRWLIYLPRLHRLFCFA------CKNEQCSDTWMDPKCGFSNLKKGGEKIEKHENSKIHRSAETELFLTKHRLFQDKTCY 270          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.827 bits (769), Expect = 6.083e-91
Identity = 202/595 (33.95%), Postives = 305/595 (51.26%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLK---------SGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQI----SEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRK 2346
            LA   L FRGHRE  G     N+GNF  ++ LLA+YD  L   L  +K N  YL   +QN+LI  L+  +   I  E+  A+F+S+I+D+T D+S+VDQ+S   R V           +  + E F+ F  + +  A      I   +Q   + +  CRGQ YDGAS MSGI +G+Q +I    PNA++VHC +H  NLV   A     + + ++   ++LY F + S+ R  +LE H KS+      TLKRL  TR ASR+ A+ ++   ++ I+  L  I     +  K + R EAMGL   +  + FV + +  +K+L+ I ++S  LQ+KD+D+  A  L+  A    A +R    F++L    +       S   +   F+ KR  + KR   EL  D+   +P   FK   ++  +DT+V Q+  RF+   +    F  L P+++     E   E  Q L  IY  D                       LS E    ++L F    + A G+ ++A   K++LT PVT A+AERSFS+LK+IKNYLRSTM+ +RLSGLA++SIE + +  +D    +  FA    RR+
Sbjct:   86 LASCNLAFRGHREKVGE---LNSGNFLSVIDLLARYDPVLRELLD-KKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSK-----PTLKRLCPTRWASRRDALYALRFRYADILQALTKITL---RSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLLQAASLLGNATCTLAQLRDQ--FDNLKCTAQGL----ASSWGIRCNFRHKRTRRIKRHFDELTEDQCLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYNED-----------------------LSSEFS-SQLLSF----RNALGVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSIESQRSRRMDLTEIVKEFAQKNVRRR 634          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.352 bits (747), Expect = 1.020e-87
Identity = 193/569 (33.92%), Postives = 295/569 (51.85%), Query Frame = 1
Query:  622 FRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLK---------SGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQI----SEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVE------KQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISI 2271
            F+GHRE  G     N+GNF  ++ LLA+YD  L   L  +K N  YL   +QN+LI  L+  +   I  E+  A+F+S+I+D+T D+S+VDQ+S   R V           +  + E F+ F  + +  A      I   +Q + + +  CRGQ YDGAS MSGI +G+Q +I    PNA++VHC +H  NLV   A     + + ++   ++LY F + S+ R  +LE H KS+      TLKRL  TR ASR+ A+ ++   ++ I+  L  I     +  K + R EAMGL   +  + FV + +  +K+L+ I ++S  LQ+KD+D+  A  L+  A    A +R    F++L    +       S   +   F+ KR  + KR   EL  D+R  +P   FK   ++  +DT+V Q+  RF+   +    F  L P+++     E   E  Q L  IY  D + E        F     S R  L  E++    +    E        +   + ++A   K++LT PVT A+AERSFS+LK+IKNYLRSTM+ +RLSGLA++SI
Sbjct:   51 FQGHREKVGE---LNSGNFLSVIDLLARYDPVLRELLD-KKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSKGLPLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSK-----PTLKRLCPTRWASRRDALYALRFRYADILQALTKITL---RSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLLQAASLLGNATCTLAQLRDQ--FDNLKCTAQGL----ASSWGIRCNFRHKRTRRIKRHFDELTEDQRLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYNEDLSSE--------FSSQLLSFRNALGSEIKTVSTVKGLFELLLLRHSSILSSVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSI 593          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.388 bits (677), Expect = 2.336e-76
Identity = 187/588 (31.80%), Postives = 297/588 (50.51%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNH---LKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV--LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCL-DPSQISEENKEFFQNLC-DIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRR 2343
            LA + LPFRG    S S    + GNF + + LLA++D   + H   +K +     YL    QN++I+ + S+    I  ++  A+++++I+D T DIS  +QMS+ +R+V  +    + E F+ +  +  +     SN++L +L+   I    CRGQAYD  + M G + G+Q ++  L+P A FV C +H  NLV   A   + DA  +FG  ++L+ F +++  R  IL +H K        TLK  SD R  SR   + SVV   S +  + E +        +   R+EA GL+  +  + F+   +   ++L     ++  LQ   + +  A +LI  A+      R     E++  A +      C  L++E E K+KR+   KR  G    DE   D     + E +  V+D+ +  L ERF         F  L D  ++   +K+   N C D+ K  T+  EA ++         ++ P LS +    E+L +  +  +    PNL I  +I LT PVT A+AERSFS+LK+IK YLRSTM  ERLSGLA+ISI  E+A ++  +  I+ FA+ K+RR
