Protein yippee-like

Overview
NameProtein yippee-like
Smed IDSMED30032842
Length (bp)598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein yippee-like (SMED30032842) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein yippee-like (SMED30032842) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein yippee-like (SMED30032842) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein yippee-like (SMED30032842) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032842

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032842SMESG000074324.1 dd_Smed_v4_2853_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032842SMESG000074331.1 SMESG000074324.1 Contig45669newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032842SMESG000074331.1 SMESG000074324.1 Contig45669uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL5 (yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329])

HSP 1 Score: 166.777 bits (421), Expect = 7.873e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL5 (yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329])

HSP 1 Score: 166.777 bits (421), Expect = 7.873e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL5 (yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329])

HSP 1 Score: 166.777 bits (421), Expect = 7.873e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL5 (yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329])

HSP 1 Score: 166.777 bits (421), Expect = 7.873e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Human
Match: YPEL5 (yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329])

HSP 1 Score: 166.777 bits (421), Expect = 7.873e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.3 (pep chromosome:WBcel235:IV:3379355:3382834:-1 gene:WBGene00015250.1 transcript:B0546.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0546.3)

HSP 1 Score: 116.316 bits (290), Expect = 1.252e-30
Identity = 55/112 (49.11%), Postives = 73/112 (65.18%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            MG+ F E+ GG ++  C  CDT L++K  ++ST F+G TG+AFLF  V N+   E   R MLTG H VRDV C  C  +LGW+YE A +++++YKEG VILER    E E F
Sbjct:    1 MGLKFFENAGGLKMFFCTNCDTYLADKGHLVSTSFTGTTGQAFLFKNVTNVKFGESVVRNMLTGAHFVRDVFCQSCRAQLGWMYELAPNDNEKYKEGSVILERMNITEREAF 112          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.4 (Protein yippee-like B0546.4 [Source:UniProtKB/Swiss-Prot;Acc:O44440])

HSP 1 Score: 98.9821 bits (245), Expect = 3.412e-26
Identity = 54/123 (43.90%), Postives = 71/123 (57.72%), Query Frame = 1
Query:   58 MGILFIEHLGGK-RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEG-FKDPLGADKK 420
            MG  F    G +  +  C  C+T L+   E+ S  F+G+TG A LF +  N+     E R M TG H VRDV C+ C+ KLGW+YE A  ESQ YKE +VI+E   F +  G  KDPLG D++
Sbjct:    1 MGRQFAGICGARGSLYGCVVCNTYLTCSKELTSKAFTGSTGPATLFKRAWNVVYGRCEHRKMTTGWHTVRDVFCVTCNQKLGWMYEMAVSESQTYKETQVIIENANFEKIAGAIKDPLGEDRQ 123          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: B0546.4 (Protein yippee-like B0546.4 [Source:UniProtKB/Swiss-Prot;Acc:O44440])

HSP 1 Score: 97.8265 bits (242), Expect = 3.823e-26
Identity = 54/122 (44.26%), Postives = 70/122 (57.38%), Query Frame = 1
Query:   58 MGILFIEHLGGK-RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEG-FKDPLGADK 417
            MG  F    G +  +  C  C+T L+   E+ S  F+G+TG A LF +  N+     E R M TG H VRDV C+ C+ KLGW+YE A  ESQ YKE +VI+E   F +  G  KDPLG D+
Sbjct:    1 MGRQFAGICGARGSLYGCVVCNTYLTCSKELTSKAFTGSTGPATLFKRAWNVVYGRCEHRKMTTGWHTVRDVFCVTCNQKLGWMYEMAVSESQTYKETQVIIENANFEKIAGAIKDPLGEDR 122          
BLAST of Protein yippee-like vs. Ensembl Celegans
Match: F37A8.5 (Protein yippee-like F37A8.5 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3G6])