Sbjct:  250 LATRNLPFRGS---SQSLYVQDNGNFLKEVELLAQFDSVTEGHVARIKDDASRTHYLGQQTQNEIIEIICSQTIQTIVAKIKQAKYYAIILDCTPDISHKEQMSLVVRIVELVPEPHIREYFLGYMNVVETTGLNLSNVVLEKLRALGIPFEDCRGQAYDNGANMKGKRQGVQARLLQLNPRAAFVPCAAHTMNLVISDAAKSSTDAISYFGYLQRLFCFFSAATQRWDILLKHVKL-------TLKSWSDVRWESR---LQSVVAVRSQVKEVREALLEARQAVTEPVARSEAQGLAEEVGSFRFLICTVVWAEVLSVTSQVNKVLQSSSMQLDIAARLIKTAKESLTKYRQSGFSEAIESAKEL-----CEALNIEPELKQKRLRSTKRQFGYEAPDEPFSDAQKRLEVEFFNHVVDSALTSLQERFETMSQVRDTFGVLLDFQKVHGISKQDLHNHCMDVEKKLTDKGEADIDGQEMMQEIINL-PQLSPQTTAFELLTYLHDNSLQEVYPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSGLAVISINAEVAHSLSLDDLISDFAARKARR 818          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032220.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13450075:13452201:1 gene:ENSAMXG00000029800.1 transcript:ENSAMXT00000032220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 7.371e-68
Identity = 189/607 (31.14%), Postives = 306/607 (50.41%), Query Frame = 1
Query:  604 AKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDIT-LCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKK------------KRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFN----DFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIY------LTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFA-SMKSRRKQF 2352
            A Q +  RGH E + SD   N GNF  +L  +AK+D T+   L     N  Y    +QN+++  LA  +   I +EV  ++ FS++VD T D+ + +Q+S+ +R    SG V E F+ F + +  +AA  ++ I+  LQ   ++      GQAYDGASVMSG   G+Q +IK  + +A +VHC +H  NLV +  +    +A  FF   E+LY F + S      L   QK  YE     L+RLSDTR A R  ++ +++    AI  +L++I    + EH  +   EA GL   I     V+L+ F  K+     +LS+ LQ   +D++ A  L+        D R++  F+SL   V +   + C      T  ++K+++ K            KR+  EL ++         F+   ++ VLD ++ +L+ RF+    D  N +     L+P       ++   +   +Y  ++NIE+   E   F       R +L  ++Q     PF V +  +   P   + +++Y      ++ PVT+A+ ERSFS LK++K YLRSTMT+ERLS L ++SIE   A+ ++ E  ++ FA + K+RR Q 
Sbjct:   78 ATQNIAQRGHNESADSD---NKGNFMAILETIAKHDKTVKKRLT-SIHNAKYTSKVIQNEVLSCLADMVRTKIIEEVKDSEVFSIMVDETKDVKKKEQISLVVRYYF-SGAVHESFLHFESADRLDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVDTVKTVPEADQFFSLLERLYVFTSGSYVHQKWLSV-QKEMYEGAPRELQRLSDTRWACRYMSLRNIIDRLPAIKRVLQEI----AHEHHGDRSVEARGLLAQIDLQFIVYLVTFC-KVFGETKLLSDMLQSPSLDLSKAVDLVEALIQTLNDYRNESFFDSLWNEVLT-TAEQCDTAVQPTAKRQKKLSSKLGGHCVLSTVGQKRSDSELEKE--------SFRTGFFYPVLDHILTELNRRFSSRNCDLMNGI---QALNPKSDGFLKEDTLFSFAKMY--ESNIEDLGHELHQF-------RRILERKIQTGTPRPFSVVELASFMEPYKEVFFELYKLCKVAVSIPVTTASCERSFSTLKLVKTYLRSTMTDERLSNLGVLSIESRRAKTLNLEEFVDLFARNHKNRRIQL 652          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040801.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:3031619:3038346:1 gene:ENSAMXG00000043357.1 transcript:ENSAMXT00000040801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.868 bits (577), Expect = 4.075e-63
Identity = 183/591 (30.96%), Postives = 278/591 (47.04%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTV--ALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKY---VYASIRPLLSCELQLKEVLPFFVEKQM-APGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
             L KQG+PFRGH E   S    + G F E   LL K+D  L ++      N  YL    QN+++Q  A E++A I KE+  AQ F+++ D   D  R +Q+S+ +R V   G + ERF+    L   +A + +N    +L    I    C  Q YDGA+VMSG   G+Q   +   P A++VHC +H  NLV        ++A+ FF   E +Y+F +SSL   H   E Q +R       L +LS TR A +  +VN V+ +F AII  L  IN              A+GL + + K+S V+L++    LL     L  YLQ+++ID+A A +      +   + RSD     L+   ++  I + + L +     E           E      ADD     K    F  LD ++ +L++RF+D    +   + +C  P      +      L   Y  D    E ++  + FK        +  +L+            V KQ+ A   P L    +  LT PV+S + ERSFS L+ +  +LR TM   RL  LA++SIE+EL ++I  +  I+RFA++K RR + 
Sbjct:  169 LLGKQGIPFRGHDESCESH---DKGMFAECFKLLQKFDPFLKSYTP--PLNTTYLSSCSQNEMVQCCAEEVTATIVKEMREAQMFAIMADEARDGKR-EQLSLCVRYV-TGGMIKERFLALTELMGFDAESIANTTEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSFFSSSLVNHHKFVETQ-TRLGLQQTELVQLSSTRWACQLRSVNCVLDNFPAIIECLLGIN-----------TPLAVGLRVKLCKFSSVYLLVMFHTLLSLCAGLHLYLQKENIDLARAMEYKNAVTDSLKEKRSDSTAGELH--ARALAICDANKLRMVDYVVESTCGAG--AGSEATSSSNADD----LKQRLLFPCLDRMLAELEKRFSDVSEELLCGIQAC-SPKSEQFLSVPLLSALALHYNIDLKPAEVMVASNFFKRKNETGGDVEDMLA------------VYKQLDADMFPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDSISPDIVIDRFANLKVRRHRL 719          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO35158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB6])

HSP 1 Score: 67.0106 bits (162), Expect = 2.529e-13
Identity = 32/77 (41.56%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2122 NLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            N+  + KI +T P++SA+ ERS S L+ +K YLRSTMT +RL+GLAL+   +++  ++D +  I+ FA +  RR + 
Sbjct:   50 NIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDSFAQLHPRRMRM 124          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB6])

HSP 1 Score: 67.0106 bits (162), Expect = 2.529e-13
Identity = 32/77 (41.56%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2122 NLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            N+  + KI +T P++SA+ ERS S L+ +K YLRSTMT +RL+GLAL+   +++  ++D +  I+ FA +  RR + 
Sbjct:   50 NIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDSFAQLHPRRMRM 124          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO32811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU05])

HSP 1 Score: 66.6254 bits (161), Expect = 3.317e-13
Identity = 32/77 (41.56%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2122 NLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            N+  + KI +T P++SA+ ERS S L+ +K YLRSTMT +RL+GLAL+   +++  ++D +  I+ FA +  RR + 
Sbjct:   50 NIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRRMKM 124          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO32247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL6])

HSP 1 Score: 66.6254 bits (161), Expect = 3.515e-13
Identity = 32/77 (41.56%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2122 NLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            N+  + KI +T P++SA+ ERS S L+ +K YLRSTMT +RL+GLAL+   +++  ++D +  I+ FA +  RR + 
Sbjct:   50 NIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRRMRM 124          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO35148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMD4])

HSP 1 Score: 66.2402 bits (160), Expect = 4.435e-13
Identity = 32/77 (41.56%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 2122 NLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            N+  + KI +T P++SA+ ERS S L+ +K YLRSTMT +RL+GLAL+   +++  ++D +  I+ FA +  RR + 
Sbjct:   50 NIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRRMRM 124          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 252.677 bits (644), Expect = 1.399e-71
Identity = 183/592 (30.91%), Postives = 297/592 (50.17%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHL----KFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV--LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            LA + L  RGH E   +   S+ GNF + + L+A++D  + +HL    +    +  Y+ H VQN+LI  L+S+I + I  ++  A++FS+I+D T+DIS  +Q+SV +R+V  ++  Q+ E F+ F   E S     +++IL  L++  I    CRGQ+YD  + M G   G+Q ++   +P A+F+ C +H  NLV   A   + DA  +FG  +KLYT  ++S  R  IL+            TLK  ++TR  S+  ++  +    +A+   L ++     K     ++AEA  LS  +  Y F    +    +L  I  +S  +Q  ++ +  A  L+          R++  F +  +A K      C  ++VE   K+KRI   K      + DE   D     + E +  V+D  +  + ERF+        F  L   PS   EE  E  + L +I   + N +   L+         ++  L S    L E++ F  +K ++   PN     +I LT PVT A AERSFS+LK+IK+YLRSTM+ ERL+ LA++SI   + E I ++  I+ FAS K+R+ +F
Sbjct:  281 LAVRNLALRGHTE---TLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQ-------VSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVR---DKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRAN-GFVNAQMAAKEM----CKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWD---LDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 252.677 bits (644), Expect = 1.399e-71
Identity = 183/592 (30.91%), Postives = 297/592 (50.17%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHL----KFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV--LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            LA + L  RGH E   +   S+ GNF + + L+A++D  + +HL    +    +  Y+ H VQN+LI  L+S+I + I  ++  A++FS+I+D T+DIS  +Q+SV +R+V  ++  Q+ E F+ F   E S     +++IL  L++  I    CRGQ+YD  + M G   G+Q ++   +P A+F+ C +H  NLV   A   + DA  +FG  +KLYT  ++S  R  IL+            TLK  ++TR  S+  ++  +    +A+   L ++     K     ++AEA  LS  +  Y F    +    +L  I  +S  +Q  ++ +  A  L+          R++  F +  +A K      C  ++VE   K+KRI   K      + DE   D     + E +  V+D  +  + ERF+        F  L   PS   EE  E  + L +I   + N +   L+         ++  L S    L E++ F  +K ++   PN     +I LT PVT A AERSFS+LK+IK+YLRSTM+ ERL+ LA++SI   + E I ++  I+ FAS K+R+ +F