HSP 1 Score: 93.2041 bits (230), Expect = 3.013e-24
Identity = 45/105 (42.86%), Postives = 61/105 (58.10%), Query Frame = 1
Query:   85 GGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKD 399
             G R   C  C   L+   E+IS  F G+ G+A+LFN VVN+     E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G+ +
Sbjct:   29 AGDRCYSCIHCRANLAAHAELISKSFQGSQGKAYLFNAVVNVGCGPAEERVLLTGLHAVADIYCEICKTTLGWKYEHAFESSQKYKEGKFIIELAHMVKDNGWDE 133          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: Yippee (gene:FBgn0026749 transcript:FBtr0073789)

HSP 1 Score: 149.828 bits (377), Expect = 1.791e-46
Identity = 66/114 (57.89%), Postives = 88/114 (77.19%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKD 399
            MG +F+EHLGG ++  C  C T L+N+ ++ISTRF+GATGRA+LF +VVN+  + +++RVMLTGRH+VRDV C  C  KLGW+YE A +ESQ+YKEG+VILE  L  E+EGF  
Sbjct:    1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKYKEGRVILEYALITEAEGFPS 114          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: Yippee (gene:FBgn0026749 transcript:FBtr0100168)

HSP 1 Score: 127.102 bits (318), Expect = 1.014e-37
Identity = 58/112 (51.79%), Postives = 80/112 (71.43%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            MG +F+EHLGG ++  C  C T L+N+ ++ISTRF+GATGRA+LF +VVN+  + +++RVMLTGRH+VRDV C  C  KLGW+YE A +ESQ++    V  +RQL     G 
Sbjct:    1 MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKW----VNADRQLVTRDSGL 108          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0332899)

HSP 1 Score: 95.5153 bits (236), Expect = 2.506e-25
Identity = 45/100 (45.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L++ DE+IS  F G+ G A+LFN VVN+   + E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G+
Sbjct:   14 RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGW 113          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0112974)

HSP 1 Score: 95.5153 bits (236), Expect = 2.506e-25
Identity = 45/100 (45.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L++ DE+IS  F G+ G A+LFN VVN+   + E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G+
Sbjct:   14 RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGW 113          
BLAST of Protein yippee-like vs. Ensembl Fly
Match: CG15309 (gene:FBgn0030183 transcript:FBtr0071487)

HSP 1 Score: 95.5153 bits (236), Expect = 2.506e-25
Identity = 45/100 (45.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L++ DE+IS  F G+ G A+LFN VVN+   + E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G+
Sbjct:   14 RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGW 113          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel5 (yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1220])

HSP 1 Score: 166.777 bits (421), Expect = 5.008e-53
Identity = 75/119 (63.03%), Postives = 98/119 (82.35%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGAD 414
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSD 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel3 (yippee-like 3 [Source:NCBI gene;Acc:368214])

HSP 1 Score: 99.7525 bits (247), Expect = 6.878e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKFIIELSHMIKDNGW 118          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel3 (yippee-like 3 [Source:NCBI gene;Acc:368214])

HSP 1 Score: 99.7525 bits (247), Expect = 6.878e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKFIIELSHMIKDNGW 118          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel1 (yippee-like 1 [Source:ZFIN;Acc:ZDB-GENE-040808-41])

HSP 1 Score: 99.3673 bits (246), Expect = 1.154e-26
Identity = 47/101 (46.53%), Postives = 62/101 (61.39%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            R   C  C   L+N DE+IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G++
Sbjct:   19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Match: ypel1 (yippee-like 1 [Source:ZFIN;Acc:ZDB-GENE-040808-41])

HSP 1 Score: 99.3673 bits (246), Expect = 1.154e-26
Identity = 47/101 (46.53%), Postives = 62/101 (61.39%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            R   C  C   L+N DE+IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G++
Sbjct:   19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: bmp5 (bone morphogenetic protein 5 [Source:Xenbase;Acc:XB-GENE-479371])

HSP 1 Score: 166.777 bits (421), Expect = 7.137e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: ypel1 (yippee like 1 [Source:NCBI gene;Acc:549459])