Sbjct:  281 LAVRNLALRGHTE---TLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQ-------VSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVR---DKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRAN-GFVNAQMAAKEM----CKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWD---LDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 252.677 bits (644), Expect = 1.399e-71
Identity = 183/592 (30.91%), Postives = 297/592 (50.17%), Query Frame = 1
Query:  601 LAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHL----KFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV--LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELNRDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLD--PSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            LA + L  RGH E   +   S+ GNF + + L+A++D  + +HL    +    +  Y+ H VQN+LI  L+S+I + I  ++  A++FS+I+D T+DIS  +Q+SV +R+V  ++  Q+ E F+ F   E S     +++IL  L++  I    CRGQ+YD  + M G   G+Q ++   +P A+F+ C +H  NLV   A   + DA  +FG  +KLYT  ++S  R  IL+            TLK  ++TR  S+  ++  +    +A+   L ++     K     ++AEA  LS  +  Y F    +    +L  I  +S  +Q  ++ +  A  L+          R++  F +  +A K      C  ++VE   K+KRI   K      + DE   D     + E +  V+D  +  + ERF+        F  L   PS   EE  E  + L +I   + N +   L+         ++  L S    L E++ F  +K ++   PN     +I LT PVT A AERSFS+LK+IK+YLRSTM+ ERL+ LA++SI   + E I ++  I+ FAS K+R+ +F
Sbjct:  281 LAVRNLALRGHTE---TLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQ-------VSITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVR---DKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRAN-GFVNAQMAAKEM----CKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWD---LDSRELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 158.688 bits (400), Expect = 4.325e-41
Identity = 153/570 (26.84%), Postives = 258/570 (45.26%), Query Frame = 1
Query:  589 CNVFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELY--LCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELN-RDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEF-FQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQ-LKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIEREL 2283
            C +FL KQ L FRG  E  GS   SN GN+ ELL ++A+ +  L  HL     NE +      +Q+DLI ++   I   I +EV +A F S++V+ T D S   Q++++LR V +SG V ERF+ F  + +   A     ++ +    N  +     Q ++GA+V S   NG+Q K+K  +P A+F+HC +H  +LV     S   + ++FF     L  F + S  R  +L+E  + R       L  ++ T   S    VN+V     A+  +   I    S+  + +VR  A G   L+  + F FL+     +     +L + LQ K  D+ F                           VK F    C  ++ E    E      +R AG  + R   A DP   ++ + + ++LD ++ Q   RF D H  +   + LDP +  E  + F    L  + ++      A+ ++   K     +  +     +   ++L F  +  ++  +  L     + LT P + A+ +R+FS L+ I+ + ++T    RLS LAL++IE++ 
Sbjct:  161 CVLFLGKQELSFRGRDESGGS---SNRGNYCELLSVIAESNTDLHYHLS---TNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTRSG-VKERFVRFEDVTSGKRADDIAGLVIKFLLENECLDKVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLLDEICQRR-------LPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSEYDEDSVRC-ADGFKALLDCFEFCFLLHTFNGIFHYSDMLFSILQDKKSDVQFCLD-----------------------RVKEF----CDTVERERSRYEGVYEATERAAGAPSARKCHAVDPREHYR-QLHGSILDNIICQTQTRFQD-HEKMMFVTLLDPLRFLEYRRSFPHAGLSSLARSHG----ALFDFSQLKTELTVMYTMDDFYGKSPSDILHFIHQNNLSEVMKQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQTRLSALALMAIEKDF 682          

HSP 2 Score: 28.1054 bits (61), Expect = 4.325e-41
Identity = 33/133 (24.81%), Postives = 50/133 (37.59%), Query Frame = 3
Query:   84 QSDFATDPGLYINTSISSKVIRKLFEI---GPCQPGLNEPFQFPTDELGRKFQISCYTKCFGKGSMKEERNWLVYSPTNQKMHCQACWLFADCKTENYSKEWSDPNFGVYNWKKGMEKIVKHETSNQHQSAIC 473
            + D   D    I+   S + +++  +I   G   P L    Q P     R FQ++ Y          E   WL  S  + K++C  C LFA     +    WS   FG  N     +   KH+ +  H  +I 
Sbjct:    7 EVDLVAD---LISRPFSRRTLQEKLDIVKKGRVTPALTSLSQ-PGGGFVRHFQVTNY----------ERYPWLTGSEVHCKLYCWECLLFA----LDRHGVWSHTGFG--NLTCLTKAAKKHQNTAGHLQSIV 119          

HSP 3 Score: 23.0978 bits (48), Expect = 4.325e-41
Identity = 8/18 (44.44%), Postives = 13/18 (72.22%), Query Frame = 2
Query:  548 QVEKNREVFK*MVDATFF 601
            +V+KNRE+ K ++D   F
Sbjct:  147 KVKKNREILKRLIDCVLF 164          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 9.926e-35
Identity = 92/258 (35.66%), Postives = 140/258 (54.26%), Query Frame = 1
Query:  583 GRCNVFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDI-TLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLAS 1353
            G   +  A Q +  RGH+E        + GNF  ++ LLAK +  +   +  ++ N   L HD QN++I  LA  + ++I  EV  ++ FS++VD T D+S+ +QMS  +R    +G V E F+ F   +  NAAA S  I+  LQK  +D      GQAYDGASVMSG   G+Q +IK+ +P A +VHC +H  NLV + ++    +A  FF   +KLY F++ S      LE  Q+   +     LKR+ + + +S
Sbjct:  229 GETLLLTATQNIAQRGHKE----SEVDSKGNFLAIMELLAKNNPIVKRKMAGQR-NATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYYY-NGSVCECFLAFEAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVSGSYVHQRWLEI-QREMSQGKSKWLKRILERKQSS 479          

HSP 2 Score: 64.6994 bits (156), Expect = 2.968e-10
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = 1
Query: 2134 LYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRK 2346
            L K+ L  PV++A+ ERSFS LK+IK  LRST+++ERLS L ++S+E   A  I+ +  ++ FA   S R+
Sbjct:  586 LCKVALALPVSTASCERSFSTLKLIKTALRSTISDERLSNLGVLSVESRRARAINLDDFVDVFAKKHSNRR 656          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036749.1 (SMESG000036749.1)

HSP 1 Score: 211.46 bits (537), Expect = 4.239e-57
Identity = 180/618 (29.13%), Postives = 308/618 (49.84%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKF-----EKKNEL--YLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSG---QVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAV----NSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN--CSLLDVETEFKEKRIAKKKRTAGELNRDERADD----PTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQFK*SGMFVTSINLL 2391
            FLA Q L FRG    SG     N GNF + + ++ K+D  + +H+K        KN +  YL +  QN++I  LA++I   I   +  A++FS+I+D T D   V+Q+++ +R V       +V E FI FY  +     +F + ++ +L    ++I+  RGQ YD  S MSG   GLQ +I    P A+F+ C +H  NL    A +++     FF     +  F ++S  R  +L+++ KS       TLK++S+TR  +R  A+    N +   + ++I I E+ +          V+ EA  L++ +  Y F+  ++   ++L+ +  +S  +Q+   +I+   + I      F  +R+D++FE+         I N  C  L+ E +F  + I+ + R   +    ER +D    P   F+    + +LDT +  L  RF         F  L    I  E++E  ++  D++    + E   +          S++ ++    Q +E++ F  +  +    PN+A   K+ LT PV+ A+ ERSFS+LKIIKN+LR++MT ERLS +++I+IE E+A++ + E  +  FAS KSRR      G   T +N +
Sbjct:  189 FLAGQCLAFRGS---SGKLYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMPHYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNYEVEVRENFIGFYQAKKCTGESFYDFLIQKLNYIELNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAISNFFSASPFRWQVLKKNVKSL------TLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMP-------TVQHEAECLAMKLKSYKFISSIIIWFEILEKVDFISKMMQKVSWNISSCAESIKEVLKYFKSIRNDESFENY------LQISNELCVALETEPDFPAE-ISVRSRHHRKQFSYERDEDIQFTPKEHFQISFSYVILDTAISSLTTRFETLSGFERCFGFL-YKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVSVASGERSFSKLKIIKNHLRTSMTQERLSNISIIAIESEIADSTNIEGAVEEFASKKSRR-----DGYLSTRVNFV 777          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 207.608 bits (527), Expect = 3.677e-55
Identity = 173/598 (28.93%), Postives = 290/598 (48.49%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKF-----EKKNEL--YLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN--CSLLDVETEFKEKRIAKKKRTAGELNRDERADD----PTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            FLA Q L FRG    SG     N GNF + + ++ K+D T+ +H+K        KN +  Y  +  QN++I  LA++I   I   +  A++FS+I+D T D   V+Q+++ +R V         +I  Y +E              L    ++I+  RGQ YD  S MSG   GLQ +I    P A+F+ C +H  NL    A +++     FF     +Y F ++S  R  +L+++ KS       TLK++S+TR  +R  A+  +      I   L +I     +     VR EA  L+  +  Y F+  ++   ++L+ +  +S  +Q+   +I+   + I      F  +R+D++FE+         I N  C  L+ E +F  + I+ + R   +    ER +D    P   F+   +  +LDT +  L  RF         F  L    I  E++E  ++  D++    + E   +          S++ ++    Q +E++ F  +  +    PN+A   K+ LT PV  A+ ERSFS+LKIIKN+LR++MT E LS +++I+IE E+A++ + E  +  FAS KSRR+ +