HSP 1 Score: 99.3673 bits (246), Expect = 1.644e-26
Identity = 47/101 (46.53%), Postives = 62/101 (61.39%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            R   C  C   L+N DE+IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D++C  C   LGW YE A + SQ+YKEGK I+E     +  G++
Sbjct:   19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: YPEL2 (yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326])

HSP 1 Score: 87.4261 bits (215), Expect = 6.742e-22
Identity = 40/90 (44.44%), Postives = 54/90 (60.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 363
            R   C  C   L+N DE+IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D++C  C   LGW Y  + + SQ++K G  + E
Sbjct:   19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYFHSINTSQKFKTGGYLFE 108          
BLAST of Protein yippee-like vs. Ensembl Xenopus
Match: YPEL2 (yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326])

HSP 1 Score: 78.9518 bits (193), Expect = 1.034e-18
Identity = 36/77 (46.75%), Postives = 45/77 (58.44%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQAND 324
            R   C  C   L+N DE+IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D++C  C   LGW Y  A  
Sbjct:   19 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYPYATS 95          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel5 (yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937])

HSP 1 Score: 166.777 bits (421), Expect = 5.405e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel5 (yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937])

HSP 1 Score: 166.777 bits (421), Expect = 5.405e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel5 (yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937])

HSP 1 Score: 166.777 bits (421), Expect = 5.405e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 101.679 bits (252), Expect = 1.410e-27
Identity = 48/100 (48.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D+HC  C   LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGW 118          
BLAST of Protein yippee-like vs. Ensembl Mouse
Match: Ypel3 (yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340])