Sbjct:  261 FLAGQCLAFRGS---SGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV---------YIKNYEVE--------------LNYLELNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSL------TLKQVSETRWEARIKAIRPLRNELGEIYDSLIEI---AEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENY------LQISNELCVALETEPDFPAE-ISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLY-KFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRETY 815          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 207.608 bits (527), Expect = 3.753e-55
Identity = 173/598 (28.93%), Postives = 290/598 (48.49%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKF-----EKKNEL--YLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN--CSLLDVETEFKEKRIAKKKRTAGELNRDERADD----PTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            FLA Q L FRG    SG     N GNF + + ++ K+D T+ +H+K        KN +  Y  +  QN++I  LA++I   I   +  A++FS+I+D T D   V+Q+++ +R V         +I  Y +E              L    ++I+  RGQ YD  S MSG   GLQ +I    P A+F+ C +H  NL    A +++     FF     +Y F ++S  R  +L+++ KS       TLK++S+TR  +R  A+  +      I   L +I     +     VR EA  L+  +  Y F+  ++   ++L+ +  +S  +Q+   +I+   + I      F  +R+D++FE+         I N  C  L+ E +F  + I+ + R   +    ER +D    P   F+   +  +LDT +  L  RF         F  L    I  E++E  ++  D++    + E   +          S++ ++    Q +E++ F  +  +    PN+A   K+ LT PV  A+ ERSFS+LKIIKN+LR++MT E LS +++I+IE E+A++ + E  +  FAS KSRR+ +
Sbjct:  261 FLAGQCLAFRGS---SGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV---------YIKNYEVE--------------LNYLELNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSL------TLKQVSETRWEARIKAIRPLRNELGEIYDSLIEI---AEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENY------LQISNELCVALETEPDFPAE-ISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLY-KFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRETY 815          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 194.126 bits (492), Expect = 9.122e-51
Identity = 166/598 (27.76%), Postives = 282/598 (47.16%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKF-----EKKNEL--YLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN--CSLLDVETEFKEKRIAKKKRTAGELNRDERADD----PTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQF 2352
            FLA Q L FRG    SG     N GNF + + ++ K+D T+ +H+K        KN +  Y  +  QN++I  LA++I   I   +  A++FS+I+D T D   V+Q++                                ++++++          RGQ YD  S MSG   GLQ +I    P A+F+ C +H  NL    A +++     FF     +Y F ++S  R  +L+++ KS       TLK++S+TR  +R  A+  +      I   L +I     +     VR EA  L+  +  Y F+  ++   ++L+ +  +S  +Q+   +I+   + I      F  +R+D++FE+         I N  C  L+ E +F  + I+ + R   +    ER +D    P   F+   +  +LDT +  L  RF         F  L    I  E++E  ++  D++    + E   +          S++ ++    Q +E++ F  +  +    PN+A   K+ LT PV  A+ ERSFS+LKIIKN+LR++MT E LS +++I+IE E+A++ + E  +  FAS KSRR+ +
Sbjct:  261 FLAGQCLAFRGS---SGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQIT--------------------------------MVISDM----------RGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVKSL------TLKQVSETRWEARIKAIRPLRNELGEIYDSLIEI---AEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENY------LQISNELCVALETEPDFPAE-ISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLY-KFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENEIADSTNIEGAVEEFASKKSRRETY 796          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000047334.1 (SMESG000047334.1)

HSP 1 Score: 181.8 bits (460), Expect = 3.570e-47
Identity = 158/566 (27.92%), Postives = 268/566 (47.35%), Query Frame = 1
Query:  598 FLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDNHLKF-----EKKNEL--YLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTIDISRVDQMSVSLRLV-LKSGQVVERFIDFYTLENSNAAAFSNIILTELQKRNIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVTIAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLKRLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGLSILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNKFADMRSDKAFESLNVAVKSFIIKN--CSLLDVETEFKEKRIAKKK--RTAGELNRDERAD-DPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQISEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKEVLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRSTMTNERLSGL 2256