HSP 1 Score: 101.679 bits (252), Expect = 1.410e-27
Identity = 48/100 (48.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+RV+LTG H V D+HC  C   LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGW 118          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|Q5RDU7|YPEL5_PONAB (Protein yippee-like 5 OS=Pongo abelii OX=9601 GN=YPEL5 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.781e-52
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|P62700|YPEL5_MOUSE (Protein yippee-like 5 OS=Mus musculus OX=10090 GN=Ypel5 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.781e-52
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|P62699|YPEL5_HUMAN (Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.781e-52
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|Q65Z55|YPEL5_CHLAE (Protein yippee-like 5 OS=Chlorocebus aethiops OX=9534 GN=YPEL5 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.781e-52
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. UniProt/SwissProt
Match: sp|Q3ZBE7|YPEL5_BOVIN (Protein yippee-like 5 OS=Bos taurus OX=9913 GN=YPEL5 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.781e-52
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A095AUP4 (Protein yippee-like (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_06597 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.118e-57
Identity = 84/120 (70.00%), Postives = 103/120 (85.83%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADK 417
            MG +FIEH+GG RII CQ C+TPL+N+ EI+STRF+GATGRAFLFN+VVNI  ++++DRVMLTGRHLVRDV CIKC+ KLGW+YE A +ESQ+YKEGKVILER L  E+EG  DPLG ++
Sbjct:    1 MGRIFIEHMGGHRIIHCQYCETPLTNRSEILSTRFTGATGRAFLFNRVVNIVHSDIQDRVMLTGRHLVRDVVCIKCNTKLGWMYEHAMEESQRYKEGKVILERALIMETEGLADPLGEEQ 120          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A430Q4V8 (Protein yippee-like OS=Schistosoma bovis OX=6184 GN=DC041_0003311 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.118e-57
Identity = 84/120 (70.00%), Postives = 103/120 (85.83%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADK 417
            MG +FIEH+GG RII CQ C+TPL+N+ EI+STRF+GATGRAFLFN+VVNI  ++++DRVMLTGRHLVRDV CIKC+ KLGW+YE A +ESQ+YKEGKVILER L  E+EG  DPLG ++
Sbjct:    1 MGRIFIEHMGGHRIIHCQYCETPLTNRSEILSTRFTGATGRAFLFNRVVNIVHSDIQDRVMLTGRHLVRDVVCIKCNTKLGWMYEHAMEESQRYKEGKVILERALIMETEGLADPLGEEQ 120          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A146MHE5 (Protein yippee-like OS=Schistosoma mansoni OX=6183 GN=c18726_g1_i1 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.118e-57
Identity = 84/120 (70.00%), Postives = 103/120 (85.83%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADK 417
            MG +FIEH+GG RII CQ C+TPL+N+ EI+STRF+GATGRAFLFN+VVNI  ++++DRVMLTGRHLVRDV CIKC+ KLGW+YE A +ESQ+YKEGKVILER L  E+EG  DPLG ++
Sbjct:    1 MGRIFIEHMGGHRIIHCQYCETPLTNRSEILSTRFTGATGRAFLFNRVVNIVHSDIQDRVMLTGRHLVRDVVCIKCNTKLGWMYEHAMEESQRYKEGKVILERALIMETEGLADPLGEEQ 120          
BLAST of Protein yippee-like vs. TrEMBL
Match: C1LK68 (Protein yippee-like OS=Schistosoma japonicum OX=6182 GN=EWB00_007789 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.118e-57
Identity = 84/120 (70.00%), Postives = 103/120 (85.83%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADK 417
            MG +FIEH+GG RII CQ C+TPL+N+ EI+STRF+GATGRAFLFN+VVNI  ++++DRVMLTGRHLVRDV CIKC+ KLGW+YE A +ESQ+YKEGKVILER L  E+EG  DPLG ++
Sbjct:    1 MGRIFIEHMGGHRIIHCQYCETPLTNRSEILSTRFTGATGRAFLFNRVVNIVHSDIQDRVMLTGRHLVRDVVCIKCNTKLGWMYEHAMEESQRYKEGKVILERALIMETEGLADPLGEEQ 120          
BLAST of Protein yippee-like vs. TrEMBL
Match: A0A5J4N555 (Protein yippee-like OS=Paragonimus westermani OX=34504 GN=DEA37_0000546 PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.771e-57
Identity = 85/119 (71.43%), Postives = 102/119 (85.71%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGAD 414
            MG +FIEHLGG++II CQ C+TPLSN+ EI+STRF+GATGRAFLFN+VVNI  +E++DRVMLTGRH VRDV CIKC+ KLGW+YE A +ESQ+YKEGKVILER L  E+EG  DPLG +
Sbjct:    1 MGRIFIEHLGGQKIIHCQYCETPLSNRSEILSTRFTGATGRAFLFNRVVNIVYSEIQDRVMLTGRHFVRDVVCIKCNTKLGWMYEHALEESQRYKEGKVILERALIMETEGIADPLGEN 119          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ENSAMXT00000025264.2 (protein yippee-like 5 [Source:NCBI gene;Acc:103045954])

HSP 1 Score: 166.777 bits (421), Expect = 3.338e-53
Identity = 75/119 (63.03%), Postives = 98/119 (82.35%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGAD 414
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHIPSD 119          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: YPEL5 (protein yippee-like 5 [Source:NCBI gene;Acc:103028910])

HSP 1 Score: 166.777 bits (421), Expect = 4.244e-53
Identity = 75/119 (63.03%), Postives = 98/119 (82.35%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGAD 414
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSD 119          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: YPEL5 (protein yippee-like 5 [Source:NCBI gene;Acc:103028910])

HSP 1 Score: 155.992 bits (393), Expect = 9.337e-49
Identity = 69/105 (65.71%), Postives = 88/105 (83.81%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQL 372
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERAL 105          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel3 (protein yippee-like 3 [Source:NCBI gene;Acc:103040367])

HSP 1 Score: 100.138 bits (248), Expect = 7.527e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   41 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGW 140          
BLAST of Protein yippee-like vs. Ensembl Cavefish
Match: ypel3 (protein yippee-like 3 [Source:NCBI gene;Acc:103040367])

HSP 1 Score: 100.138 bits (248), Expect = 9.763e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   47 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGW 146          
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Match: ypel5 (yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1220])

HSP 1 Score: 164.851 bits (416), Expect = 3.927e-53
Identity = 74/119 (62.18%), Postives = 98/119 (82.35%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGAD 414
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGW+YE A +++Q+YKEG+VILER L  ESEGF++ + AD
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLSFSEVQDRVMLTGRHMVRDVSCKNCNSKLGWMYEFATEDNQRYKEGRVILERALVRESEGFEEHVPAD 119          
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003901.1 (pep scaffold:Pmarinus_7.0:GL476703:5356:9476:-1 gene:ENSPMAG00000003573.1 transcript:ENSPMAT00000003901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.014e-12
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  202 VNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            VN+     E+R++LTG H V D++C  C+  LGW YE A + SQ+YKEGK I+E     +  G++
Sbjct:   57 VNVGCGPAEERLLLTGLHAVADIYCENCNTTLGWKYEHAFESSQKYKEGKYIIEVAHMIKDNGWE 121          
BLAST of Protein yippee-like vs. Ensembl Yeast
Match: MOH1 (Protein of unknown function, essential for stationary phase survival; not required for growth on nonfermentable carbon sources; possibly linked with vacuolar transport [Source:SGD;Acc:S000000145])

HSP 1 Score: 87.8113 bits (216), Expect = 5.665e-23
Identity = 44/92 (47.83%), Postives = 61/92 (66.30%), Query Frame = 1
Query:  106 CQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCE 381
            C+ C T LS+  +IIS  + G TG A+L NKVVN+   ++E R MLTG +LV D+ C  C   +GW Y Q++++ QQYKEGK ILE +  C+
Sbjct:   45 CRHCKTHLSSSFQIISRDYRGRTGTAYLMNKVVNVVEGKVEQRRMLTGDYLVCDILCHWCKRNVGWKYLQSSNDDQQYKEGKFILELKNICK 136          
BLAST of Protein yippee-like vs. Ensembl Nematostella
Match: EDO44220 (Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:A7RW79])

HSP 1 Score: 155.221 bits (391), Expect = 4.549e-49
Identity = 69/114 (60.53%), Postives = 91/114 (79.82%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKD 399
            MG +F++H GG ++  C  CDT L+N+ E+IS RF+GATGRAFLF+KVVN+  +E++DRVMLTGRH+VRDV C  C  KLGW+YE A +E+Q+YKEG+VILER L  ESEG ++
Sbjct:    1 MGRIFLDHPGGSKLYSCANCDTVLTNRSELISMRFTGATGRAFLFHKVVNLSYSEVQDRVMLTGRHMVRDVSCKNCDTKLGWMYEYATEENQRYKEGRVILERALVTESEGIEE 114          
BLAST of Protein yippee-like vs. Ensembl Nematostella
Match: EDO47518 (Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:A7RM06])

HSP 1 Score: 97.4413 bits (241), Expect = 1.898e-26
Identity = 48/101 (47.52%), Postives = 62/101 (61.39%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            R   C  C   L+N DE+IS  F G+ GRA+LFNKVVN+     E+RV+LTG H V D+ C  C   LGW YE A + SQ+YKEGK I+E     +  G++
Sbjct:   14 RTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNKVVNVGCGPAEERVLLTGLHAVSDIFCECCKTTLGWKYEHAFEISQKYKEGKYIIEMAHMIKDNGWE 114          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypel5 (yippee like 5 [Source:NCBI gene;Acc:100529201])

HSP 1 Score: 166.777 bits (421), Expect = 4.218e-53
Identity = 75/121 (61.98%), Postives = 98/121 (80.99%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKK 420
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGWIYE A ++SQ+YKEG+VILER L  ESEGF++ + +D  
Sbjct:    1 MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS 121          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypelb (yippee-like b [Source:NCBI gene;Acc:100049287])