            FLA Q L FRG    SG     N GNF + + ++ K+D  + +H+K        KN +  YL +  QN++I  LA++I   I   +  A++FS+I+D T D   V+Q+++ +R V +K+ +V                        EL    ++I+  RGQ YD  S MSG    LQ +I    P A+F+ C +H  NL    A +++     FF     +Y   ++S  R  +L+++ KS       TLK++S+T+  +R  A+  +      I   L +I     +     VR EA  L++ +  Y F+  ++   ++L+ +  +S  +Q+   +I+   + I      F  +R+D++FE+         I N  C  L+ E +F  + I + +  R      RDE     P   F+   ++ +LDT +  L  RF         F  L    I  E++E  ++  D++    + E   +          S++ ++    Q +E++ F  +  +    PN+A   K+ LT PV+ A+ ERSFS+LKIIKN+LR++MT ERLS +
Sbjct:  390 FLAGQCLAFRGS---SGILYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMPHYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNYEV------------------------ELNYLELNISDMRGQGYDNGSNMSGKHRRLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAIYNIFSASPFRWQVLKKNVKSL------TLKQVSETQWEARIKAIRPLRNELGEIYDSLIEI---AEESSMPTVRHEAECLAMKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENY------LQISNELCVALETEPDFPAEIIVRSRHHRKQFSYERDEDIQFTPKEHFQISFFYVILDTAISSLTTRFETLSGFERCFGFL-YKFIDMEHEEIKKSCFDLHNKFKDGESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVSVASGERSFSKLKIIKNHLRTSMTQERLSNI 912          
The following BLAST results are available for this feature:
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYM15.315e-3927.68zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.315e-3927.68zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.315e-3927.68zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM15.315e-3927.68zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
THAP124.541e-2022.28THAP domain containing 12 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CR762475.13.289e-7431.06pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
thap12a3.847e-1922.10THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-240b21.23.719e-1244.83si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
thap12b3.651e-1120.98THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043220.11.533e-6431.08pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
tbx182.060e-4228.10T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a63.237e-2427.09solute carrier family 10 (sodium/bile acid cotrans... [more]
thap127.644e-1423.46THAP domain containing 12 [Source:NCBI gene;Acc:39... [more]
znf385c7.016e-619.46zinc finger protein 385C [Source:NCBI gene;Acc:779... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zmym12.537e-3126.26zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym13.189e-3126.26zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym13.189e-3126.26zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Thap122.345e-1821.68THAP domain containing 12 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5SVZ6|ZMYM1_HUMAN2.552e-3827.68Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
sp|O43422|P52K_HUMAN2.181e-1922.2852 kDa repressor of the inhibitor of the protein k... [more]
sp|Q9CUX1|P52K_MOUSE1.640e-1721.6852 kDa repressor of the inhibitor of the protein k... [more]
sp|A6QPH9|ZMYM5_BOVIN1.773e-629.01Zinc finger MYM-type protein 5 OS=Bos taurus OX=99... [more]
back to top
BLAST of TTF-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3ACH62.157e-15744.75Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
A0A452GX583.872e-13943.00Uncharacterized protein OS=Gopherus agassizii OX=3... [more]
W4YS261.150e-12840.37TTF-type domain-containing protein OS=Strongylocen... [more]
W4YYX41.369e-12840.37TTF-type domain-containing protein OS=Strongylocen... [more]
H3A3B13.615e-12640.17DUF4371 domain-containing protein OS=Latimeria cha... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042930.16.083e-9133.95pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000035789.11.020e-8733.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036272.12.336e-7631.80pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000032220.17.371e-6831.14pep primary_assembly:Astyanax_mexicanus-2.0:24:134... [more]
ENSAMXT00000040801.14.075e-6330.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO351582.529e-1341.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293992.529e-1341.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328113.317e-1341.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322473.515e-1341.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351484.435e-1341.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028133.11.399e-7130.91zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.11.399e-7130.91zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.11.399e-7130.91zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000041223.14.325e-4126.84zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