HSP 1 Score: 164.466 bits (415), Expect = 3.362e-52
Identity = 74/113 (65.49%), Postives = 94/113 (83.19%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFK 396
            MG +F++H+GG R+  C  CDT L+N+ E+ISTRF+GATGRAFLFNKVVN+  +E++DRVMLTGRH+VRDV C  C+ KLGW+YE A +ESQ+YKEG+VILER L  ESEGF+
Sbjct:    1 MGRIFLDHIGGSRLFSCGTCDTVLTNRAELISTRFTGATGRAFLFNKVVNLQHSEIQDRVMLTGRHMVRDVSCKNCNSKLGWMYEFATEESQRYKEGRVILERALVKESEGFE 113          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 100.138 bits (248), Expect = 5.257e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGW 118          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 100.138 bits (248), Expect = 5.257e-27
Identity = 47/100 (47.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGF 393
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E     +  G+
Sbjct:   19 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIELSHMIKDNGW 118          
BLAST of Protein yippee-like vs. Ensembl Medaka
Match: ypela (yippee-like a [Source:NCBI gene;Acc:100049286])

HSP 1 Score: 99.7525 bits (247), Expect = 7.552e-27
Identity = 46/90 (51.11%), Postives = 60/90 (66.67%), Query Frame = 1
Query:   94 RIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 363
            R   C  C   L+N D++IS  F G+ GRA+LFN VVN+     E+R++LTG H V D++C  CH  LGW YEQA + SQ+YKEGK I+E
Sbjct:   19 RRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLHAVADIYCENCHTTLGWKYEQAFELSQKYKEGKYIIE 108          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000074324.1 (SMESG000074324.1)

HSP 1 Score: 270.396 bits (690), Expect = 4.000e-94
Identity = 129/129 (100.00%), Postives = 129/129 (100.00%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSDNRSDVP 444
            MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSDNRSDVP
Sbjct:    1 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSDNRSDVP 129          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000074331.1 (SMESG000074331.1)

HSP 1 Score: 263.848 bits (673), Expect = 1.380e-91
Identity = 125/129 (96.90%), Postives = 127/129 (98.45%), Query Frame = 1
Query:   58 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSDNRSDVP 444
            MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSG TGRAFLFNKVVNIYSTEL+DR+MLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSD RSDVP
Sbjct:    1 MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGVTGRAFLFNKVVNIYSTELQDRLMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILERQLFCESEGFKDPLGADKKSDTRSDVP 129          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000011702.1 (SMESG000011702.1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.711e-25
Identity = 49/109 (44.95%), Postives = 63/109 (57.80%), Query Frame = 1
Query:   37 FKIYFYDMGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 363
            FK+Y  D             +  C  C   L+  D +IS  F G+ GRA+LF+ VVN+ S + EDRV+LTG H V D+ C  C   LGW YEQA + SQ+YKEGK I+E
Sbjct:    5 FKVYLGDKS-------SNNPVYSCAHCRAHLAKHDNLISKSFQGSQGRAYLFDSVVNVASGKPEDRVLLTGLHSVADIKCECCRTVLGWKYEQAFEPSQKYKEGKFIIE 106          
BLAST of Protein yippee-like vs. Planmine SMEST
Match: SMESG000069906.1 (SMESG000069906.1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.948e-20
Identity = 42/89 (47.19%), Postives = 59/89 (66.29%), Query Frame = 1
Query:   97 IIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVNIYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVILE 363
            I  C  C   L++  ++IS  F G+ GRA+LFN VVN+ S   E+R++LTG H V D++C  C   LGW YE+A + +Q+YKEGK I+E
Sbjct:   19 IYSCIHCRANLAHHRDLISKSFQGSQGRAYLFNNVVNVGSLVAEERMLLTGLHYVADIYCECCSFILGWKYERAFEPNQRYKEGKYIIE 107          
The following BLAST results are available for this feature:
BLAST of Protein yippee-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YPEL57.873e-5361.98yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329][more]
YPEL57.873e-5361.98yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329][more]
YPEL57.873e-5361.98yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329][more]
YPEL57.873e-5361.98yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329][more]
YPEL57.873e-5361.98yippee like 5 [Source:HGNC Symbol;Acc:HGNC:18329][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
B0546.31.252e-3049.11pep chromosome:WBcel235:IV:3379355:3382834:-1 gene... [more]
B0546.43.412e-2643.90Protein yippee-like B0546.4 [Source:UniProtKB/Swi... [more]
B0546.43.823e-2644.26Protein yippee-like B0546.4 [Source:UniProtKB/Swi... [more]
F37A8.53.013e-2442.86Protein yippee-like F37A8.5 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Yippee1.791e-4657.89gene:FBgn0026749 transcript:FBtr0073789[more]
Yippee1.014e-3751.79gene:FBgn0026749 transcript:FBtr0100168[more]
CG153092.506e-2545.00gene:FBgn0030183 transcript:FBtr0332899[more]
CG153092.506e-2545.00gene:FBgn0030183 transcript:FBtr0112974[more]
CG153092.506e-2545.00gene:FBgn0030183 transcript:FBtr0071487[more]
back to top
BLAST of Protein yippee-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ypel55.008e-5363.03yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-122... [more]
ypel36.878e-2747.00yippee-like 3 [Source:NCBI gene;Acc:368214][more]
ypel36.878e-2747.00yippee-like 3 [Source:NCBI gene;Acc:368214][more]
ypel11.154e-2646.53yippee-like 1 [Source:ZFIN;Acc:ZDB-GENE-040808-41][more]
ypel11.154e-2646.53yippee-like 1 [Source:ZFIN;Acc:ZDB-GENE-040808-41][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bmp57.137e-5361.98bone morphogenetic protein 5 [Source:Xenbase;Acc:X... [more]
ypel11.644e-2646.53yippee like 1 [Source:NCBI gene;Acc:549459][more]
YPEL26.742e-2244.44yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326][more]
YPEL21.034e-1846.75yippee like 2 [Source:HGNC Symbol;Acc:HGNC:18326][more]
back to top
BLAST of Protein yippee-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ypel55.405e-5361.98yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937][more]
Ypel55.405e-5361.98yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937][more]
Ypel55.405e-5361.98yippee like 5 [Source:MGI Symbol;Acc:MGI:1916937][more]
Ypel31.410e-2748.00yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
Ypel31.410e-2748.00yippee like 3 [Source:MGI Symbol;Acc:MGI:1913340][more]
back to top
BLAST of Protein yippee-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RDU7|YPEL5_PONAB3.781e-5261.98Protein yippee-like 5 OS=Pongo abelii OX=9601 GN=Y... [more]
sp|P62700|YPEL5_MOUSE3.781e-5261.98Protein yippee-like 5 OS=Mus musculus OX=10090 GN=... [more]
sp|P62699|YPEL5_HUMAN3.781e-5261.98Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=Y... [more]
sp|Q65Z55|YPEL5_CHLAE3.781e-5261.98Protein yippee-like 5 OS=Chlorocebus aethiops OX=9... [more]
sp|Q3ZBE7|YPEL5_BOVIN3.781e-5261.98Protein yippee-like 5 OS=Bos taurus OX=9913 GN=YPE... [more]
back to top
BLAST of Protein yippee-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095AUP41.118e-5770.00Protein yippee-like (Fragment) OS=Schistosoma haem... [more]
A0A430Q4V81.118e-5770.00Protein yippee-like OS=Schistosoma bovis OX=6184 G... [more]
A0A146MHE51.118e-5770.00Protein yippee-like OS=Schistosoma mansoni OX=6183... [more]
C1LK681.118e-5770.00Protein yippee-like OS=Schistosoma japonicum OX=61... [more]
A0A5J4N5552.771e-5771.43Protein yippee-like OS=Paragonimus westermani OX=3... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025264.23.338e-5363.03protein yippee-like 5 [Source:NCBI gene;Acc:103045... [more]
YPEL54.244e-5363.03protein yippee-like 5 [Source:NCBI gene;Acc:103028... [more]
YPEL59.337e-4965.71protein yippee-like 5 [Source:NCBI gene;Acc:103028... [more]
ypel37.527e-2747.00protein yippee-like 3 [Source:NCBI gene;Acc:103040... [more]
ypel39.763e-2747.00protein yippee-like 3 [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ypel53.927e-5362.18yippee-like 5 [Source:ZFIN;Acc:ZDB-GENE-040426-122... [more]
ENSPMAT00000003901.11.014e-1243.08pep scaffold:Pmarinus_7.0:GL476703:5356:9476:-1 ge... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MOH15.665e-2347.83Protein of unknown function, essential for station... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO442204.549e-4960.53Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO475181.898e-2647.52Protein yippee-like [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Protein yippee-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ypel54.218e-5361.98yippee like 5 [Source:NCBI gene;Acc:100529201][more]
ypelb3.362e-5265.49yippee-like b [Source:NCBI gene;Acc:100049287][more]
ypela5.257e-2747.00yippee-like a [Source:NCBI gene;Acc:100049286][more]
ypela5.257e-2747.00yippee-like a [Source:NCBI gene;Acc:100049286][more]
ypela7.552e-2751.11yippee-like a [Source:NCBI gene;Acc:100049286][more]
back to top
BLAST of Protein yippee-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000074324.14.000e-94100.00SMESG000074324.1[more]
SMESG000074331.11.380e-9196.90SMESG000074331.1[more]
SMESG000011702.12.711e-2544.95SMESG000011702.1[more]
SMESG000069906.12.948e-2047.19SMESG000069906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032842 ID=SMED30032842|Name=Protein yippee-like|organism=Schmidtea mediterranea sexual|type=transcript|length=598bp
AGTAGTTAGTCAGCTGATTAAGTTAATTAATAACATTTTAAAATTTATTT
TTATGATATGGGAATTTTGTTTATTGAACATTTAGGCGGCAAAAGAATAA
TTCAGTGCCAAGCTTGTGATACTCCATTATCTAATAAAGACGAAATAATT
AGTACTAGATTCAGTGGTGCTACAGGACGAGCATTTTTATTTAATAAAGT
CGTCAATATTTATTCTACTGAATTAGAAGACAGAGTAATGTTGACAGGGC
GTCATTTAGTAAGAGATGTTCATTGCATTAAATGCCACGTTAAACTAGGT
TGGATTTATGAACAAGCGAATGATGAAAGTCAGCAGTACAAGGAAGGCAA
AGTGATCCTTGAAAGGCAACTGTTTTGTGAATCAGAGGGATTTAAAGATC
CTCTTGGTGCAGATAAAAAATCTGATAATCGTTCTGATGTTCCATAATAA
CAATATTAACTGTTTCATTTGTAAATAACCCTGATCATTGAGAAATATTT
AATCTTAATTACTAATATTTTTAATTAAGGAAAAGGAAAAATCAAATGTA
AACTCTAAGCTTTACAAAAATTTGCAAAATAATGGTTTTAAAGATTAC
back to top

protein sequence of SMED30032842-orf-1

>SMED30032842-orf-1 ID=SMED30032842-orf-1|Name=SMED30032842-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MGILFIEHLGGKRIIQCQACDTPLSNKDEIISTRFSGATGRAFLFNKVVN
IYSTELEDRVMLTGRHLVRDVHCIKCHVKLGWIYEQANDESQQYKEGKVI
LERQLFCESEGFKDPLGADKKSDNRSDVP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR039058Yippee_fam
IPR034751Yippee
IPR004910Yippee/Mis18/Cereblon
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 84..104
NoneNo IPR availablePANTHERPTHR13848:SF58PROTEIN YIPPEE-LIKE 5coord: 1..119
IPR004910Yippee/Mis18/CereblonPFAMPF03226Yippee-Mis18coord: 14..106
e-value: 9.1E-13
score: 48.3
IPR039058Yippee familyPANTHERPTHR13848FAMILY NOT NAMEDcoord: 1..119
IPR034751Yippee domainPROSITEPS51792YIPPEEcoord: 13..110
score: 43.284