ENSORLT00000027735.19.926e-3535.66pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036749.14.239e-5729.13SMESG000036749.1[more]
SMESG000061124.13.677e-5528.93SMESG000061124.1[more]
SMESG000061124.13.753e-5528.93SMESG000061124.1[more]
SMESG000061124.19.122e-5127.76SMESG000061124.1[more]
SMESG000047334.13.570e-4727.92SMESG000047334.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032853 ID=SMED30032853|Name=TTF-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2488bp
TCATGTGCAGAGAATACTGAGACGAATTTGATACAGTGGAAAAACAACTT
GCTTCAGATATTTTACAAGAACAACTTCTTACTCAATCCGACTTCGCTAC
AGATCCAGGACTCTACATTAATACGAGCATAAGCTCGAAAGTGATACGAA
AATTGTTTGAAATCGGACCATGTCAACCTGGACTCAATGAACCATTTCAA
TTTCCGACAGATGAATTGGGGCGCAAGTTTCAAATTTCATGTTACACAAA
ATGTTTTGGAAAAGGTAGTATGAAGGAGGAAAGAAATTGGCTTGTCTATT
CACCAACAAATCAAAAAATGCATTGCCAAGCTTGCTGGTTATTCGCTGAT
TGTAAAACTGAAAATTATAGCAAGGAATGGTCCGACCCAAATTTTGGAGT
TTATAACTGGAAAAAAGGTATGGAAAAAATTGTTAAACATGAAACTTCCA
ATCAACATCAAAGTGCAATATGCCAATATTTGCTGGCTAAATATCGCATT
TCAAATGAAAAACTGTGATATCTGGTTTGATCAGTCAGGAGCGTTATCAA
GTGGAAAAAAATAGAGAAGTTTTCAAATGAATGGTAGATGCAACGTTTTT
TTAGCAAAACAAGGTTTGCCATTTAGAGGACACAGAGAACATTCTGGCTC
TGACAGGTGTAGTAATACTGGAAATTTTCGTGAATTGCTATTTTTATTGG
CTAAATATGATTTCACTTTGGACAATCATCTAAAGTTTGAAAAGAAAAAT
GAACTTTATTTATGTCATGATGTACAAAATGACCTAATTCAATCACTTGC
CTCTGAAATATCCGCAAATATTGATAAGGAAGTAATGTCTGCACAATTCT
TTTCTCTAATTGTTGATTCAACAATTGATATATCCAGAGTTGATCAGATG
TCAGTTTCTTTAAGATTGGTGTTAAAATCAGGACAAGTTGTTGAACGATT
TATAGACTTCTACACTTTGGAAAACAGTAATGCTGCAGCATTTTCTAATA
TAATATTAACGGAGTTACAAAAGCGAAACATTGACATTACACTTTGTAGA
GGACAGGCATATGATGGTGCCTCTGTGATGTCTGGGATTAAAAATGGTCT
TCAAACTAAAATAAAGACACTTTCACCAAATGCCATCTTTGTCCACTGTT
GTTCTCATGCATCGAATTTGGTGACTATTGCAGCAATGTCTCTTAACAAT
GATGCTCAGTTGTTTTTTGGTACATCAGAAAAGTTGTATACTTTCCTTAC
ATCAAGTCTACCACGACTACATATTCTCGAAGAACATCAGAAGTCTCGAT
ATGAATCGACAGTAGATACTCTAAAACGACTTTCTGATACAAGATTGGCA
AGCCGAAAGCATGCAGTTAATTCAGTTGTTGGATCATTCTCTGCTATTAT
ATCTATTCTAGAAGATATAAATTTTGGGGAATCAAAAGAACACAAAAGAA
ATGTCAGAGCAGAAGCTATGGGACTATCTATTTTGATTACAAAATATTCT
TTTGTTTTTCTGATGCTATTTCTACAAAAGCTGTTAGATAATATCTTTGT
GTTATCAAACTATTTGCAACGAAAGGACATTGATATTGCGTTTGCAAAAC
AATTGATTTATGTTGCCAGAAATAAGTTTGCTGATATGAGAAGTGATAAA
GCTTTTGAAAGTCTAAATGTTGCTGTAAAATCATTTATTATCAAAAATTG
TTCCTTACTAGATGTTGAAACAGAATTTAAAGAAAAGCGAATTGCAAAAA
AGAAACGCACGGCAGGTGAACTTAACAGAGATGAAAGAGCTGATGATCCA
ACTACATGCTTCAAATGTGAAACGTATTTCACTGTCTTGGATACACTTGT
AATACAACTAGATGAACGTTTTAATGATTTTCATAACACTGTTGCTTTAT
TCTCCTGTCTTGATCCATCACAAATATCAGAAGAAAATAAAGAATTTTTT
CAAAATTTATGCGACATTTACAAAAACGATACTAATATTGAAGAAGCAAT
CCTAGAATATGATACTTTCAAATACGTGTATGCATCAATACGCCCATTAC
TATCTTGTGAACTACAACTTAAAGAGGTGCTGCCTTTCTTTGTTGAAAAA
CAGATGGCGCCAGGACTTCCCAATTTGGCAATTCTCTATAAAATATACTT
GACTTTTCCTGTTACATCTGCCACTGCTGAAAGAAGTTTCAGTAGACTGA
AAATCATCAAAAATTATTTGCGATCAACAATGACAAACGAACGTCTGTCT
GGATTAGCATTAATTTCAATAGAACGCGAACTGGCTGAGAACATTGACTT
TGAATCGACTATAAATCGTTTTGCTTCAATGAAATCACGCAGGAAGCAAT
TTAAATAAAGTGGTATGTTTGTTACATCAATAAATTTACTAGAATAAATT
TACTGAATCTTTGCTTTATAATAATATTGGTATTCACTCAATACTCGGGA
AAATGAGTAGTACCATCTTCATAATTTGTGGCGCCCCT
back to top

protein sequence of SMED30032853-orf-1

>SMED30032853-orf-1 ID=SMED30032853-orf-1|Name=SMED30032853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=594bp
MNGRCNVFLAKQGLPFRGHREHSGSDRCSNTGNFRELLFLLAKYDFTLDN
HLKFEKKNELYLCHDVQNDLIQSLASEISANIDKEVMSAQFFSLIVDSTI
DISRVDQMSVSLRLVLKSGQVVERFIDFYTLENSNAAAFSNIILTELQKR
NIDITLCRGQAYDGASVMSGIKNGLQTKIKTLSPNAIFVHCCSHASNLVT
IAAMSLNNDAQLFFGTSEKLYTFLTSSLPRLHILEEHQKSRYESTVDTLK
RLSDTRLASRKHAVNSVVGSFSAIISILEDINFGESKEHKRNVRAEAMGL
SILITKYSFVFLMLFLQKLLDNIFVLSNYLQRKDIDIAFAKQLIYVARNK
FADMRSDKAFESLNVAVKSFIIKNCSLLDVETEFKEKRIAKKKRTAGELN
RDERADDPTTCFKCETYFTVLDTLVIQLDERFNDFHNTVALFSCLDPSQI
SEENKEFFQNLCDIYKNDTNIEEAILEYDTFKYVYASIRPLLSCELQLKE
VLPFFVEKQMAPGLPNLAILYKIYLTFPVTSATAERSFSRLKIIKNYLRS
TMTNERLSGLALISIERELAENIDFESTINRFASMKSRRKQFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding