Neurotrypsin

Overview
NameNeurotrypsin
Smed IDSMED30032823
Length (bp)7054
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurotrypsin (SMED30032823) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurotrypsin (SMED30032823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurotrypsin (SMED30032823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurotrypsin (SMED30032823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 91

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30032823SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30032823SMESG000016088.1 dd_Smed_v6_790_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000077556.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000043973.1 SMESG000041346.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000007021.1 SMESG000073618.1 Contig30565newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000077556.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000043973.1 SMESG000041346.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000007021.1 SMESG000073618.1 Contig30565uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032823SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032823SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032823SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032823SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032823SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032823SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30032823SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30032823SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032823SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
gutSMED30032823SMESG000016088.1 dd_Smed_v4_790_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032823SMESG000016088.1 dd_Smed_v4_790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032823SMESG000016088.1 dd_Smed_v4_790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032823SMESG000016088.1 dd_Smed_v4_790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032823SMESG000016088.1 dd_Smed_v4_790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032823SMESG000016088.1 dd_790dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Smed sexual biotypeSMED30032823SMESG000003949.1 Contig31582newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000003949.1 Contig31582uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000016088.1 Contig42529newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000016088.1 Contig42529uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000016088.1 Contig37510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000016088.1 Contig37510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081696.1 Contig17718newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081696.1 Contig17718uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30032823SMESG000016088.1 dd_Smed_v6_790_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032823SMESG000063435.1 OX_Smed_1.0.18836ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30032823SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30032823SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071434.1 SMESG000068262.1 SMESG000067334.1 SMESG000064600.1 SMESG000050479.1 SMESG000044971.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000022791.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000009106.1 SMESG000007021.1 SMESG000018675.1 Contig46895newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071434.1 SMESG000068262.1 SMESG000067334.1 SMESG000064600.1 SMESG000050479.1 SMESG000044971.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000022791.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000009106.1 SMESG000007021.1 SMESG000018675.1 Contig46895uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000068262.1 SMESG000051528.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000015216.1 SMESG000007021.1 Contig55839newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000068262.1 SMESG000051528.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000015216.1 SMESG000007021.1 Contig55839uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30032823SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032823SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032823SMESG000081078.1 SMESG000069853.1 SMESG000045007.1 SMESG000016710.1 SMESG000016305.1 SMESG000002984.1 SMESG000078601.1 SMESG000062504.1 SMESG000047126.1 SMESG000040474.1 SMESG000029537.1 dd_Smed_v4_199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020523.1 SMESG000020398.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 Contig13279newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020523.1 SMESG000020398.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 Contig13279uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000077556.1 SMESG000067334.1 SMESG000063632.1 SMESG000054682.1 SMESG000054673.1 SMESG000049555.1 SMESG000049554.1 SMESG000049551.1 SMESG000040257.1 SMESG000015216.1 Contig14346newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000077556.1 SMESG000067334.1 SMESG000063632.1 SMESG000054682.1 SMESG000054673.1 SMESG000049555.1 SMESG000049554.1 SMESG000049551.1 SMESG000040257.1 SMESG000015216.1 Contig14346uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032823SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30032823SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurotrypsin vs. Ensembl Human
Match: PRSS12 (serine protease 12 [Source:HGNC Symbol;Acc:HGNC:9477])

HSP 1 Score: 303.908 bits (777), Expect = 8.077e-86
Identity = 199/551 (36.12%), Postives = 285/551 (51.72%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYAR---PKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVCKVNG-VYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +T     IRL G    +EG++EV Y+G+WG VCDDG+      VVC+QLGF    ++   + N F ++  P + +D++ C+G E    +C    W  H+C   E                                D +  C  G +         V L DG + K GRVE+   G  GT+CDD + DKDAAVICR L   G A+A     FGEG G I +DN+KCTG E +L +C     G H C H ED GVIC   D    +    + K   ++   CG R +  ++ R++GG  ++ G +PWQV +R K    D    CGA++LS  W++ AAHC+ R       Y VR GD+     +++E+   ++++++H  +     DYD AL++++  +    +F+++V P CLP     P    S C ++GWGDT   Y   L  A +PL+    C E YKGR T RM CAG  +E   +D+CQGDSGGPL+C+  G  + ++G TSWG GC    +PGVY K+   + WIK  T L
Sbjct:  368 NCGHKEDAGVSCTPLT--DGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQA---SANHFEESTGP-IWLDDVSCSGKETRFLQCSRRQWGRHDCSHRE--------------------------------DVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC---DYFGKKASGNSNKESLSS--VCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL 875          

HSP 2 Score: 140.969 bits (354), Expect = 7.255e-33
Identity = 90/262 (34.35%), Postives = 130/262 (49.62%), Query Frame = 1
Query: 2125 IDCTTVTFPPFEI-RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            + C+    P F I RL G  + +EG+VE+ + G+WG VCDD +D   AEV+C+QLG  G  ++ H A   FG+   P +++DE++CTG E S+E+C  S W  HNC   E AGV C                                +DG           + LA G  +  GR+E+   G  GTVCDD + + +  V+CR L      QA  +  F E  G I LD++ C+G+E     C   +WG H C+H+ED+ + C
Sbjct:  267 VTCSFSHGPTFPIIRLAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAY--FGEGSGP-VMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC-----------------------------TPLTDGV----------IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASAN-HFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIAC 485          

HSP 3 Score: 129.028 bits (323), Expect = 4.306e-29
Identity = 93/275 (33.82%), Postives = 121/275 (44.00%), Query Frame = 1
Query: 2107 GDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVV 2928
            GD   ++D          +RL G  N++EG VEV   G WG VC   +D   A V+C QL   G   +  +  +  G      +    ++C G E ++  C+   W+   C     A V C      T    R                                    LA G     GRVEL   G  GTVCDD +DD DA VICR L + G A+A     FGEG+G ++LD ++CTG EL++E CP   WGEH C HKED GV C  L D V+
Sbjct:  152 GDARGKVDWGYCDCRHGSVRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLI---PIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIR------------------------------------LAGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVI 387          

HSP 4 Score: 70.8626 bits (172), Expect = 3.189e-11
Identity = 48/109 (44.04%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  358 IIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSC 675
            IIRL G +++  +EGRVE+Y +    WG VCDD W+  DA V CRQLG    A+ A  Q  +G G   V    + +++CTGNE S+  CP  S     C  K  AGVSC
Sbjct:  279 IIRLAGGSSV--HEGRVELYHAGQ--WGTVCDDQWDDADAEVICRQLGLSGIAK-AWHQAYFGEGSGPV---MLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 379          

HSP 5 Score: 65.0846 bits (157), Expect = 1.798e-9
Identity = 38/86 (44.19%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            + GEN     EGRVEV+ +    WG +CDD W   DA V CRQLG++  AR  T    +G G   ++   V  ++CTGNE+SL DC
Sbjct:  503 MDGENK---KEGRVEVFINGQ--WGTICDDGWTDKDAAVICRQLGYKGPARART-MAYFGEGKGPIH---VDNVKCTGNERSLADC 579          

HSP 6 Score: 53.1434 bits (126), Expect = 8.528e-6
Identity = 32/94 (34.04%), Postives = 46/94 (48.94%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            P +  +IRL G     ++EGR+EVY      WG VCDD W  L+  V CRQLGF+   + +        G   ++D     + C+G E   + C
Sbjct:  381 PLTDGVIRLAGGKG--SHEGRLEVYYRGQ--WGTVCDDGWTELNTYVVCRQLGFKYGKQASANHFEESTGPIWLDD-----VSCSGKETRFLQC 465          
BLAST of Neurotrypsin vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 173.711 bits (439), Expect = 3.480e-45
Identity = 137/432 (31.71%), Postives = 212/432 (49.07%), Query Frame = 1
Query: 2455 AGVVCK-VDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLE--NCPFFKWGEHK--CTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSD--YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT--LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            AG++ K +   C+NS   C     CI+ S  CD  + C  G DE   +C V++    GP+    +V  S+      VC DD+++      CR +         K+  +   +  IV D+   +  +LN    N   +K   H   C+ K  + + C                      + CG      ++ R+VGG  A+ GA+PWQV +  +    + H CG SI++ +WI+ AAHC  +P ++  +          S   Y   +++E++I HPN+++   + D AL+K+++     + FN+ V+PVCLP  GM+  P   C +SGWG T       E L AA+V LI+ +RC     Y   +T  M CAG+  G +D+CQGDSGGPLV   N ++ + G TSWG+GCA+   PGVY  + +  DWI  Q
Sbjct:  102 AGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDE--NRC-VRLY---GPNFIL-QVYSSQRKSWHPVCQDDWNENYGRAACRDM-------GYKNNFYS--SQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRC----------------------IACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQ----NVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQK----PLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQ 487          
BLAST of Neurotrypsin vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 173.711 bits (439), Expect = 3.480e-45
Identity = 137/432 (31.71%), Postives = 212/432 (49.07%), Query Frame = 1
Query: 2455 AGVVCK-VDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLE--NCPFFKWGEHK--CTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSD--YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT--LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            AG++ K +   C+NS   C     CI+ S  CD  + C  G DE   +C V++    GP+    +V  S+      VC DD+++      CR +         K+  +   +  IV D+   +  +LN    N   +K   H   C+ K  + + C                      + CG      ++ R+VGG  A+ GA+PWQV +  +    + H CG SI++ +WI+ AAHC  +P ++  +          S   Y   +++E++I HPN+++   + D AL+K+++     + FN+ V+PVCLP  GM+  P   C +SGWG T       E L AA+V LI+ +RC     Y   +T  M CAG+  G +D+CQGDSGGPLV   N ++ + G TSWG+GCA+   PGVY  + +  DWI  Q
Sbjct:  102 AGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDE--NRC-VRLY---GPNFIL-QVYSSQRKSWHPVCQDDWNENYGRAACRDM-------GYKNNFYS--SQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRC----------------------IACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQ----NVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQK----PLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQ 487          
BLAST of Neurotrypsin vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 173.711 bits (439), Expect = 3.533e-45
Identity = 137/432 (31.71%), Postives = 212/432 (49.07%), Query Frame = 1
Query: 2455 AGVVCK-VDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLE--NCPFFKWGEHK--CTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSD--YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT--LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            AG++ K +   C+NS   C     CI+ S  CD  + C  G DE   +C V++    GP+    +V  S+      VC DD+++      CR +         K+  +   +  IV D+   +  +LN    N   +K   H   C+ K  + + C                      + CG      ++ R+VGG  A+ GA+PWQV +  +    + H CG SI++ +WI+ AAHC  +P ++  +          S   Y   +++E++I HPN+++   + D AL+K+++     + FN+ V+PVCLP  GM+  P   C +SGWG T       E L AA+V LI+ +RC     Y   +T  M CAG+  G +D+CQGDSGGPLV   N ++ + G TSWG+GCA+   PGVY  + +  DWI  Q
Sbjct:  102 AGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDE--NRC-VRLY---GPNFIL-QVYSSQRKSWHPVCQDDWNENYGRAACRDM-------GYKNNFYS--SQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRC----------------------IACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQ----NVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQK----PLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQ 487          
BLAST of Neurotrypsin vs. Ensembl Human
Match: TMPRSS2 (transmembrane serine protease 2 [Source:HGNC Symbol;Acc:HGNC:11876])

HSP 1 Score: 174.096 bits (440), Expect = 6.487e-45
Identity = 137/432 (31.71%), Postives = 212/432 (49.07%), Query Frame = 1
Query: 2455 AGVVCK-VDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLE--NCPFFKWGEHK--CTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSD--YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT--LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            AG++ K +   C+NS   C     CI+ S  CD  + C  G DE   +C V++    GP+    +V  S+      VC DD+++      CR +         K+  +   +  IV D+   +  +LN    N   +K   H   C+ K  + + C                      + CG      ++ R+VGG  A+ GA+PWQV +  +    + H CG SI++ +WI+ AAHC  +P ++  +          S   Y   +++E++I HPN+++   + D AL+K+++     + FN+ V+PVCLP  GM+  P   C +SGWG T       E L AA+V LI+ +RC     Y   +T  M CAG+  G +D+CQGDSGGPLV   N ++ + G TSWG+GCA+   PGVY  + +  DWI  Q
Sbjct:  139 AGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDE--NRC-VRLY---GPNFIL-QVYSSQRKSWHPVCQDDWNENYGRAACRDM-------GYKNNFYS--SQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRC----------------------IACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQ----NVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQK----PLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQ 524          
BLAST of Neurotrypsin vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 196.823 bits (499), Expect = 1.217e-50
Identity = 141/435 (32.41%), Postives = 199/435 (45.75%), Query Frame = 1
Query: 2425 RSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLE-NCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPK--SDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYK--GRLTERMQCAGYEAGGIDTCQGDSGGPLVCKV-NGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIK 3711
            R  NC    I+   C+  R C++ +     D  CI   ++C+   DC  G DE   +      L +G D  SG +E+        +C D  + K +  IC  +            R GE    +  +    +G  +N + +C   +     CT    I  I        +Q      +V+     K        +  RVVGGFE V GAFPW   +R K     +H CGASIL +  +I AAHC+   +  S Y V  GDWDN   D  EQ+F ++ +  +P + +         I I      GI+FN Y QP+CLP    V  P  +C+VSGWG     Y E+L AA +P+I    C    +    ++    CAGY  GGID+CQGDSGGP  C+  +G + + G  SWG+GCAQ K PG+Y  +   L WI 
Sbjct:  541 REPNCTSTVIS--TCEPIR-CSHCQQAACGDGSCIRFDQLCNGQIDCQSGEDEDYCRAN-SFRLTNGSDT-SGYLEVLFRSRWEPICADHLNGKISNSICDAM------------RLGEHGFILSTNATISSGYNVNCDVDCSIRR--SSSCTRHARISCISQNGMSSASQCGLRYVEVNARDAAK-------SRIARVVGGFETVPGAFPWTAALRNKATK--AHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHD----IAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWIS 943          
BLAST of Neurotrypsin vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 128.257 bits (321), Expect = 5.459e-32
Identity = 84/243 (34.57%), Postives = 122/243 (50.21%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYA--RPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTL---STYPEKLLAAEVPLIKHERCFEF--YKGRL-TERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            R++GG E+   ++PW V   Q +     H CG S++  ++++ AAHC+A  R  + Y VR G   + S   +     +  + +HP W N  +   Y    +  +  V    +   +P+CLP L  V   N  C+V+GWG T+   S     L    VPL+    C     Y GR+    M CAGY  G ID+CQGDSGGPL+C  +G + + G  SWG GCA+P  PGVY  +     WI  +
Sbjct:   57 RLIGGSESSPHSWPWTV---QLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGSGSPHR----VTAVSIHP-WYNIGFPSSYDFAIMRIHPPVNT--STTARPICLPSLPAVE--NRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWINLE 287          
BLAST of Neurotrypsin vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 72.4034 bits (176), Expect = 7.117e-13
Identity = 82/273 (30.04%), Postives = 127/273 (46.52%), Query Frame = 1
Query: 2986 HRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERN-DGVGIKFNNYVQPVCLPKLGMVPDPNSKCL-------VSGWGDTLS---------TYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYE--AGGI--DTCQGDSGGPLVC-KVNGVYTIFGATSWG----NGCA-QPKNPGVYAKIQMQLDWIKEQTG 3723
            ++PI     R++GG     GA  W   +    D+     CGA+++ + W++ AAHC  + ++    R+  +     +  E+ F ++E  +H  +NN   D D AL++I  +   +GIK      PVCL     V D +SK L       V G+G TL             + L +  VP+I  + C + ++      ++  GY+  AG     T  GDSGGPL+  K NG Y   G TS+G    +G   Q K PGVY +I   + WI+   G
Sbjct:   30 YKPIF--SFRIIGGNSIDDGA-NWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQT----RSFVYVREPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIK------PVCL-----VHD-DSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIG 283          
BLAST of Neurotrypsin vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 74.3294 bits (181), Expect = 1.347e-12
Identity = 57/197 (28.93%), Postives = 83/197 (42.13%), Query Frame = 1
Query: 1546 QCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLD-ESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDC 2133
            QC+  +++CD +  C G +DE+  FC+ + C E +F C     CI  T VCD +++C DGSDE NC +   +      ++ T                 I KC  K      +F C   +  P  +               +EP     I           +CT EQF+CT G CI   ++CD   +C D SDE  C
Sbjct: 3544 QCLYASKLCDGVKDCSGGDDEEPAFCENFECTEAQFKCGDKKKCIPLTSVCDKEKDCDDGSDELNCEITSCKPDFFACFNGT----------------AISKCIPK------EFYCDGEDDCPEGQ---------------DEPDSCFGI----------GECTHEQFQCTSGKCIPKRRQCDGTLDCRDGSDEKGC 3693          

HSP 2 Score: 63.5438 bits (153), Expect = 2.328e-9
Identity = 97/396 (24.49%), Postives = 146/396 (36.87%), Query Frame = 1
Query: 1537 YNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSK-----ILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLT---------KLASEEPYKLIAITYPGAHYSMKSDCTAE-QFKC--TRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVN--KYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAME-SIHSAVNRFGK--------NRSPNLLVDEIKCTGTENSLEECKHSPWRSHN---CRPDEIAGVVC----------------KVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDE 2583
            ++ +CI   + CD+   C   +DED  +C   +C+   F C + + CI +  VC+   +CA+ +DE NCT  +     +      SK     + D +D  D I  P   C+          A   F         T S+C   +            S+E    +     G   S    C A+ QF C  TR  C+    +CD + +C D SDE +C       FE     S      E K + R        C DG D    E  C   G       + H  +    +        + + +L  DE+ C     S     H P R  +       E+  V+C                 +DR C  +E+ C   + CI   ++CD + DC DGSDE
Sbjct: 2648 HSDRCIRYEDTCDRYNDCPMFDDEDTKYCSTRVCRPGYFNCGNGL-CIPEQKVCNRINDCANFADESNCTCNENEFRCQSGACIPSKARCNHMQDCNDASDEIGCPFRNCS----------ALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATR-TCMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSKKCIPLEQKCDGRRD------CPDGEDEHQCETECDSKGGNATFRCTNHRCIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSF----HVPSRCADETCVVACELTAVLCDGIQDCSDGFDEKNCASLDRQCKPNEWMCDSGQ-CIDSGRLCDASVDCVDGSDE 3020          

HSP 3 Score: 57.3806 bits (137), Expect = 1.791e-7
Identity = 58/217 (26.73%), Postives = 89/217 (41.01%), Query Frame = 1
Query: 1543 RQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNC-TVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAH-----------YSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDE-IDCTTVTFPP 2154
            R C+PK+  CD  P C    DE +  C    C   EF C S   CI     CDG+R+C DG DE  C T  D       +  T+ + + ++ + D  D  +D             A ++  ++P       S C   T + + E   L A+   G              S+   C   ++ C  G CI+  + CD   +C D SDE ++  +++ PP
Sbjct: 2827 RTCMPKHWQCDGQPDCADGSDEKN--CDAKKCTSFEFSCESSKKCIPLEQKCDGRRDCPDGEDEHQCETECDSKGGNATFRCTNHRCIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSFHVP-------SRCADETCVVACE---LTAVLCDGIQDCSDGFDEKNCASLDRQCKPNEWMCDSGQCIDSGRLCDASVDCVDGSDEWVEICSLSEPP 3031          

HSP 4 Score: 52.7582 bits (125), Expect = 4.634e-6
Identity = 65/247 (26.32%), Postives = 100/247 (40.49%), Query Frame = 1
Query: 1498 CQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFC-KKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSK--ILDVSDKLDYI---DIPIDKCAEKCK-------ILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGM-CIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEG 2196
            C   Q+ C        +CI K++ C+ +  C    DE+   C +  LC  +EF C + + CI ++ VCDGK  C DG DE++C   ++    + +   + K   LD+  + D +   +   D+  E CK          +QF C               +C    +L    P  L          SM    T     C  G  CI    +CD  D+CGDNSDE  CT +      +R    + + +G
Sbjct: 1013 CSVSQFQCSKT-----KCIIKSKRCNGVQECDNGADEED--CPRSKLCDPDEFRCGTGL-CIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMC------------ADGKCLRSFQLCDGFPDCLTGEDETECPPSMCDSTT--HLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIRLDEAALRCQSPMYQCDG 1237          
BLAST of Neurotrypsin vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 69.3218 bits (168), Expect = 3.268e-12
Identity = 73/234 (31.20%), Postives = 112/234 (47.86%), Query Frame = 1
Query: 3103 CGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERN-DGVGIKFNNYVQPVCLPKLGMVPDPNSKCL-------VSGWGDTLS---------TYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYE--AGGI--DTCQGDSGGPLVC-KVNGVYTIFGATSWG----NGCA-QPKNPGVYAKIQMQLDWIKEQTG 3723
            CGA+++ + W++ AAHC  + ++    R+  +     +  E+ F ++E  +H  +NN   D D AL++I  +   +GIK      PVCL     V D +SK L       V G+G TL             + L +  VP+I  + C + ++      ++  GY+  AG     T  GDSGGPL+  K NG Y   G TS+G    +G   Q K PGVY +I   + WI+   G
Sbjct:   16 CGATVIDDFWLVTAAHCALQLQT----RSFVYVREPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIK------PVCL-----VHD-DSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVIG 233          
BLAST of Neurotrypsin vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0076525)

HSP 1 Score: 335.88 bits (860), Expect = 3.066e-93
Identity = 217/624 (34.78%), Postives = 313/624 (50.16%), Query Frame = 1
Query: 2044 FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPP--FEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVD-RACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKC--TVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKP------------------TAKVDPAAGL-----KCGHRP-------------IVHKRGRVVGGFEAVYGAFPWQVGVRQK-VDDYDSHWCGASILSEDWIIGAAHC-YARPKSDYRVRTGD-WDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT---LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL*LVVRKLNDKLVQF 3768
            F C  G C++  + CD + NC +  DE +C     PP  +E+RL+G  +   G++EV+  G+WG+VCDD F +K A+VVC++LGF    + +  +      N+  N L+DE++C G E  L +C    W  HNC  DE+AGV CKV    C N+ + C   K CI  + VCD T DC+D SDE    C   V+  L  G ++  GR+E+   G+ G+VCDDD++ K A V C  +   G A+ I+   FG   G I LD + C G E +++ C  + WGEH C H ED+ + C         PP+                   T K     GL     K  H P               H+  RVV G  A  G  PWQ  +R +      SHWCGA ++S+  ++ AAHC Y  PK  Y VR GD + N ++      F IE   LH N+    +  +   + + +     +KF++YVQP+CLP        + KC +SGWG     +ST  + L +AE+P++    C +   Y   ++E M CAG     +D C+GDSGGPLVC  +   T++G  SWG  C     PGVY ++   +DWI E         K+N+ L++F
Sbjct:  851 FDCGNGQCLKKEEICDGKKNCPNGKDEANC-----PPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK-IEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCS-----AGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSF-IENWYLHENFRKGTHMNNDIALVVLK---TPLKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWIYE---------KINESLLRF 1450          

HSP 2 Score: 122.479 bits (306), Expect = 3.242e-27
Identity = 94/348 (27.01%), Postives = 148/348 (42.53%), Query Frame = 1
Query: 1561 NEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEK-----CKILFHQFACKSFN----YLPPHESRTH----SECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKC--------TRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSK 2541
            N+  D +P+   +E       +     + +F C +   C+ K  +CDGK+NC +G DE NC   D    L   +  +   ++V     +  +  DK   K     C+ L  Q   +       Y PP++   +     EC        +  +K   +   G        C     KC        T   CI  +  CD+  +C D SDE  C  V   P + RL G  N  EG++EV++ G WG VCDD F++K+A+V C  +GF G  +      N FG +  P + +D++ C G E S+++C H  W  HNC   E   + C       +  +  ++ K   SL +
Sbjct:  821 NDDWDLLPNSNAEEVTPKLATRSSFNTQCDFDCGNGQ-CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDE--CAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK---IEKNIFGNSNGP-IWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGR 1161          

HSP 3 Score: 69.707 bits (169), Expect = 3.825e-11
Identity = 50/165 (30.30%), Postives = 73/165 (44.24%), Query Frame = 1
Query: 2434 NCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGA---IVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLP 2916
            N   +E+   +       T  +F C   + C+   ++CD   +C +G DE        +V L+ G     GR+E+   G  G VCDD +  KDA V+CR L     AQ ++   F          ++D ++C G E  L  C F  WG H C   E  GV C +P
Sbjct:  829 NSNAEEVTPKLATRSSFNTQCDFDCGNGQ-CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVP 992          

HSP 4 Score: 61.2326 bits (147), Expect = 1.390e-8
Identity = 43/125 (34.40%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSC-VYNLGCPNGW 705
            P S   +RL G    + N GR+EV  +    WG VCDD + + DA+V CR+LGF+  A+E      Y   +   N Y + +++C GNE  L  C        +    + AGV+C V  + CPN +
Sbjct:  881 PPSDYEVRLSG--GESPNMGRIEVKANGQ--WGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFN-YLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNY 1000          
BLAST of Neurotrypsin vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344980)

HSP 1 Score: 337.806 bits (865), Expect = 1.064e-92
Identity = 217/624 (34.78%), Postives = 313/624 (50.16%), Query Frame = 1
Query: 2044 FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPP--FEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVD-RACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCT--VKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKP------------------TAKVDPAAGL-----KCGHRP-------------IVHKRGRVVGGFEAVYGAFPWQVGVRQK-VDDYDSHWCGASILSEDWIIGAAHC-YARPKSDYRVRTGD-WDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT---LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL*LVVRKLNDKLVQF 3768
            F C  G C++  + CD + NC +  DE +C     PP  +E+RL+G  +   G++EV+  G+WG+VCDD F +K A+VVC++LGF    + +  +      N+  N L+DE++C G E  L +C    W  HNC  DE+AGV CKV    C N+ + C   K CI  + VCD T DC+D SDE    C   V+  L  G ++  GR+E+   G+ G+VCDDD++ K A V C  +   G A+ I+   FG   G I LD + C G E +++ C  + WGEH C H ED+ + C         PP+                   T K     GL     K  H P               H+  RVV G  A  G  PWQ  +R +      SHWCGA ++S+  ++ AAHC Y  PK  Y VR GD + N ++      F IE   LH N+    +  +   + + +     +KF++YVQP+CLP        + KC +SGWG     +ST  + L +AE+P++    C +   Y   ++E M CAG     +D C+GDSGGPLVC  +   T++G  SWG  C     PGVY ++   +DWI E         K+N+ L++F
Sbjct: 1780 FDCGNGQCLKKEEICDGKKNCPNGKDEANC-----PPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK-IEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCS-----AGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSF-IENWYLHENFRKGTHMNNDIALVVLKTP---LKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWIYE---------KINESLLRF 2379          

HSP 2 Score: 122.094 bits (305), Expect = 5.162e-27
Identity = 89/310 (28.71%), Postives = 135/310 (43.55%), Query Frame = 1
Query: 1675 CILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEK-----CKILFHQFACK----SFNYLPPHESRTH----SECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKC--------TRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSK 2541
            C+ K  +CDGK+NC +G DE NC   D    L   +  +   ++V     +  +  DK   K     C+ L  Q   +    S  Y PP++   +     EC        +  +K   +   G        C     KC        T   CI  +  CD+  +C D SDE  C  V   P + RL G  N  EG++EV++ G WG VCDD F++K+A+V C  +GF G  +      N FG +  P + +D++ C G E S+++C H  W  HNC   E   + C       +  +  ++ K   SL +
Sbjct: 1787 CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDE--CAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK---IEKNIFGNSNGP-IWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGR 2090          

HSP 3 Score: 70.0922 bits (170), Expect = 3.320e-11
Identity = 50/165 (30.30%), Postives = 73/165 (44.24%), Query Frame = 1
Query: 2434 NCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGA---IVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLP 2916
            N   +E+   +       T  +F C   + C+   ++CD   +C +G DE        +V L+ G     GR+E+   G  G VCDD +  KDA V+CR L     AQ ++   F          ++D ++C G E  L  C F  WG H C   E  GV C +P
Sbjct: 1758 NSNAEEVTPKLATRSSFNTQCDFDCGNGQ-CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVP 1921          

HSP 4 Score: 62.003 bits (149), Expect = 9.551e-9
Identity = 47/134 (35.07%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  316 PMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYCS-GKSAGVSC-VYNLGCPNGW 705
            P  K     P S   +RL G    + N GR+EV  +N + WG VCDD + + DA+V CR+LGF+  A+E      Y   +   N Y + +++C GNE  L  C         C   + AGV+C V  + CPN +
Sbjct: 1801 PNGKDEANCPPSDYEVRLSG--GESPNMGRIEV-KANGQ-WGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFN-YLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNY 1929          
BLAST of Neurotrypsin vs. Ensembl Fly
Match: teq (gene:FBgn0023479 transcript:FBtr0344981)

HSP 1 Score: 337.421 bits (864), Expect = 2.125e-92
Identity = 217/624 (34.78%), Postives = 313/624 (50.16%), Query Frame = 1
Query: 2044 FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPP--FEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVD-RACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKC--TVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKP------------------TAKVDPAAGL-----KCGHRP-------------IVHKRGRVVGGFEAVYGAFPWQVGVRQK-VDDYDSHWCGASILSEDWIIGAAHC-YARPKSDYRVRTGD-WDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT---LSTYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL*LVVRKLNDKLVQF 3768
            F C  G C++  + CD + NC +  DE +C     PP  +E+RL+G  +   G++EV+  G+WG+VCDD F +K A+VVC++LGF    + +  +      N+  N L+DE++C G E  L +C    W  HNC  DE+AGV CKV    C N+ + C   K CI  + VCD T DC+D SDE    C   V+  L  G ++  GR+E+   G+ G+VCDDD++ K A V C  +   G A+ I+   FG   G I LD + C G E +++ C  + WGEH C H ED+ + C         PP+                   T K     GL     K  H P               H+  RVV G  A  G  PWQ  +R +      SHWCGA ++S+  ++ AAHC Y  PK  Y VR GD + N ++      F IE   LH N+    +  +   + + +     +KF++YVQP+CLP        + KC +SGWG     +ST  + L +AE+P++    C +   Y   ++E M CAG     +D C+GDSGGPLVC  +   T++G  SWG  C     PGVY ++   +DWI E         K+N+ L++F
Sbjct: 2193 FDCGNGQCLKKEEICDGKKNCPNGKDEANC-----PPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDECAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK-IEKNIFGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCS-----AGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLTDEYAHREERVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSEVDSF-IENWYLHENFRKGTHMNNDIALVVLKTP---LKFSDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWIYE---------KINESLLRF 2792          

HSP 2 Score: 122.094 bits (305), Expect = 5.912e-27
Identity = 89/310 (28.71%), Postives = 135/310 (43.55%), Query Frame = 1
Query: 1675 CILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEK-----CKILFHQFACK----SFNYLPPHESRTH----SECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKC--------TRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSK 2541
            C+ K  +CDGK+NC +G DE NC   D    L   +  +   ++V     +  +  DK   K     C+ L  Q   +    S  Y PP++   +     EC        +  +K   +   G        C     KC        T   CI  +  CD+  +C D SDE  C  V   P + RL G  N  EG++EV++ G WG VCDD F++K+A+V C  +GF G  +      N FG +  P + +D++ C G E S+++C H  W  HNC   E   + C       +  +  ++ K   SL +
Sbjct: 2200 CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNYWLCHTSKECIPPAFVCDNTPDCADKSDE--CAAVCQAPVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSMGFFGPAK---IEKNIFGNSNGP-IWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAGPPPRSQRYSQTQIKGGRSLGR 2503          

HSP 3 Score: 70.0922 bits (170), Expect = 3.143e-11
Identity = 50/165 (30.30%), Postives = 73/165 (44.24%), Query Frame = 1
Query: 2434 NCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGA---IVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLP 2916
            N   +E+   +       T  +F C   + C+   ++CD   +C +G DE        +V L+ G     GR+E+   G  G VCDD +  KDA V+CR L     AQ ++   F          ++D ++C G E  L  C F  WG H C   E  GV C +P
Sbjct: 2171 NSNAEEVTPKLATRSSFNTQCDFDCGNGQ-CLKKEEICDGKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIEVKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNYLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVP 2334          

HSP 4 Score: 62.003 bits (149), Expect = 9.320e-9
Identity = 47/134 (35.07%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  316 PMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYCS-GKSAGVSC-VYNLGCPNGW 705
            P  K     P S   +RL G    + N GR+EV  +N + WG VCDD + + DA+V CR+LGF+  A+E      Y   +   N Y + +++C GNE  L  C         C   + AGV+C V  + CPN +
Sbjct: 2214 PNGKDEANCPPSDYEVRLSG--GESPNMGRIEV-KANGQ-WGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFN-YLMDEVECHGNETKLGQCAFKGWGVHNCGVDEVAGVTCKVPVMKCPNNY 2342          
BLAST of Neurotrypsin vs. Ensembl Fly
Match: CG31954 (gene:FBgn0051954 transcript:FBtr0077563)

HSP 1 Score: 152.91 bits (385), Expect = 1.497e-40
Identity = 99/244 (40.57%), Postives = 136/244 (55.74%), Query Frame = 1
Query: 3010 GRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHC-YARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDT--LSTYPEKLLAAEVPLIKHERCFEFYK--GRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            GR+VGG        P QV ++       SH CG SI+SE+WI+ AAHC Y +     +VR G  + A      Q+  +++++ H  +N  N DYD++L+++       IKF+   + V LP+  M       C VSGWG+T  L    E L   EVPL+  E C E YK  G +TERM CAG+  GG D CQGDSGGP+V +      + G  SWG GCA+P  PGVY+++    DWIKE +G+
Sbjct:   49 GRIVGGHRINITDAPHQVSLQT-----SSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEFARSG---QLLRVQKIVQHAQFNYTNVDYDFSLLQLAHP----IKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESG---ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHSGV 277          
BLAST of Neurotrypsin vs. Ensembl Fly
Match: CG8172 (gene:FBgn0033362 transcript:FBtr0301191)

HSP 1 Score: 149.058 bits (375), Expect = 3.567e-38
Identity = 92/262 (35.11%), Postives = 141/262 (53.82%), Query Frame = 1
Query: 2962 PAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYAR-PKSDYRVRTGDWDNASDDKY--EQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTL---STYPEKLLAAEVPLIKHERCFEFYK--GR---LTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            P     CG   +  +  R+VGG    +G+ PWQV + +         CG +++S  W+I AAHC A  P S+ ++R G+WD    ++    + + IE   +HP++N A++  D ALI+++RN    + +  ++ PVCLP             V+GWG T    ST P  L   +V +I ++RC  +++  GR   + +   CAGY+ GG D+CQGDSGGPL   ++G  T+ G  SWG GC +   PGVY  IQ  + WI +
Sbjct:  110 PVNNTSCGE--VYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRN----VVYKQHIIPVCLPP-STTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 364          
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 304.679 bits (779), Expect = 3.706e-88
Identity = 206/596 (34.56%), Postives = 315/596 (52.85%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERN------DGVGIKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTG 3723
            IA  + GA++   S     ++  CT   + IE   K    ++  D++++   + V      +RL G V  YEG++EV Y+G+WG VCDDG+     +VVC+QLGF    ES+  +  RFG    P +L+D+++CTG E ++  C    W  H+C   +   +VC           +CS+  +  SL                        V L  G + + GRVE+  GG  GTVCDD + D+DA V+CR L   G A+A     FGEG G I +DN+KCTG E +L +C    +G H C H ED GVIC        Q   P  K   A G  CG R    ++ R++GG  ++ G +PWQ  VR +    D    CGA+++S  WI+ +AHC+ R  +    Y+VR GD+ +   ++YE+ + +E+++LHP ++  + DYD AL+++  +       G  +  +  V P CLP +   VP   + C ++GWGDT   Y + L  A + ++   +C + Y  + T RM CAG  ++A  +D+C+GDSGGPLVC + +G + ++G TSWG+ C   + PGVY K+   + WIK+  G
Sbjct:  113 IAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFRSG-ESV--SAGRFGIAAGP-VLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSP---------QCSRHGVPNSL-----------------------PVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQLGYSGLAKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYG----LQQDSPGVK--EAVGSMCGLRLSHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQRYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVIG 666          

HSP 2 Score: 139.428 bits (350), Expect = 5.343e-33
Identity = 89/257 (34.63%), Postives = 130/257 (50.58%), Query Frame = 1
Query: 2137 TVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            T  F P  +RL+G  + YEG+VEV + G+WG VCDD +D   AEVVC+QLG  G  ++   A    G  R   + +DE+ CTG E S+E+C  + W  HNC   E AGV                    C+ L          +DG+          V L  G     GR+E+   G  GTVCDD +   +  V+CR L      +++   RFG  AG ++LD+++CTG+E  + +C    W +H CTH++D+ ++C
Sbjct:   61 TSVFVP--VRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGR---VFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGV-------------------SCVPL----------TDGA----------VRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFR-SGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVC 272          

HSP 3 Score: 95.1301 bits (235), Expect = 4.720e-19
Identity = 64/179 (35.75%), Postives = 80/179 (44.69%), Query Frame = 1
Query: 2371 IKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            + C G E+ L +C  + W    C   + A V C                                       E    V V L+ GP A  GRVE+   G  GTVCDD +DD DA V+CR L + G A+A     FG G+G + LD + CTG EL++E CP   WGEH C H ED GV C
Sbjct:   24 VGCEGQEDDLLQCNRTVWNGGECENRQAAAVSCM------------------------------------PVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 166          

HSP 4 Score: 67.3958 bits (163), Expect = 1.763e-10
Identity = 46/122 (37.70%), Postives = 61/122 (50.00%), Query Frame = 1
Query:  331 RDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCVYNL 687
            R G P S  +  + GEN     EGRVE+       WG VCDD W   DA V CRQLG+   A+ A     +G G+  ++   +  ++CTG E SL DC   P  + +    + AGV C Y L
Sbjct:  278 RHGVPNSLPVRLVGGENE---REGRVEILVGGQ--WGTVCDDGWTDRDAEVVCRQLGYSGLAK-ARVMAYFGEGEGPIH---IDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGL 390          

HSP 5 Score: 61.2326 bits (147), Expect = 1.302e-8
Identity = 45/114 (39.47%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  346 ESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYC-SGKSAGVSCV 678
            E+   + +R     +A EGRVEVY +    WG VCDD W+  DA V CRQLG    A+ A     +G G   V    + ++ CTGNE S+  CP  +     C   + AGVSCV
Sbjct:   60 ETSVFVPVRLSGGPSAYEGRVEVYHAGQ--WGTVCDDQWDDNDAEVVCRQLGLGGIAK-AWVGAYFGAGSGRV---FLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCV 167          

HSP 6 Score: 53.1434 bits (126), Expect = 4.975e-6
Identity = 32/95 (33.68%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
             P +   +RL G   +   EGR+EV+      WG VCDD W   +  V CRQLGFR  + E+    R+G    +     +  ++CTG E ++  C
Sbjct:  167 VPLTDGAVRLVG--GVKGYEGRLEVHYRGQ--WGTVCDDGWTQTNTQVVCRQLGFR--SGESVSAGRFG---IAAGPVLLDDVRCTGKEPTVTHC 252          
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 306.605 bits (784), Expect = 2.440e-87
Identity = 205/596 (34.40%), Postives = 315/596 (52.85%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERN------DGVGIKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTG 3723
            IA  + GA++   S     ++  CT   + IE   K    ++  D++++   + V      +RL G V  YEG++EV Y+G+WG VCDDG+     +VVC+QLGF    ES+  +  RFG    P +L+D+++CTG E ++  C    W  H+C   +   +VC           +CS+  +  SL                        V L  G + + GRVE+  GG  GTVCDD + D+DA V+CR L   G A+A     FGEG G I +DN+KCTG E +L +C    +G H C H ED GVIC        Q   P  KV    GL+  H     ++ R++GG  ++ G +PWQ  VR +    D    CGA+++S  WI+ +AHC+ R  +    Y+VR GD+ +   ++YE+ + +E+++LHP ++  + DYD AL+++  +       G  +  +  V P CLP +   VP   + C ++GWGDT   Y + L  A + ++   +C + Y  + T RM CAG  ++A  +D+C+GDSGGPLVC + +G + ++G TSWG+ C   + PGVY K+   + WIK+  G
Sbjct:  264 IAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFRSG-ESV--SAGRFGIAAGP-VLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSP---------QCSRHGVPNSL-----------------------PVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQLGYSGLAKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYG----LQQDSPGVKVGSMCGLRLSHT----RQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQRYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVIG 815          

HSP 2 Score: 139.813 bits (351), Expect = 1.059e-32
Identity = 89/257 (34.63%), Postives = 130/257 (50.58%), Query Frame = 1
Query: 2137 TVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            T  F P  +RL+G  + YEG+VEV + G+WG VCDD +D   AEVVC+QLG  G  ++   A    G  R   + +DE+ CTG E S+E+C  + W  HNC   E AGV                    C+ L          +DG+          V L  G     GR+E+   G  GTVCDD +   +  V+CR L      +++   RFG  AG ++LD+++CTG+E  + +C    W +H CTH++D+ ++C
Sbjct:  212 TSVFVP--VRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGR---VFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGV-------------------SCVPL----------TDGA----------VRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFR-SGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVC 423          

HSP 3 Score: 129.028 bits (323), Expect = 2.504e-29
Identity = 89/266 (33.46%), Postives = 119/266 (44.74%), Query Frame = 1
Query: 2110 DNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +N   ID          +RL G  +K +G VEV   G WG +C +G+D + A VVC+QLG        H+ ++   +     +    + C G E+ L +C  + W    C   + A V C                                       E    V V L+ GP A  GRVE+   G  GTVCDD +DD DA V+CR L + G A+A     FG G+G + LD + CTG EL++E CP   WGEH C H ED GV C
Sbjct:   91 NNRGRIDWGYCDCKQGSLRLQGGRSKLDGTVEVYLNGVWGTICSNGWDDQDAAVVCRQLG---QGYRAHARMSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSCM------------------------------------PVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 317          

HSP 4 Score: 65.4698 bits (158), Expect = 8.514e-10
Identity = 46/122 (37.70%), Postives = 61/122 (50.00%), Query Frame = 1
Query:  331 RDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCVYNL 687
            R G P S  +  + GEN     EGRVE+       WG VCDD W   DA V CRQLG+   A+ A     +G G+  ++   +  ++CTG E SL DC   P  + +    + AGV C Y L
Sbjct:  429 RHGVPNSLPVRLVGGENE---REGRVEILVGGQ--WGTVCDDGWTDRDAEVVCRQLGYSGLAK-ARVMAYFGEGEGPIH---IDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGL 541          

HSP 5 Score: 60.4622 bits (145), Expect = 2.423e-8
Identity = 44/114 (38.60%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  346 ESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSCV 678
            E+   + +R     +A EGRVEVY +    WG VCDD W+  DA V CRQLG    A+ A     +G G   V    + ++ CTGNE S+  CP  +    +    + AGVSCV
Sbjct:  211 ETSVFVPVRLSGGPSAYEGRVEVYHAGQ--WGTVCDDQWDDNDAEVVCRQLGLGGIAK-AWVGAYFGAGSGRV---FLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCV 318          

HSP 6 Score: 53.5286 bits (127), Expect = 3.591e-6
Identity = 31/78 (39.74%), Postives = 38/78 (48.72%), Query Frame = 1
Query: 1192 SDCYEDNGLD--YRGRISRTVQGSSCAKWTD-PAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGV--YGYC 1410
            +DC +  G    Y G I  T  G  C  W+D P      Q     GLGDH FCRNPD  ++PWC+     G   +GYC
Sbjct:   27 TDCVQSKGKAGFYEGSIDSTESGVKCMNWSDVPGVRERYQGK---GLGDHTFCRNPDGRIRPWCFFTNNRGRIDWGYC 101          
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Match: BX511095.2 (serine protease 12 [Source:NCBI gene;Acc:566809])

HSP 1 Score: 306.605 bits (784), Expect = 2.533e-87
Identity = 205/596 (34.40%), Postives = 315/596 (52.85%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERN------DGVGIKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTG 3723
            IA  + GA++   S     ++  CT   + IE   K    ++  D++++   + V      +RL G V  YEG++EV Y+G+WG VCDDG+     +VVC+QLGF    ES+  +  RFG    P +L+D+++CTG E ++  C    W  H+C   +   +VC           +CS+  +  SL                        V L  G + + GRVE+  GG  GTVCDD + D+DA V+CR L   G A+A     FGEG G I +DN+KCTG E +L +C    +G H C H ED GVIC        Q   P  KV    GL+  H     ++ R++GG  ++ G +PWQ  VR +    D    CGA+++S  WI+ +AHC+ R  +    Y+VR GD+ +   ++YE+ + +E+++LHP ++  + DYD AL+++  +       G  +  +  V P CLP +   VP   + C ++GWGDT   Y + L  A + ++   +C + Y  + T RM CAG  ++A  +D+C+GDSGGPLVC + +G + ++G TSWG+ C   + PGVY K+   + WIK+  G
Sbjct:  264 IAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCVPLTDGAVRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFRSG-ESV--SAGRFGIAAGP-VLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVCSP---------QCSRHGVPNSL-----------------------PVRLVGGENEREGRVEILVGGQWGTVCDDGWTDRDAEVVCRQLGYSGLAKARVMAYFGEGEGPIHIDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYG----LQQDSPGVKVGSMCGLRLSHT----RQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLISSCWILTSAHCFKRYGNSTGLYKVRVGDYHSLVPEEYEEEYAVEKIVLHPRYHADSSDYDLALLRVSGHRAHRGVTGQCVTLSRSVLPACLPVRREKVPKGIANCYITGWGDTGRAYSKTLQQASISVLSKRQCEQRYSEQFTNRMLCAGSSHDAQRVDSCRGDSGGPLVCERPSGSWVVYGVTSWGHACRLQEAPGVYTKVSAFVPWIKKVIG 815          

HSP 2 Score: 139.813 bits (351), Expect = 1.014e-32
Identity = 89/257 (34.63%), Postives = 130/257 (50.58%), Query Frame = 1
Query: 2137 TVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            T  F P  +RL+G  + YEG+VEV + G+WG VCDD +D   AEVVC+QLG  G  ++   A    G  R   + +DE+ CTG E S+E+C  + W  HNC   E AGV                    C+ L          +DG+          V L  G     GR+E+   G  GTVCDD +   +  V+CR L      +++   RFG  AG ++LD+++CTG+E  + +C    W +H CTH++D+ ++C
Sbjct:  212 TSVFVP--VRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGR---VFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGV-------------------SCVPL----------TDGA----------VRLVGGVKGYEGRLEVHYRGQWGTVCDDGWTQTNTQVVCRQLGFR-SGESVSAGRFGIAAGPVLLDDVRCTGKEPTVTHCSRRGWFKHDCTHRQDVAIVC 423          

HSP 3 Score: 129.028 bits (323), Expect = 2.504e-29
Identity = 89/266 (33.46%), Postives = 119/266 (44.74%), Query Frame = 1
Query: 2110 DNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +N   ID          +RL G  +K +G VEV   G WG +C +G+D + A VVC+QLG        H+ ++   +     +    + C G E+ L +C  + W    C   + A V C                                       E    V V L+ GP A  GRVE+   G  GTVCDD +DD DA V+CR L + G A+A     FG G+G + LD + CTG EL++E CP   WGEH C H ED GV C
Sbjct:   91 NNRGRIDWGYCDCKQGSLRLQGGRSKLDGTVEVYLNGVWGTICSNGWDDQDAAVVCRQLG---QGYRAHARMSPLSRLVVSVVHWQTVGCEGQEDDLLQCNRTVWNGGECENRQAAAVSCM------------------------------------PVETSVFVPVRLSGGPSAYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGIAKAWVGAYFGAGSGRVFLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSC 317          

HSP 4 Score: 65.4698 bits (158), Expect = 8.587e-10
Identity = 46/122 (37.70%), Postives = 61/122 (50.00%), Query Frame = 1
Query:  331 RDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCVYNL 687
            R G P S  +  + GEN     EGRVE+       WG VCDD W   DA V CRQLG+   A+ A     +G G+  ++   +  ++CTG E SL DC   P  + +    + AGV C Y L
Sbjct:  429 RHGVPNSLPVRLVGGENE---REGRVEILVGGQ--WGTVCDDGWTDRDAEVVCRQLGYSGLAK-ARVMAYFGEGEGPIH---IDNVKCTGGEHSLTDCIKQPFGTHNCRHSEDAGVICNYGL 541          

HSP 5 Score: 60.4622 bits (145), Expect = 2.444e-8
Identity = 44/114 (38.60%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  346 ESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSCV 678
            E+   + +R     +A EGRVEVY +    WG VCDD W+  DA V CRQLG    A+ A     +G G   V    + ++ CTGNE S+  CP  +    +    + AGVSCV
Sbjct:  211 ETSVFVPVRLSGGPSAYEGRVEVYHAGQ--WGTVCDDQWDDNDAEVVCRQLGLGGIAK-AWVGAYFGAGSGRV---FLDEVSCTGNELSIEQCPKTAWGEHNCDHTEDAGVSCV 318          

HSP 6 Score: 53.5286 bits (127), Expect = 3.975e-6
Identity = 31/78 (39.74%), Postives = 38/78 (48.72%), Query Frame = 1
Query: 1192 SDCYEDNGLD--YRGRISRTVQGSSCAKWTD-PAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGV--YGYC 1410
            +DC +  G    Y G I  T  G  C  W+D P      Q     GLGDH FCRNPD  ++PWC+     G   +GYC
Sbjct:   27 TDCVQSKGKAGFYEGSIDATESGVKCMNWSDVPGVRERYQGK---GLGDHTFCRNPDGRIRPWCFFTNNRGRIDWGYC 101          
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Match: si:ch211-51a6.2 (si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-118])

HSP 1 Score: 296.59 bits (758), Expect = 1.108e-86
Identity = 206/566 (36.40%), Postives = 303/566 (53.53%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFE-AVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP----KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGG--IDTCQGDSGGPLVCKVNGV-YTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS ++C H      N D ++   V+  PF    +RL G+ + +EG++EV + GEWG VCDD +  + A+VVC+QLG+ G  E   S V  +G+  +  +L+DE+ C G E+SL +C HS W  H+C   E  G+             RC ++     + +V   T                 V L DG   K GRVE+      G+VCDD ++D +A V+CR L   G ++A     FGEG G+I LDN+KC G E++L  C       H C H ED GVIC    + VT+P     K++     +CG RP   +R R + G + ++ G +PWQV +  +     SH  CGA++++  W+I AAHC+ R  SD   Y +R GD+     D +E+    E +++H  +++  ++YD AL+K++  D   + FN +   VCLP    K G  P     C+++GWG T S Y   LL A VPL+   +C + Y  R T RM CAG  +    +D+CQGDSGGPLVC+ +G  + + G  SWG+GC  P  PGVY ++   L WI++ T
Sbjct:   30 ELSLEECPHAPWGRHNCDHMEDAGVSCNPFTDGVLRLVGADSPWEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQLGYRGRAEV--SPVGMYGEG-TGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGI-------------RCEREGQNNEIPEVAPVTGPL--------------VRLVDGESRKEGRVEVFINAQWGSVCDDGWNDINAQVVCRQLGFVGVSKARSMAYFGEGQGSIHLDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVIC----DYVTEP----VKMNSFGKHECGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRSQSKGSHPLCGATLINSCWVITAAHCFKRFGSDASRYVLRLGDYHTEERDDFERSLSPERIVIHKKYHSQGWEYDIALLKLKGTDENCVAFNPHTNAVCLPPQSSKKGKRP---IACVITGWGITDSEYSRTLLQAWVPLLPSWKCKKRYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGDGGHWMLTGVISWGHGCGDPSYPGVYTRVGRFLKWIEKVT 554          

HSP 2 Score: 107.071 bits (266), Expect = 5.270e-23
Identity = 69/192 (35.94%), Postives = 95/192 (49.48%), Query Frame = 1
Query: 2332 FGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            FG+   P + +D + CTG E SLEEC H+PW  HNC   E AGV C                             N  +DG         +++  AD P    GR+E+   G  GTVCDD++  + A V+CR L   GRA+      +GEG G I+LD + C G E +L +C   +WG+H C+H ED+G+ C
Sbjct:   12 FGQGTGP-IALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSC-----------------------------NPFTDG--------VLRLVGADSP--WEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQLGYRGRAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRC 163          

HSP 3 Score: 64.3142 bits (155), Expect = 1.351e-9
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL G  A +  EGR+EVY +    WG VCDD W    A V CRQLG+R +A E +    YG G   +    + ++ C G E SL+DC H
Sbjct:   58 PFTDGVLRLVG--ADSPWEGRLEVYHAGE--WGTVCDDNWTGRHAQVVCRQLGYRGRA-EVSPVGMYGEGTGMI---LLDEVTCEGGESSLLDCDH 145          

HSP 4 Score: 61.6178 bits (148), Expect = 9.297e-9
Identity = 28/55 (50.91%), Postives = 32/55 (58.18%), Query Frame = 1
Query: 2743 GRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            G  +A     FG+G G I LD + CTG EL+LE CP   WG H C H ED GV C
Sbjct:    2 GVPKAWTWAHFGQGTGPIALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSC 56          

HSP 5 Score: 59.6918 bits (143), Expect = 3.476e-8
Identity = 42/122 (34.43%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  325 KVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP---HDSTSYCSGKSAGVSCVY 681
            ++ + AP +  ++RL   +  +  EGRVEV+ +    WG VCDD WN ++A V CRQLGF   ++ A     +G G  S++   +  ++C G E SL +C     D+      + AGV C Y
Sbjct:  171 EIPEVAPVTGPLVRLV--DGESRKEGRVEVFINAQ--WGSVCDDGWNDINAQVVCRQLGFVGVSK-ARSMAYFGEGQGSIH---LDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVICDY 284          
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Match: si:ch211-51a6.2 (si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-118])

HSP 1 Score: 296.975 bits (759), Expect = 6.006e-84
Identity = 206/566 (36.40%), Postives = 303/566 (53.53%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFE-AVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP----KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGG--IDTCQGDSGGPLVCKVNGVYTIF-GATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS ++C H      N D ++   V+  PF    +RL G+ + +EG++EV + GEWG VCDD +  + A+VVC+QLG+ G  E   S V  +G+  +  +L+DE+ C G E+SL +C HS W  H+C   E  G+             RC ++     + +V   T                 V L DG   K GRVE+      G+VCDD ++D +A V+CR L   G ++A     FGEG G+I LDN+KC G E++L  C       H C H ED GVIC    + VT+P     K++     +CG RP   +R R + G + ++ G +PWQV +  +     SH  CGA++++  W+I AAHC+ R  SD   Y +R GD+     D +E+    E +++H  +++  ++YD AL+K++  D   + FN +   VCLP    K G  P     C+++GWG T S Y   LL A VPL+   +C + Y  R T RM CAG  +    +D+CQGDSGGPLVC+ +G + +  G  SWG+GC  P  PGVY ++   L WI++ T
Sbjct:  302 ELSLEECPHAPWGRHNCDHMEDAGVSCNPFTDGVLRLVGADSPWEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQLGYRGRAEV--SPVGMYGEG-TGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGI-------------RCEREGQNNEIPEVAPVTGPL--------------VRLVDGESRKEGRVEVFINAQWGSVCDDGWNDINAQVVCRQLGFVGVSKARSMAYFGEGQGSIHLDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVIC----DYVTEP----VKMNSFGKHECGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRSQSKGSHPLCGATLINSCWVITAAHCFKRFGSDASRYVLRLGDYHTEERDDFERSLSPERIVIHKKYHSQGWEYDIALLKLKGTDENCVAFNPHTNAVCLPPQSSKKGKRP---IACVITGWGITDSEYSRTLLQAWVPLLPSWKCKKRYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGDGGHWMLTGVISWGHGCGDPSYPGVYTRVGRFLKWIEKVT 826          

HSP 2 Score: 155.221 bits (391), Expect = 1.574e-37
Identity = 100/278 (35.97%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 2074 LSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +S  C+H +  G     + C         +RL G +  +EG+VEV Y G WG +CDD +D   AEVVC+QLG  G  ++   A   FG+   P + +D + CTG E SLEEC H+PW  HNC   E AGV C                             N  +DG         +++  AD P    GR+E+   G  GTVCDD++  + A V+CR L   GRA+      +GEG G I+LD + C G E +L +C   +WG+H C+H ED+G+ C
Sbjct:  205 VSGDCNHGNEAG-----VICAVPEGNGAPLRLVGGLEDFEGRVEVYYNGRWGTICDDEWDDIDAEVVCRQLGLGGVPKAWTWA--HFGQGTGP-IALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSC-----------------------------NPFTDG--------VLRLVGADSP--WEGRLEVYHAGEWGTVCDDNWTGRHAQVVCRQLGYRGRAEVSPVGMYGEGTGMILLDEVTCEGGESSLLDCDHSQWGQHDCSHSEDVGIRC 435          

HSP 3 Score: 119.013 bits (297), Expect = 2.865e-26
Identity = 86/252 (34.13%), Postives = 116/252 (46.03%), Query Frame = 1
Query: 2158 EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNR--FGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            ++RL G  +   G++EV   G WG VCD     + A V+C+QL     +  I +A+    FG   S     + + C G E SL +C+   + S +C     AGV+C V                                    PEG     + L  G +   GRVE+   G  GT+CDD++DD DA V+CR L + G  +A     FG+G G I LD + CTG EL+LE CP   WG H C H ED GV C
Sbjct:  119 DVRLVGGSSNKSGRLEVYLNGRWGSVCDSHLTDRDASVICRQL----RLGEIGTALRHSYFGPG-SGLFHFERLGCHGNEESLLKCRTRKYVSGDCNHGNEAGVICAV------------------------------------PEGN-GAPLRLVGGLEDFEGRVEVYYNGRWGTICDDEWDDIDAEVVCRQLGLGGVPKAWTWAHFGQGTGPIALDGVHCTGNELSLEECPHAPWGRHNCDHMEDAGVSC 328          

HSP 4 Score: 68.1662 bits (165), Expect = 1.213e-10
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 1
Query: 2608 VTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPD 2919
            V L  G   KSGR+E+   G  G+VCD    D+DA+VICR L++     A++   FG G+G    + L C G E +L  C   K+    C H  + GVIC +P+
Sbjct:  120 VRLVGGSSNKSGRLEVYLNGRWGSVCDSHLTDRDASVICRQLRLGEIGTALRHSYFGPGSGLFHFERLGCHGNEESLLKCRTRKYVSGDCNHGNEAGVICAVPE 223          

HSP 5 Score: 63.1586 bits (152), Expect = 3.853e-9
Identity = 39/96 (40.62%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL G  A +  EGR+EVY +    WG VCDD W    A V CRQLG+R +A E +    YG G   +    + ++ C G E SL+DC H
Sbjct:  330 PFTDGVLRLVG--ADSPWEGRLEVYHAGE--WGTVCDDNWTGRHAQVVCRQLGYRGRA-EVSPVGMYGEGTGMI---LLDEVTCEGGESSLLDCDH 417          

HSP 6 Score: 62.003 bits (149), Expect = 9.068e-9
Identity = 41/99 (41.41%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  334 DGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            +GAP     +RL G   L   EGRVEVY +    WG +CDD W+ +DA V CRQLG     +  T    +G+G        +  + CTGNE SL +CPH
Sbjct:  225 NGAP-----LRLVG--GLEDFEGRVEVYYNGR--WGTICDDEWDDIDAEVVCRQLGLGGVPKAWTWA-HFGQG---TGPIALDGVHCTGNELSLEECPH 310          

HSP 7 Score: 58.9214 bits (141), Expect = 9.318e-8
Identity = 42/117 (35.90%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP---HDSTSYCSGKSAGVSCVY 681
            AP +  ++RL   +  +  EGRVEV+ +    WG VCDD WN ++A V CRQLGF   ++ A     +G G  S++   +  ++C G E SL +C     D+      + AGV C Y
Sbjct:  448 APVTGPLVRL--VDGESRKEGRVEVFINAQ--WGSVCDDGWNDINAQVVCRQLGFVGVSK-ARSMAYFGEGQGSIH---LDNVKCVGTEVSLGECSAVGSDAHDCRHSEDAGVICDY 556          

HSP 8 Score: 56.9954 bits (136), Expect = 2.924e-7
Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 1
Query: 1168 QMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTD-PAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            Q + P S S+ + + G  Y G +S+T  G SC KWT+ P   +     P+ GLGDHN CRNPD +  PWC+    +G  G+
Sbjct:   34 QSSGPLSCSEGFTELGY-YNGSVSQTDTGFSCLKWTEFPDYMLQ---YPKRGLGDHNHCRNPDRESNPWCFFRQKSGAVGW 110          
BLAST of Neurotrypsin vs. Ensembl Xenopus
Match: ENSXETT00000001560.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 316.62 bits (810), Expect = 1.112e-90
Identity = 203/548 (37.04%), Postives = 288/548 (52.55%), Query Frame = 1
Query: 2113 NSDEIDCTTVTFPPF---EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            N D I+   V+  PF    +RL+G     EG VEV Y G+WG VCDDG+    A+VVC+QLGF G   S  S+   FG      + +D++ CTG E SL EC HS W  H+C   E  GV C                            +N+ +D    P G     V L DG   K GRVE+   G  G+VCDD + D DAAV+CR L   G A+A     FGEG G I +DN++C+G E  L  C     G H C H ED GVIC   ++   Q      K        CG   + H++ R+VGG ++  G++PWQ  +R K    ++   CGA++++  W + AAHC+ R       Y +R GD+    +D++E+   ++++++H N+ + + D D AL++++  +G    F+ +V P+CLP+     +    C +SGWGDT ++Y   LL   V ++  + C   YKG+ T RM CAG  +E   ID+CQGDSGGPL+C + NG + I G TSWG GC +   PGVY K+     WIK+   L
Sbjct:  301 NCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGP--SSLSSKAEFGSGEG-FIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRC----------------------------SNESNDIIGIPTGP---PVRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQ-----VKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCILRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAKL 809          

HSP 2 Score: 153.68 bits (387), Expect = 5.817e-37
Identity = 99/295 (33.56%), Postives = 148/295 (50.17%), Query Frame = 1
Query: 2077 SKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVVTQPPKPTAKV 2958
            SK  +HR + G  +  + C++       +RL G   +YEG+VEV ++G WG +CDD +D   AEV+C+QLGF G  ++   A   +G+   P +L+DE+ C G E+SL+ C+ S W  HNC   E AGV C                             +  +DG+          + L+ G     G VE+   G  G+VCDD + + +A V+CR L   G +       FG G G I LD++ CTGEE +L  CP   WG+H C+H ED+GV C    ++++  P  P  ++
Sbjct:  186 SKSLNHRSSHGLIA-AVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWA--HYGQGSGP-ILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC-----------------------------DPFTDGA----------LRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGIPTGPPVRL 437          

HSP 3 Score: 102.064 bits (253), Expect = 6.603e-21
Identity = 85/274 (31.02%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAV--NRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGL 2976
            +RL G ++  +G VE+   G+WG +C + +    A VVC+QLG    +  I +A+   R G   +P  L     C G E +L  C +S   +H      IA V C             SKD                              + L  G +   GRVE+   G  GT+CDD +DD DA VICR L   G+ +A     +G+G+G I+LD + C G E +L+ C   KW  H C H ED GV C   D       + +    P  GL
Sbjct:  104 VRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLG----VSEIGTALISTRSGSWLAPEHL-QAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCS-----------SSKDSQ--------------------------TPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC---DPFTDGALRLSGGARPGEGL 332          

HSP 4 Score: 62.7734 bits (151), Expect = 8.427e-9
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS 636
            P +   +RL G       EG VEVY +    WG VCDD W  L+A V CRQLGF   +  +++ + +G G+  +    +  + CTG E+SL++CPH S
Sbjct:  314 PFTDGALRLSG--GARPGEGLVEVYYNGD--WGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAE-FGSGEGFI---FLDDVTCTGEEESLLECPHSS 403          

HSP 5 Score: 58.9214 bits (141), Expect = 1.054e-7
Identity = 41/118 (34.75%), Postives = 60/118 (50.85%), Query Frame = 1
Query:  337 GAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSCVY 681
            G P  P +  + GE   +  EGRVEV+ +    WG VCDD W   DA V CRQLG R  A+  T    +G G   ++   +  ++C+G+E +L +C    +   +    + AGV C Y
Sbjct:  428 GIPTGPPVRLMDGE---STKEGRVEVFLNGE--WGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMA-YFGEGQGPIH---MDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDY 536          

HSP 6 Score: 56.9954 bits (136), Expect = 4.802e-7
Identity = 39/96 (40.62%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSY--CSG-KSAGVSC 675
            EGRVEV+      WG +CDD+W+  DA V CRQLGF  K + A     YG+G   +    + ++ C GNE SL  C      +  C   + AGVSC
Sbjct:  223 EGRVEVFHEGR--WGTICDDHWDDSDAEVICRQLGFSGKPK-AWVWAHYGQGSGPI---LLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 312          

HSP 7 Score: 54.6842 bits (130), Expect = 2.188e-6
Identity = 27/62 (43.55%), Postives = 34/62 (54.84%), Query Frame = 1
Query: 1222 YRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            Y G IS T  GS C  W +    +  Q  P  GLGDHN CRNPD  + PWC+   ++GV  +
Sbjct:   35 YNGTISVTETGSECLHWKEFPDYI--QQYPGRGLGDHNHCRNPDGGVVPWCFYRKSSGVISW 94          
BLAST of Neurotrypsin vs. Ensembl Xenopus
Match: ENSXETT00000001537.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 317.005 bits (811), Expect = 1.167e-90
Identity = 203/548 (37.04%), Postives = 288/548 (52.55%), Query Frame = 1
Query: 2113 NSDEIDCTTVTFPPF---EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            N D I+   V+  PF    +RL+G     EG VEV Y G+WG VCDDG+    A+VVC+QLGF G   S  S+   FG      + +D++ CTG E SL EC HS W  H+C   E  GV C                            +N+ +D    P G     V L DG   K GRVE+   G  G+VCDD + D DAAV+CR L   G A+A     FGEG G I +DN++C+G E  L  C     G H C H ED GVIC   ++   Q      K        CG   + H++ R+VGG ++  G++PWQ  +R K    ++   CGA++++  W + AAHC+ R       Y +R GD+    +D++E+   ++++++H N+ + + D D AL++++  +G    F+ +V P+CLP+     +    C +SGWGDT ++Y   LL   V ++  + C   YKG+ T RM CAG  +E   ID+CQGDSGGPL+C + NG + I G TSWG GC +   PGVY K+     WIK+   L
Sbjct:  320 NCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGP--SSLSSKAEFGSGEG-FIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRC----------------------------SNESNDIIGIPTGP---PVRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQ-----VKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCILRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAKL 828          

HSP 2 Score: 153.68 bits (387), Expect = 7.244e-37
Identity = 99/295 (33.56%), Postives = 148/295 (50.17%), Query Frame = 1
Query: 2077 SKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVVTQPPKPTAKV 2958
            SK  +HR + G  +  + C++       +RL G   +YEG+VEV ++G WG +CDD +D   AEV+C+QLGF G  ++   A   +G+   P +L+DE+ C G E+SL+ C+ S W  HNC   E AGV C                             +  +DG+          + L+ G     G VE+   G  G+VCDD + + +A V+CR L   G +       FG G G I LD++ CTGEE +L  CP   WG+H C+H ED+GV C    ++++  P  P  ++
Sbjct:  205 SKSLNHRSSHGLIA-AVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWA--HYGQGSGP-ILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC-----------------------------DPFTDGA----------LRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGIPTGPPVRL 456          

HSP 3 Score: 102.064 bits (253), Expect = 7.986e-21
Identity = 87/274 (31.75%), Postives = 120/274 (43.80%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAV--NRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGL 2976
            +RL G ++  +G VE+   G+WG +C + +    A VVC+QLG    +  I +A+   R G   +P  L     C G E +L  C +S   +H      IA V C             SKD                   S  P       + L  G +   GRVE+   G  GT+CDD +DD DA VICR L   G+ +A     +G+G+G I+LD + C G E +L+ C   KW  H C H ED GV C   D       + +    P  GL
Sbjct:  123 VRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLG----VSEIGTALISTRSGSWLAPEHL-QAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCS-----------SSKD-------------------SQTP-------LRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC---DPFTDGALRLSGGARPGEGL 351          

HSP 4 Score: 62.7734 bits (151), Expect = 7.693e-9
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS 636
            P +   +RL G       EG VEVY +    WG VCDD W  L+A V CRQLGF   +  +++ + +G G+  +    +  + CTG E+SL++CPH S
Sbjct:  333 PFTDGALRLSG--GARPGEGLVEVYYNGD--WGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAE-FGSGEGFI---FLDDVTCTGEEESLLECPHSS 422          

HSP 5 Score: 59.3066 bits (142), Expect = 9.133e-8
Identity = 41/118 (34.75%), Postives = 60/118 (50.85%), Query Frame = 1
Query:  337 GAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSCVY 681
            G P  P +  + GE   +  EGRVEV+ +    WG VCDD W   DA V CRQLG R  A+  T    +G G   ++   +  ++C+G+E +L +C    +   +    + AGV C Y
Sbjct:  447 GIPTGPPVRLMDGE---STKEGRVEVFLNGE--WGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMA-YFGEGQGPIH---MDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDY 555          

HSP 6 Score: 56.9954 bits (136), Expect = 4.490e-7
Identity = 39/96 (40.62%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSY--CSG-KSAGVSC 675
            EGRVEV+      WG +CDD+W+  DA V CRQLGF  K + A     YG+G   +    + ++ C GNE SL  C      +  C   + AGVSC
Sbjct:  242 EGRVEVFHEGR--WGTICDDHWDDSDAEVICRQLGFSGKPK-AWVWAHYGQGSGPI---LLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 331          

HSP 7 Score: 55.0694 bits (131), Expect = 1.785e-6
Identity = 27/62 (43.55%), Postives = 34/62 (54.84%), Query Frame = 1
Query: 1222 YRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            Y G IS T  GS C  W +    +  Q  P  GLGDHN CRNPD  + PWC+   ++GV  +
Sbjct:   54 YNGTISVTETGSECLHWKEFPDYI--QQYPGRGLGDHNHCRNPDGGVVPWCFYRKSSGVISW 113          
BLAST of Neurotrypsin vs. Ensembl Xenopus
Match: ENSXETT00000001485.1 (neurotrypsin-like [Source:NCBI gene;Acc:100497588])

HSP 1 Score: 315.464 bits (807), Expect = 2.819e-90
Identity = 202/548 (36.86%), Postives = 287/548 (52.37%), Query Frame = 1
Query: 2113 NSDEIDCTTVTFPPF---EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            N D I+   V+  PF    +RL+G     EG VEV Y G+WG VCDDG+    A+VVC+QLGF G   S  S+   FG      + +D++ CTG E SL EC HS W  H+C   E  GV C                            +N+ +D    P       V L DG   K GRVE+   G  G+VCDD + D DAAV+CR L   G A+A     FGEG G I +DN++C+G E  L  C     G H C H ED GVIC   ++   Q      K        CG   + H++ R+VGG ++  G++PWQ  +R K    ++   CGA++++  W + AAHC+ R       Y +R GD+    +D++E+   ++++++H N+ + + D D AL++++  +G    F+ +V P+CLP+     +    C +SGWGDT ++Y   LL   V ++  + C   YKG+ T RM CAG  +E   ID+CQGDSGGPL+C + NG + I G TSWG GC +   PGVY K+     WIK+   L
Sbjct:  309 NCDHIEDAGVSCDPFTDGALRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGP--SSLSSKAEFGSGEG-FIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRC----------------------------SNESNDIIGPP-------VRLMDGESTKEGRVEVFLNGEWGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMAYFGEGQGPIHMDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDYIEKRDNQ-----VKAKGGVSSVCGISLVPHRKKRIVGGTKSARGSWPWQASLRLKGFHKETRLLCGATLINNCWALTAAHCFKRFGKQVHRYSLRVGDYHTGVEDEFERELPLQKIVIHKNYRSTSNDNDIALVRVQGKEGHCFPFSLHVLPICLPEKKEKTNNWQPCFISGWGDTGTSYSRTLLQGAVSVLPKDTCILRYKGKFTNRMVCAGTLFEDRLIDSCQGDSGGPLMCQRSNGQWIIVGITSWGYGCGRKGYPGVYTKVSKFTPWIKKAAKL 813          

HSP 2 Score: 154.451 bits (389), Expect = 3.484e-37
Identity = 99/288 (34.38%), Postives = 143/288 (49.65%), Query Frame = 1
Query: 2077 SKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPP 2940
            SK  +HR + G  +  + C++       +RL G   +YEG+VEV ++G WG +CDD +D   AEV+C+QLGF G  ++   A   +G+   P +L+DE+ C G E+SL+ C+ S W  HNC   E AGV C                             +  +DG+          + L+ G     G VE+   G  G+VCDD + + +A V+CR L   G +       FG G G I LD++ CTGEE +L  CP   WG+H C+H ED+GV C      +  PP
Sbjct:  194 SKSLNHRSSHGLIA-AVTCSSSKDSQTPLRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWA--HYGQGSGP-ILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC-----------------------------DPFTDGA----------LRLSGGARPGEGLVEVYYNGDWGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAEFGSGEGFIFLDDVTCTGEEESLLECPHSSWGQHDCSHSEDVGVRCSNESNDIIGPP 438          

HSP 3 Score: 102.064 bits (253), Expect = 6.421e-21
Identity = 87/274 (31.75%), Postives = 120/274 (43.80%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAV--NRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGL 2976
            +RL G ++  +G VE+   G+WG +C + +    A VVC+QLG    +  I +A+   R G   +P  L     C G E +L  C +S   +H      IA V C             SKD                   S  P       + L  G +   GRVE+   G  GT+CDD +DD DA VICR L   G+ +A     +G+G+G I+LD + C G E +L+ C   KW  H C H ED GV C   D       + +    P  GL
Sbjct:  112 VRLVGDLSFNQGLVELYLNGQWGTICGEQWTDWDASVVCRQLG----VSEIGTALISTRSGSWLAPEHL-QAANCRGNEKALLHCHYSKSLNHRSSHGLIAAVTCSS-----------SKD-------------------SQTP-------LRLVGGKERYEGRVEVFHEGRWGTICDDHWDDSDAEVICRQLGFSGKPKAWVWAHYGQGSGPILLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC---DPFTDGALRLSGGARPGEGL 340          

HSP 4 Score: 62.7734 bits (151), Expect = 7.438e-9
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS 636
            P +   +RL G       EG VEVY +    WG VCDD W  L+A V CRQLGF   +  +++ + +G G+  +    +  + CTG E+SL++CPH S
Sbjct:  322 PFTDGALRLSG--GARPGEGLVEVYYNGD--WGSVCDDGWTELNAQVVCRQLGFSGPSSLSSKAE-FGSGEGFI---FLDDVTCTGEEESLLECPHSS 411          

HSP 5 Score: 56.9954 bits (136), Expect = 4.811e-7
Identity = 39/96 (40.62%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSY--CSG-KSAGVSC 675
            EGRVEV+      WG +CDD+W+  DA V CRQLGF  K + A     YG+G   +    + ++ C GNE SL  C      +  C   + AGVSC
Sbjct:  231 EGRVEVFHEGR--WGTICDDHWDDSDAEVICRQLGFSGKPK-AWVWAHYGQGSGPI---LLDEVHCIGNESSLDLCEKSKWEHHNCDHIEDAGVSC 320          

HSP 6 Score: 55.0694 bits (131), Expect = 1.549e-6
Identity = 33/91 (36.26%), Postives = 45/91 (49.45%), Query Frame = 1
Query: 1147 EKLPFICQMNIPQSRSDCYEDNGLD----YRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            + L   C + +    S C   +G+D    Y G IS T  GS C  W +    +  Q  P  GLGDHN CRNPD  + PWC+   ++GV  +
Sbjct:   16 QLLKSCCMLFLLAGYSLC--SDGIDSLGYYNGTISVTETGSECLHWKEFPDYI--QQYPGRGLGDHNHCRNPDGGVVPWCFYRKSSGVISW 102          

HSP 7 Score: 55.0694 bits (131), Expect = 1.947e-6
Identity = 39/113 (34.51%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  352 PQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSCVY 681
            P +  + GE   +  EGRVEV+ +    WG VCDD W   DA V CRQLG R  A+  T    +G G   ++   +  ++C+G+E +L +C    +   +    + AGV C Y
Sbjct:  437 PPVRLMDGE---STKEGRVEVFLNGE--WGSVCDDGWTDDDAAVVCRQLGHRGPAKARTMA-YFGEGQGPIH---MDNVECSGSENTLAECRKQDSGIHNCWHNEDAGVICDY 540          
BLAST of Neurotrypsin vs. Ensembl Xenopus
Match: tmem132a (transmembrane protein 132A [Source:Xenbase;Acc:XB-GENE-1009879])

HSP 1 Score: 287.345 bits (734), Expect = 2.402e-81
Identity = 192/551 (34.85%), Postives = 279/551 (50.64%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGY--EAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +      IRL G    +EG++EV ++  WG VCDDG+     +VVC+QLG+      +    N +  + +  + +D+I CTG E+ + +C    W  H+C   E   + C  D                       ++T+    G           + L DG   K GRVE+   G  GT+CDD + DKDA+V+CR L   G A+A     FGEG G I +DN++CTG E +L +C     G H C H ED GVIC   D ++ +      K    + L CG R    +  R++GG  +V G +PWQV +R K    D    CGA+++S  W++ AAHC+ R  ++   Y +R GD+     ++YE+   I+++I+H ++     DYD ALI++       ++ + +V P CLP     P    S C ++GWGDT   Y   L  A V L+    C E Y+ + T RM CAG       +D+CQGDSGGPLVC +  G + ++G TSWG GC    +PGVY K+   + WIK  T L
Sbjct:  237 NCGHKEDAGVSCTPLA--DGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLNTQVVCRQLGYKNGKILLE---NHYAGS-AGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIACHPD-----------------------NETHRPLSGP---------PLRLMDGETKKEGRVEIYLNGQWGTICDDGWTDKDASVVCRQLGYKGPAKARTMAYFGEGKGPIHVDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVIC---DYIIKKSTFAANK--ELSPLVCGSRLQHRRPKRIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRSYVIRVGDYHTLVPEEYEEDMTIQQIIIHNDYRPDGNDYDIALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCYITGWGDTGRAYSRTLQQATVTLLPKRVCEERYRSQFTGRMLCAGSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTSWGYGCGVKDSPGVYTKVSAFIPWIKSVTNL 744          

HSP 2 Score: 139.428 bits (350), Expect = 1.147e-32
Identity = 90/258 (34.88%), Postives = 129/258 (50.00%), Query Frame = 1
Query: 2164 RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQP 2937
            RL G  + YEG++EV + G WG VCDD +D   AEVVC+QLG+ G  ++   A   FG+     +L+DE++CTG E S+EEC+ SPW  HNC   E AGV C                                +DG+          + LA G  +  GR+E+      GTVCDD + D +  V+CR L      + + +  +   AG I LD++ CTG+E  +  C    WG+H C+H+ED+ + C  PD    +P
Sbjct:  150 RLVGGSSPYEGRIEVYHSGHWGTVCDDQWDDADAEVVCRQLGYGGVAKAWSQA--HFGEGVG-FILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSC-----------------------------TPLADGA----------IRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLNTQVVCRQLGYK-NGKILLENHYAGSAGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIAC-HPDNETHRP 363          

HSP 3 Score: 88.9669 bits (219), Expect = 6.095e-17
Identity = 50/102 (49.02%), Postives = 61/102 (59.80%), Query Frame = 1
Query: 2602 VKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +   L  G     GR+E+   G  GTVCDD +DD DA V+CR L   G A+A     FGEG G I+LD ++CTG EL++E C    WGEH C HKED GV C
Sbjct:  147 IPARLVGGSSPYEGRIEVYHSGHWGTVCDDQWDDADAEVVCRQLGYGGVAKAWSQAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSC 248          

HSP 4 Score: 67.781 bits (164), Expect = 2.419e-10
Identity = 52/168 (30.95%), Postives = 74/168 (44.05%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCV---------------------------YNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFIL 810
            EGR+EVY S    WG VCDD W+  DA V CRQLG+   A+ A  Q  +G G   V    + ++QCTGNE S+ +C   P    +    + AGVSC                            +   C +GW   N    Q+  +Q+ YK      ++H +  A ++
Sbjct:  159 EGRIEVYHSGH--WGTVCDDQWDDADAEVVCRQLGYGGVAK-AWSQAHFGEG---VGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCTPLADGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLN---TQVVCRQLGYKNGKILLENHYAGSAGVI 317          

HSP 5 Score: 63.929 bits (154), Expect = 3.515e-9
Identity = 43/108 (39.81%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYC-SGKSAGVSCVY 681
            LR  +  T  EGRVE+Y +    WG +CDD W   DA+V CRQLG++  A+  T    +G G   ++   V  ++CTG E+SL DC      T  C   + AGV C Y
Sbjct:  369 LRLMDGETKKEGRVEIYLNGQ--WGTICDDGWTDKDASVVCRQLGYKGPAKART-MAYFGEGKGPIH---VDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVICDY 470          
BLAST of Neurotrypsin vs. Ensembl Xenopus
Match: tmem132a (transmembrane protein 132A [Source:Xenbase;Acc:XB-GENE-1009879])

HSP 1 Score: 287.345 bits (734), Expect = 1.749e-80
Identity = 192/551 (34.85%), Postives = 279/551 (50.64%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGY--EAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +      IRL G    +EG++EV ++  WG VCDDG+     +VVC+QLG+      +    N +  + +  + +D+I CTG E+ + +C    W  H+C   E   + C  D                       ++T+    G           + L DG   K GRVE+   G  GT+CDD + DKDA+V+CR L   G A+A     FGEG G I +DN++CTG E +L +C     G H C H ED GVIC   D ++ +      K    + L CG R    +  R++GG  +V G +PWQV +R K    D    CGA+++S  W++ AAHC+ R  ++   Y +R GD+     ++YE+   I+++I+H ++     DYD ALI++       ++ + +V P CLP     P    S C ++GWGDT   Y   L  A V L+    C E Y+ + T RM CAG       +D+CQGDSGGPLVC +  G + ++G TSWG GC    +PGVY K+   + WIK  T L
Sbjct:  344 NCGHKEDAGVSCTPLA--DGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLNTQVVCRQLGYKNGKILLE---NHYAGS-AGVIWLDDISCTGKESMISQCSRRDWGKHDCSHQEDVHIACHPD-----------------------NETHRPLSGP---------PLRLMDGETKKEGRVEIYLNGQWGTICDDGWTDKDASVVCRQLGYKGPAKARTMAYFGEGKGPIHVDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVIC---DYIIKKSTFAANK--ELSPLVCGSRLQHRRPKRIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCWVLTAAHCFKRYGNNTRSYVIRVGDYHTLVPEEYEEDMTIQQIIIHNDYRPDGNDYDIALIRLHGTAEQCVQLSTHVLPACLPLRRERPQKTASNCYITGWGDTGRAYSRTLQQATVTLLPKRVCEERYRSQFTGRMLCAGSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTSWGYGCGVKDSPGVYTKVSAFIPWIKSVTNL 851          

HSP 2 Score: 124.02 bits (310), Expect = 1.203e-27
Identity = 91/267 (34.08%), Postives = 121/267 (45.32%), Query Frame = 1
Query: 2110 DNSDEIDCTTVTFPPFEIRLTGSVNKYEGKV-EVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +N   ID          +RL GS +K EG V EV   G WG +C   +D   A V+C+QL       +    ++  G+    +    +++C G E ++ +C    WRS  C  D  A V C V +A         KD + I                            L  G     GR+E+   G  GTVCDD +DD DA V+CR L   G A+A     FGEG G I+LD ++CTG EL++E C    WGEH C HKED GV C
Sbjct:  126 NNHGRIDWGYCDCKQGSVRLRGSKSKSEGSVVEVYVNGAWGTICSGQWDDNDASVICRQLELGDKGTAKKIVLSGVGQ---ISAFWTDVQCRGNEENILQCAKDIWRSGACPQDTAAAVTCSVIQA---------KDSVFI-------------------------PARLVGGSSPYEGRIEVYHSGHWGTVCDDQWDDADAEVVCRQLGYGGVAKAWSQAHFGEGVGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSC 355          

HSP 3 Score: 67.781 bits (164), Expect = 2.312e-10
Identity = 52/168 (30.95%), Postives = 74/168 (44.05%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCV---------------------------YNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFIL 810
            EGR+EVY S    WG VCDD W+  DA V CRQLG+   A+ A  Q  +G G   V    + ++QCTGNE S+ +C   P    +    + AGVSC                            +   C +GW   N    Q+  +Q+ YK      ++H +  A ++
Sbjct:  266 EGRIEVYHSGH--WGTVCDDQWDDADAEVVCRQLGYGGVAK-AWSQAHFGEG---VGFILLDEVQCTGNELSIEECQRSPWGEHNCGHKEDAGVSCTPLADGAIRLAGGKGSHEGRLEVFHKARWGTVCDDGWTDLN---TQVVCRQLGYKNGKILLENHYAGSAGVI 424          

HSP 4 Score: 63.5438 bits (153), Expect = 4.123e-9
Identity = 43/108 (39.81%), Postives = 58/108 (53.70%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYC-SGKSAGVSCVY 681
            LR  +  T  EGRVE+Y +    WG +CDD W   DA+V CRQLG++  A+  T    +G G   ++   V  ++CTG E+SL DC      T  C   + AGV C Y
Sbjct:  476 LRLMDGETKKEGRVEIYLNGQ--WGTICDDGWTDKDASVVCRQLGYKGPAKART-MAYFGEGKGPIH---VDNVRCTGYERSLADCIKQDIGTHNCRHSEDAGVICDY 577          
BLAST of Neurotrypsin vs. Ensembl Mouse
Match: Prss12 (protease, serine 12 neurotrypsin (motopsin) [Source:MGI Symbol;Acc:MGI:1100881])

HSP 1 Score: 302.753 bits (774), Expect = 1.507e-86
Identity = 211/593 (35.58%), Postives = 300/593 (50.59%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRD-NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            IA  +  AH+   S     ++ +CT   + IE   K    + NCG   D  + C  +T     IRL G  + +EG++EV Y+G+WG VCDDG+      V C+ LGF    +S   +VN F  +  P + +D++ C+G E S  +C    W  H+C   E  G+ C  D                             SDG     G     + L DG + K GRVE+   G  GT+CDD + DK AAVICR L   G A+A     FGEG G I +DN+KCTG E  L +C     G H C H ED GVIC   D +  +      K   ++G  CG R +  ++ R++GG  ++ GA+PWQ  +R +    D    CGA++LS  W++ AAHC+ R  ++   Y VR GD+     +++EQ   ++++++H N+     DYD AL++++       + + +V P CLP     P    S C ++GWGDT   Y   L  A VPL+    C E YKG  T RM CAG   E   +D+CQGDSGGPL+C K +  + ++G TSWG GC     PGVY ++   + WIK  T L
Sbjct:  212 IAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLT--DGVIRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQS---SVNHFDGSNRP-IWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPD-----------------------------SDGHRLSPG---FPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVIC---DYLEKKASSSGNKEMLSSG--CGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSVTSL 761          

HSP 2 Score: 132.88 bits (333), Expect = 1.238e-30
Identity = 87/254 (34.25%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDE 2922
            IRL G  + +EG+VE+ + G+WG +CDD +D   A+V+C+QLG  G  ++ H A   FG+   P +L+DE++CTG E S+E+C  S W  HNC   E AGV                    C+ L          +DG           + LA G     GR+E+   G  GTVCDD + + +  V CR+L      Q+  +  F      I LD++ C+G+E++   C   +WG H C+H+ED+G+ C  PD 
Sbjct:  166 IRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQA--HFGEGSGP-ILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGV-------------------SCVPL----------TDGV----------IRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVN-HFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTC-YPDS 375          

HSP 3 Score: 98.2117 bits (243), Expect = 8.225e-20
Identity = 53/107 (49.53%), Postives = 66/107 (61.68%), Query Frame = 1
Query: 2587 EGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +G     + L  G     GRVEL   G  GT+CDD +D+ DA VICR L + G A+A     FGEG+G I+LD ++CTG EL++E CP   WGEH C HKED GV C
Sbjct:  159 QGPALPVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 265          

HSP 4 Score: 73.559 bits (179), Expect = 3.010e-12
Identity = 49/116 (42.24%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSCV 678
             P  P +IRL G N  + +EGRVE+Y +    WG +CDD W+  DA+V CRQLG    A+ A  Q  +G G   +    + +++CTGNE S+  CP  S     C  K  AGVSCV
Sbjct:  160 GPALP-VIRLVGGN--SGHEGRVELYHAGQ--WGTICDDQWDNADADVICRQLGLSGIAK-AWHQAHFGEGSGPI---LLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCV 266          

HSP 5 Score: 62.3882 bits (150), Expect = 7.590e-9
Identity = 43/99 (43.43%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  334 DGAPESPQI-IRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            DG   SP   IRL  GEN     EGRVEV+ +    WG +CDD W    A V CRQLG++  AR  T    +G G   ++   +  ++CTGNEK+L DC
Sbjct:  376 DGHRLSPGFPIRLVDGENK---KEGRVEVFVNGQ--WGTICDDGWTDKHAAVICRQLGYKGPARART-MAYFGEGKGPIH---MDNVKCTGNEKALADC 465          
BLAST of Neurotrypsin vs. Ensembl Mouse
Match: Tmprss2 (transmembrane protease, serine 2 [Source:MGI Symbol;Acc:MGI:1354381])

HSP 1 Score: 176.407 bits (446), Expect = 2.782e-46
Identity = 134/425 (31.53%), Postives = 203/425 (47.76%), Query Frame = 1
Query: 2476 DRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKG--TVCXXXXXXXXAAVICRMLQIPGR---AQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWD--NASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLST--YPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            D  C+ SE  C     CIS S  CD    C +G DE   +C V++        +S  +++     K    VC DD+ +      C+ +        +Q I D+     +GA     L  +   ++L    +       C+ +  + + C                      ++CG R  V ++ R+VGG  A  G +PWQV +  +      H CG SI++ +WI+ AAHC   P S  R  T        S   Y    ++E++I HPN+++   + D AL+K++      + FN+ V+PVCLP  GM+ D + +C +SGWG T       + L AA VPLI+  +C     Y   +T  M CAG+  G +D+CQGDSGGPLV   NG++ + G TSWG+GCA+   PGVY  + +  DWI +Q
Sbjct:  109 DSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDE--NRC-VRLY------GQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQ-----SGATSFMKLNVSSGNVDLYKKLYH---SDSCSSRMVVSLRC----------------------IECGVRS-VKRQSRIVGGLNASPGDWPWQVSLHVQ----GVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQ----TPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQ 485          
BLAST of Neurotrypsin vs. Ensembl Mouse
Match: Tmprss15 (transmembrane protease, serine 15 [Source:MGI Symbol;Acc:MGI:1197523])

HSP 1 Score: 184.111 bits (466), Expect = 4.035e-46
Identity = 132/446 (29.60%), Postives = 217/446 (48.65%), Query Frame = 1
Query: 2425 RSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGA---------GAIVLD-NLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTG--DWDNASDDKYEQVFE--IEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWG-DTLS--TYPEKLLAAEVPLIKHERCFE-FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWI 3708
            R    + +  +G    +   C + EF+C KD  CI L  +CD    C DGSDE    C   V   +G  + +G V+ +   +    C +++  + +  +C +L +     ++     G G          G+++L  +L+C+ + L L           +C HK      CG          K T KV P                ++VGG +A  GA+PW V +  +    D   CGAS++S DW++ AAHC  R   D    T        S+    QV    +++++++P+++      D A++ +E      + + +Y+QP+CLP+   +  P   C ++GWG D ++  +  + L  A+VPLI +E+C +   +  +TE M CAGYE GGID+CQGDSGGPL+C+ N  + + G TS+G  CA P +PGVY ++   ++WI
Sbjct:  668 RRKGFKANFTSGYYLGIPEPCQDDEFQC-KDGNCIPLGNLCDSYPHCRDGSDE--ASC---VRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPNGSLILTPSLQCSQDSLIL----------LQCNHKS-----CG--------EKKVTQKVSP----------------KIVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLE----FKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWI 1064          

HSP 2 Score: 52.7582 bits (125), Expect = 7.453e-6
Identity = 36/145 (24.83%), Postives = 57/145 (39.31%), Query Frame = 1
Query: 2002 GAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGK----NRSPN---LLVDEIKCTGTENSLEECKH 2415
            G +  +   C  ++F+C  G CI L   CD   +C D SDE  C         +R         G V+      W   C + +  + +  VC  LG   A  S+  +    G     N++PN   +L   ++C+     L +C H
Sbjct:  679 GYYLGIPEPCQDDEFQCKDGNCIPLGNLCDSYPHCRDGSDEASC---------VRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPNGSLILTPSLQCSQDSLILLQCNH 814          
BLAST of Neurotrypsin vs. Ensembl Mouse
Match: Tmprss15 (transmembrane protease, serine 15 [Source:MGI Symbol;Acc:MGI:1197523])

HSP 1 Score: 183.726 bits (465), Expect = 4.721e-46
Identity = 132/446 (29.60%), Postives = 217/446 (48.65%), Query Frame = 1
Query: 2425 RSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGA---------GAIVLD-NLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTG--DWDNASDDKYEQVFE--IEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWG-DTLS--TYPEKLLAAEVPLIKHERCFE-FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWI 3708
            R    + +  +G    +   C + EF+C KD  CI L  +CD    C DGSDE    C   V   +G  + +G V+ +   +    C +++  + +  +C +L +     ++     G G          G+++L  +L+C+ + L L           +C HK      CG          K T KV P                ++VGG +A  GA+PW V +  +    D   CGAS++S DW++ AAHC  R   D    T        S+    QV    +++++++P+++      D A++ +E      + + +Y+QP+CLP+   +  P   C ++GWG D ++  +  + L  A+VPLI +E+C +   +  +TE M CAGYE GGID+CQGDSGGPL+C+ N  + + G TS+G  CA P +PGVY ++   ++WI
Sbjct:  653 RRKGFKANFTSGYYLGIPEPCQDDEFQC-KDGNCIPLGNLCDSYPHCRDGSDE--ASC---VRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPNGSLILTPSLQCSQDSLIL----------LQCNHKS-----CG--------EKKVTQKVSP----------------KIVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLE----FKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWI 1049          

HSP 2 Score: 52.7582 bits (125), Expect = 8.289e-6
Identity = 36/145 (24.83%), Postives = 57/145 (39.31%), Query Frame = 1
Query: 2002 GAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGK----NRSPN---LLVDEIKCTGTENSLEECKH 2415
            G +  +   C  ++F+C  G CI L   CD   +C D SDE  C         +R         G V+      W   C + +  + +  VC  LG   A  S+  +    G     N++PN   +L   ++C+     L +C H
Sbjct:  664 GYYLGIPEPCQDDEFQCKDGNCIPLGNLCDSYPHCRDGSDEASC---------VRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPNGSLILTPSLQCSQDSLILLQCNH 799          
BLAST of Neurotrypsin vs. Ensembl Mouse
Match: F11 (coagulation factor XI [Source:MGI Symbol;Acc:MGI:99481])

HSP 1 Score: 172.555 bits (436), Expect = 5.449e-44
Identity = 97/242 (40.08%), Postives = 141/242 (58.26%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYA---RPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTL--STYPEKLLAAEVPLIKHERCFEFYK-GRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            RVVGG  +V+G +PWQV +         H CG SI+   WI+ AAHC++    PK   RV  G  + +  ++    F ++E+I+H  +  A   YD AL+K+E      + + ++ +P+CLP  G     +++C V+GWG T         L  A+VPL+ +E C   Y+  ++T +M CAGY+ GG DTC+GDSGGPL CK NGV+ + G TSWG GC Q + PGVY  +   +DWI E+T
Sbjct:  389 RVVGGAASVHGEWPWQVTLHIS----QGHLCGGSIIGNQWILTAAHCFSGIETPK-KLRVYGGIVNQSEINEGTAFFRVQEMIIHDQYTTAESGYDIALLKLES----AMNYTDFQRPICLPSKGDRNAVHTECWVTGWGYTALRGEVQSTLQKAKVPLVSNEECQTRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILEKT 621          
BLAST of Neurotrypsin vs. UniProt/SwissProt
Match: sp|Q5G265|NETR_SAGLB (Neurotrypsin OS=Saguinus labiatus OX=78454 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.396e-86
Identity = 201/551 (36.48%), Postives = 286/551 (51.91%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYAR---PKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVCKVNG-VYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +T     IRL G    +EG++EV Y G+WG VCDDG+      VVC+QLGF    ++   + N F ++  P + +D++ C+G E    +C    W  H+C   E  G+ C                                  GS+         V L DG + K GRVE+   G  GT+CDD + DKDAAVICR L   G A+A     FGEG G I +DN+KCTG E +L +C     G H C H ED GVIC   D    +    + K   ++   CG R +  ++ R++GG  ++ G +PWQV +R K    D    CGA++LS  W++ AAHC+ R      +Y VR GD+     +++E+   ++E+++H  +   + DYD AL++++  +    +FN++V P CLP     P    S C ++GWGDT   Y   L  A + L+    C E YKGR T RM CAG  +E   +D+CQGDSGGPL+C+  G  + ++G TSWG GC    +PGVY K+   + WIK  T L
Sbjct:  368 NCGHKEDAGVSCTPLT--DGVIRLAGGKGSHEGRLEVYYSGQWGTVCDDGWTELNTYVVCRQLGFKYGKQA---SANHFEESAGP-IWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVGIACY--------------------------------PGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC---DYFGKKASGNSNKESLSS--VCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHRDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQEIVIHREYRPDSSDYDIALVRLQGPEEQCARFNSHVLPACLPLWRERPQKTASNCYITGWGDTGQAYSRTLQQAAIHLLPKRFCEERYKGRFTGRMLCAGNLHEHKHVDSCQGDSGGPLMCERPGESWVVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL 875          

HSP 2 Score: 142.51 bits (358), Expect = 1.350e-32
Identity = 90/262 (34.35%), Postives = 131/262 (50.00%), Query Frame = 1
Query: 2125 IDCTTVTFPPFEI-RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            + C+    P F I RL G  + +EG+VE+ + G+WG +CDD +D   AEV+C+QL   G  ++ H A   FG+   P +++DE++CTG E S+E+C  S W  HNC   E AGV C                                +DG           + LA G  +  GR+E+   G  GTVCDD + + +  V+CR L      QA  +  F E AG I LD++ C+G+E     C   +WG H C+H+ED+G+ C
Sbjct:  267 VMCSFSHGPAFPIIRLVGGSSVHEGRVELYHAGQWGTICDDQWDDADAEVICRQLSLSGIAKAWHQAY--FGEGSGP-VMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC-----------------------------TPLTDGV----------IRLAGGKGSHEGRLEVYYSGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASAN-HFEESAGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVGIAC 485          

HSP 3 Score: 128.642 bits (322), Expect = 2.629e-28
Identity = 91/275 (33.09%), Postives = 122/275 (44.36%), Query Frame = 1
Query: 2107 GDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVV 2928
            GD   ++D          +RL GS N++EG VEV   G WG VC   +D   A V+C QL   G   +  +  +  G      +    ++C G E ++  C+   W+   C     A V+C                                        G     + L  G     GRVEL   G  GT+CDD +DD DA VICR L + G A+A     FGEG+G ++LD ++CTG EL++E CP   WGEH C HKED GV C  L D V+
Sbjct:  152 GDARGKVDWGYCDCRHGSVRLRGSKNEFEGTVEVYANGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGL---IPVYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVMCSFS------------------------------------HGPAFPIIRLVGGSSVHEGRVELYHAGQWGTICDDQWDDADAEVICRQLSLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVI 387          

HSP 4 Score: 90.8929 bits (224), Expect = 1.040e-16
Identity = 53/131 (40.46%), Postives = 73/131 (55.73%), Query Frame = 1
Query: 2086 CDHRDNCGDN---SDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVC 2469
            C HR++ G       E    ++ FP   +RL    NK EG+VEV   G+WG +CDDG+  K A V+C+QLG+ G   +    +  FG+ + P + VD +KCTG E SL +C       HNCR  E AGV+C
Sbjct:  475 CSHREDVGIACYPGSEGHRLSLGFP---VRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARA--RTMAYFGEGKGP-IHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC 599          

HSP 5 Score: 67.3958 bits (163), Expect = 1.471e-9
Identity = 48/115 (41.74%), Postives = 63/115 (54.78%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSC 675
             P  P IIRL G +++  +EGRVE+Y +    WG +CDD W+  DA V CRQL     A+ A  Q  +G G   V    + +++CTGNE S+  CP  S     C  K  AGVSC
Sbjct:  274 GPAFP-IIRLVGGSSV--HEGRVELYHAGQ--WGTICDDQWDDADAEVICRQLSLSGIAK-AWHQAYFGEGSGPV---MLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 379          

HSP 6 Score: 65.0846 bits (157), Expect = 8.491e-9
Identity = 38/86 (44.19%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            + GEN     EGRVEV+ +    WG +CDD W   DA V CRQLG++  AR  T    +G G   ++   V  ++CTGNE+SL DC
Sbjct:  503 MDGENK---KEGRVEVFINGQ--WGTICDDGWTDKDAAVICRQLGYKGPARART-MAYFGEGKGPIH---VDNVKCTGNERSLADC 579          
BLAST of Neurotrypsin vs. UniProt/SwissProt
Match: sp|G3V801|NETR_RAT (Neurotrypsin OS=Rattus norvegicus OX=10116 GN=Prss12 PE=1 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 4.654e-86
Identity = 211/593 (35.58%), Postives = 302/593 (50.93%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRD-NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            IA  +  AH+   S     ++ +CT   + IE   K    + NCG   D  + C  +T     IRL+G  + +EG++EV Y+G+WG VCDDG+      V C+ LGF    +S   +VN F  +  P + +D++ C+G E S  +C    W  H+C   E  G+ C  D                             SDG     G     + L DG + + GRVE+   G  GT+CDD + DK AAVICR L   G A+A     FGEG G I +DN+KCTG E  L +C     G H C H ED GVIC   D    +      K   ++G  CG R +  ++ R++GG  ++ GA+PWQ  +R K    D    CGA++LS  W++ AAHC+ R  ++   Y VR GD+     +++EQ   ++++++H N+   + DYD AL++++ +     + + +V P CLP     P    S C ++GWGDT   Y   L  A VPL+    C E YKG  T RM CAG   E   +D+CQGDSGGPL+C K +  + ++G TSWG GC     PGVY ++   + WIK  T L
Sbjct:  212 IAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCAPLT--DGVIRLSGGKSVHEGRLEVYYRGQWGTVCDDGWTEMNTYVACRLLGFKYGKQS---SVNHFEGSSRP-IWLDDVSCSGKEASFIQCSRRQWGRHDCSHREDVGLTCYPD-----------------------------SDGHRLSPG---FPIRLMDGENKREGRVEVFVSGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVIC---DYYEKKTSGHGNKETLSSG--CGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLKSTHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKPDETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSVTSL 761          

HSP 2 Score: 133.65 bits (335), Expect = 5.366e-30
Identity = 86/253 (33.99%), Postives = 127/253 (50.20%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPD 2919
            IRL G  + +EG+VE+ + G+WG +CDD +D   AEV+C+QLG  G  ++ H A   FG+   P +L+DE++CTG E S+E+C  S W  HNC   E AGV C                                +DG           + L+ G     GR+E+   G  GTVCDD + + +  V CR+L      Q+  +  F   +  I LD++ C+G+E +   C   +WG H C+H+ED+G+ C  PD
Sbjct:  166 IRLVGGKSGHEGRVELYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQA--HFGEGSGP-ILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCA-----------------------------PLTDGV----------IRLSGGKSVHEGRLEVYYRGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVN-HFEGSSRPIWLDDVSCSGKEASFIQCSRRQWGRHDCSHREDVGLTC-YPD 374          

HSP 3 Score: 99.7525 bits (247), Expect = 1.942e-19
Identity = 57/115 (49.57%), Postives = 70/115 (60.87%), Query Frame = 1
Query: 2587 EGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVV 2928
            +G     + L  G     GRVEL   G  GT+CDD +DD DA VICR L + G A+A     FGEG+G I+LD ++CTG EL++E CP   WGEH C HKED GV C  L D V+
Sbjct:  159 QGPALPVIRLVGGKSGHEGRVELYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCAPLTDGVI 273          

HSP 4 Score: 69.707 bits (169), Expect = 2.987e-10
Identity = 47/116 (40.52%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSCV 678
             P  P +IRL G    + +EGRVE+Y +    WG +CDD W+  DA V CRQLG    A+ A  Q  +G G   +    + +++CTGNE S+  CP  S     C  K  AGVSC 
Sbjct:  160 GPALP-VIRLVGGK--SGHEGRVELYHAGQ--WGTICDDQWDDADAEVICRQLGLSGIAK-AWHQAHFGEGSGPI---LLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCA 266          

HSP 5 Score: 64.3142 bits (155), Expect = 1.319e-8
Identity = 44/99 (44.44%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  334 DGAPESPQI-IRLR-GENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            DG   SP   IRL  GEN     EGRVEV+ S    WG +CDD W    A V CRQLG++  AR  T    +G G   ++   +  ++CTGNEK+L DC
Sbjct:  376 DGHRLSPGFPIRLMDGENK---REGRVEVFVSGQ--WGTICDDGWTDKHAAVICRQLGYKGPARART-MAYFGEGKGPIH---MDNVKCTGNEKALADC 465          
BLAST of Neurotrypsin vs. UniProt/SwissProt
Match: sp|Q5G267|NETR_MACMU (Neurotrypsin OS=Macaca mulatta OX=9544 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 5.192e-86
Identity = 200/551 (36.30%), Postives = 288/551 (52.27%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYAR---PKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVCKVNG-VYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +T     IRL G    +EG++EV Y+G+WG VCDDG+      VVC+QLGF    ++   + N F ++  P + +D++ C+G E    +C    W  H+C   E                                D +  C  GS+         V L DG + K GRVE+   G  GT+CDD + DKDAAVICR L   G A+A     FGEG G I +DN+KCTG E +L +C     G H C H ED GVIC   D    +    + K   ++   CG R +  ++ R++GG  ++ G +PWQV +R K    D    CGA++LS  W++ AAHC+ R      +Y VR GD+     +++E+   ++++++H  +   + DYD AL++++  +    +F+++V P CLP     P    S C ++GWGDT   Y   L  A +PL+    C E YKGR T RM CAG  +E   +D+CQGDSGGPL+C+  G  + ++G TSWG GC    +PGVY K+   + WIK  T L
Sbjct:  368 NCGHKEDAGVSCTPLT--DGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQA---SANHFEESTGP-IWLDDVSCSGKETRFLQCSRRQWGQHDCSHHE--------------------------------DVSIACYPGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC---DYFGKKASGNSNKESLSS--VCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDSSDYDIALVRLQGPEEQCARFSSHVLPACLPFWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWAVYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL 875          

HSP 2 Score: 140.584 bits (353), Expect = 5.500e-32
Identity = 89/262 (33.97%), Postives = 130/262 (49.62%), Query Frame = 1
Query: 2125 IDCTTVTFPPFEI-RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            + C+    P F I RL G  + +EG+VE+ + G+WG +CDD +D   AEV+C+QLG  G  ++ H A   FG+   P +++DE++CTG E S+E+C  S W  HNC   E AGV C                                +DG           + LA G  +  GR+E+   G  GTVCDD + + +  V+CR L      QA  +  F E  G I LD++ C+G+E     C   +WG+H C+H ED+ + C
Sbjct:  267 VTCSFSRGPAFPIIRLVGGSSVHEGRVELYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQAY--FGEGSGP-VMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC-----------------------------TPLTDGV----------IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASAN-HFEESTGPIWLDDVSCSGKETRFLQCSRRQWGQHDCSHHEDVSIAC 485          

HSP 3 Score: 129.028 bits (323), Expect = 1.947e-28
Identity = 91/275 (33.09%), Postives = 121/275 (44.00%), Query Frame = 1
Query: 2107 GDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVV 2928
            GD   ++D          +RL G  N++EG VEV   G WG VC   +D   A V+C QL   G   +  +  +  G      +    ++C G E ++  C+   W+   C     A V C   R                                    G     + L  G     GRVEL   G  GT+CDD +DD DA VICR L + G A+A     FGEG+G ++LD ++CTG EL++E CP   WGEH C HKED GV C  L D V+
Sbjct:  152 GDARGKVDWGYCDCRHGSVRLRGGKNEFEGTVEVYASGAWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGL---IPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSR------------------------------------GPAFPIIRLVGGSSVHEGRVELYHAGQWGTICDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVI 387          

HSP 4 Score: 70.0922 bits (170), Expect = 2.300e-10
Identity = 49/115 (42.61%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSC 675
             P  P IIRL G +++  +EGRVE+Y +    WG +CDD W+  DA V CRQLG    A+ A  Q  +G G   V    + +++CTGNE S+  CP  S     C  K  AGVSC
Sbjct:  274 GPAFP-IIRLVGGSSV--HEGRVELYHAGQ--WGTICDDQWDDADAEVICRQLGLSGIAK-AWHQAYFGEGSGPV---MLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 379          

HSP 5 Score: 64.6994 bits (156), Expect = 9.560e-9
Identity = 38/86 (44.19%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            + GEN     EGRVEV+ +    WG +CDD W   DA V CRQLG++  AR  T    +G G   ++   V  ++CTGNE+SL DC
Sbjct:  503 MDGENK---KEGRVEVFINGQ--WGTICDDGWTDKDAAVICRQLGYKGPARART-MAYFGEGKGPIH---VDNVKCTGNERSLADC 579          
BLAST of Neurotrypsin vs. UniProt/SwissProt
Match: sp|O08762|NETR_MOUSE (Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.054e-85
Identity = 211/593 (35.58%), Postives = 300/593 (50.59%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRG-MCIELSKKCDHRD-NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            IA  +  AH+   S     ++ +CT   + IE   K    + NCG   D  + C  +T     IRL G  + +EG++EV Y+G+WG VCDDG+      V C+ LGF    +S   +VN F  +  P + +D++ C+G E S  +C    W  H+C   E  G+ C  D                             SDG     G     + L DG + K GRVE+   G  GT+CDD + DK AAVICR L   G A+A     FGEG G I +DN+KCTG E  L +C     G H C H ED GVIC   D +  +      K   ++G  CG R +  ++ R++GG  ++ GA+PWQ  +R +    D    CGA++LS  W++ AAHC+ R  ++   Y VR GD+     +++EQ   ++++++H N+     DYD AL++++       + + +V P CLP     P    S C ++GWGDT   Y   L  A VPL+    C E YKG  T RM CAG   E   +D+CQGDSGGPL+C K +  + ++G TSWG GC     PGVY ++   + WIK  T L
Sbjct:  212 IAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLT--DGVIRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQS---SVNHFDGSNRP-IWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPD-----------------------------SDGHRLSPG---FPIRLVDGENKKEGRVEVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGNEKALADCVKQDIGRHNCRHSEDAGVIC---DYLEKKASSSGNKEMLSSG--CGLRLLHRRQKRIIGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLCAGNLQEDNRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWIKSVTSL 761          

HSP 2 Score: 132.88 bits (333), Expect = 8.657e-30
Identity = 87/254 (34.25%), Postives = 129/254 (50.79%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDE 2922
            IRL G  + +EG+VE+ + G+WG +CDD +D   A+V+C+QLG  G  ++ H A   FG+   P +L+DE++CTG E S+E+C  S W  HNC   E AGV                    C+ L          +DG           + LA G     GR+E+   G  GTVCDD + + +  V CR+L      Q+  +  F      I LD++ C+G+E++   C   +WG H C+H+ED+G+ C  PD 
Sbjct:  166 IRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQA--HFGEGSGP-ILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGV-------------------SCVPL----------TDGV----------IRLAGGKSTHEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVN-HFDGSNRPIWLDDVSCSGKEVSFIQCSRRQWGRHDCSHREDVGLTC-YPDS 375          

HSP 3 Score: 98.2117 bits (243), Expect = 5.754e-19
Identity = 53/107 (49.53%), Postives = 66/107 (61.68%), Query Frame = 1
Query: 2587 EGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +G     + L  G     GRVEL   G  GT+CDD +D+ DA VICR L + G A+A     FGEG+G I+LD ++CTG EL++E CP   WGEH C HKED GV C
Sbjct:  159 QGPALPVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFGEGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 265          

HSP 4 Score: 73.559 bits (179), Expect = 2.106e-11
Identity = 49/116 (42.24%), Postives = 65/116 (56.03%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSCV 678
             P  P +IRL G N  + +EGRVE+Y +    WG +CDD W+  DA+V CRQLG    A+ A  Q  +G G   +    + +++CTGNE S+  CP  S     C  K  AGVSCV
Sbjct:  160 GPALP-VIRLVGGN--SGHEGRVELYHAGQ--WGTICDDQWDNADADVICRQLGLSGIAK-AWHQAHFGEGSGPI---LLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCV 266          

HSP 5 Score: 62.3882 bits (150), Expect = 5.309e-8
Identity = 43/99 (43.43%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  334 DGAPESPQI-IRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            DG   SP   IRL  GEN     EGRVEV+ +    WG +CDD W    A V CRQLG++  AR  T    +G G   ++   +  ++CTGNEK+L DC
Sbjct:  376 DGHRLSPGFPIRLVDGENK---KEGRVEVFVNGQ--WGTICDDGWTDKHAAVICRQLGYKGPARART-MAYFGEGKGPIH---MDNVKCTGNEKALADC 465          
BLAST of Neurotrypsin vs. UniProt/SwissProt
Match: sp|Q5G268|NETR_NOMLE (Neurotrypsin OS=Nomascus leucogenys OX=61853 GN=PRSS12 PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.647e-85
Identity = 199/551 (36.12%), Postives = 288/551 (52.27%), Query Frame = 1
Query: 2101 NCGDNSDE-IDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYAR---PKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPN-SKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVCKVNG-VYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            NCG   D  + CT +T     IRL G    +EG++EV Y+G+WG VCDDG+      VVC+QLGF    ++   + N F ++  P + +D++ C+G E    +C    W  H+C   E                                D +  C  G +         V L DG + K GRVE+   G  GT+CDD + DKDAAVICR L   G A+A     FGEG G I +DN+KCTG E +L +C     G H C H ED GVIC   D    +    + K   ++   CG R +  ++ R++GG  ++ G +PWQV +R K    D    CGA++LS  W++ AAHC+ R      +Y VR GD+     +++E+   ++++++H  +   + DYD AL++++  +    +F+++V P CLP     P    S C ++GWGDT   Y   L  A +PL+    C E YKGR T RM CAG  +E   +D+CQGDSGGPL+C+  G  + ++G TSWG+GC    +PGVY K+   + WIK  T L
Sbjct:  368 NCGHKEDAGVSCTPLT--DGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQA---SANHFEESTGP-IWLDDVSCSGKETRFLQCSRRQWGRHDCSHRE--------------------------------DVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC---DYFGKKASGNSNKESLSS--VCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRPDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVVYGVTSWGHGCGVKDSPGVYTKVSAFVPWIKSVTKL 875          

HSP 2 Score: 140.969 bits (354), Expect = 4.175e-32
Identity = 90/262 (34.35%), Postives = 130/262 (49.62%), Query Frame = 1
Query: 2125 IDCTTVTFPPFEI-RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            + C+    P F I RL G  + +EG+VE+ + G+WG VCDD +D   AEV+C+QLG  G  ++ H A   FG+   P +++DE++CTG E S+E+C  S W  HNC   E AGV C                                +DG           + LA G  +  GR+E+   G  GTVCDD + + +  V+CR L      QA  +  F E  G I LD++ C+G+E     C   +WG H C+H+ED+ + C
Sbjct:  267 VTCSFSHGPTFPIIRLVGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAY--FGEGSGP-VMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC-----------------------------TPLTDGV----------IRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELNTYVVCRQLGFKYGKQASAN-HFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHREDVSIAC 485          

HSP 3 Score: 127.872 bits (320), Expect = 4.999e-28
Identity = 93/275 (33.82%), Postives = 120/275 (43.64%), Query Frame = 1
Query: 2107 GDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICG-LPDEVV 2928
            GD   ++D          IRL G  N++EG VEV   G WG VC   +D   A V+C QL   G   +  +  +  G      +    ++C G E ++  C+   W+   C     A V C      T    R                                    L  G     GRVEL   G  GTVCDD +DD DA VICR L + G A+A     FGEG+G ++LD ++CTG EL++E CP   WGEH C HKED GV C  L D V+
Sbjct:  152 GDARGKVDWGYCDCRHGSIRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGL---IPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIR------------------------------------LVGGSSVHEGRVELYHAGQWGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCTPLTDGVI 387          

HSP 4 Score: 70.4774 bits (171), Expect = 2.008e-10
Identity = 48/109 (44.04%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  358 IIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSGKS-AGVSC 675
            IIRL G +++  +EGRVE+Y +    WG VCDD W+  DA V CRQLG    A+ A  Q  +G G   V    + +++CTGNE S+  CP  S     C  K  AGVSC
Sbjct:  279 IIRLVGGSSV--HEGRVELYHAGQ--WGTVCDDQWDDADAEVICRQLGLSGIAK-AWHQAYFGEGSGPV---MLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSC 379          

HSP 5 Score: 65.0846 bits (157), Expect = 8.636e-9
Identity = 38/86 (44.19%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC 624
            + GEN     EGRVEV+ +    WG +CDD W   DA V CRQLG++  AR  T    +G G   ++   V  ++CTGNE+SL DC
Sbjct:  503 MDGENK---KEGRVEVFINGQ--WGTICDDGWTDKDAAVICRQLGYKGPARART-MAYFGEGKGPIH---VDNVKCTGNERSLADC 579          
BLAST of Neurotrypsin vs. TrEMBL
Match: A0A267GUN8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012109g1 PE=3 SV=1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 471/1239 (38.01%), Postives = 672/1239 (54.24%), Query Frame = 1
Query:  217 TRHKRQAVSE--DETTFFDQNIPPLTGTGRSNTRFP----MRKVRDGAPESPQIIRLRGE-NALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCT--GNEKSLVDCPHDSTSYCS-GKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCS-ELPPPTATLKPQVTDPM--GFGQGGCQSIQ-YHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKI---LDVSDKLDYIDIPID------------KCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCT-AEQFKCTRGMCIELSKKCDHRDNCGDNSDEID--CTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPW-RSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIV-LDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVD-----------DYDSHWCGASILSEDWIIGAAHCYA---RPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXX-XXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLG--MVPDPNSKCLVSGWGDTLS-TYPEKLLAAEVPLIKHERCFEFYK-GRLTERMQCAGYEAGGIDTCQGDSGGPLVCKV----------------------NGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWI 3708
             R +R+A S       F D N  P  G  R++         R    G P +PQI+R+RG+   +  NEGRVEV  +   +WGLVC DY   ++A + C QLGF   A    +   YG G +   D  V  +QC   G+E +L DC       C    + G+ C+YN GC  GW SF+G CY++ T+     +A   CQ   +KL  +   +E N+I+N+LYT+++S+  +WTGG +   + D G     W +  TIH   Q     LWFPGF E  TD+RP GDP+ +SC+A+++ F + + +  V DVNYFWWDN+SC  +LPF+CQ  +  + +DCYE  G DYRG  +RT +G+ C  W D    +NP T P AGL  H  CRNPD D +PWCW +  N V+GYC++ +CS ELP      +PQ   PM  GFG   C   + + CPSM+SY   C+ + +VCD    C+GKEDED  FC+ Y C  + F+C     CI    VCDG  +C  G DE       E A + V  + ++++     ++  +D   +P D            +CA+ C  L  QF CKSF Y    E R  S+C LL    + +P      +    +Y +   C  A+ F C    C++ S+ C+  D+CGD SDEI+  C       +E+ L+G  + +EG++E+R   + G VCDDG +   A+V+C+QLG+ G    I +A  +FG+  +   ++  + C     ++ +C H PW  S  C    +AG++C +DR C+  E RC  D  C  LSK+CD   DCSDG DE E    + VTL+   +  +G VE+SRGG++G VCDD + D++  V+CR L IPGR    +  +F   AG ++ L +++C G E +L +C    WGE  C+  E + ++CGLP+  VT P    A     + + CG R   +   R+ GG  +     PWQV +R+KV               S WCG +ILS+ WI+ AAHC+     PKS + VR GDW+N + D+YE+ F+++ LI H  +     YD+D +L++I+ +    ++FN  VQP CLP+    M  DP SKCL+SGWG      YPE L  AEVPLI+ E C   Y+   +TERM CAGY+ GGID CQGDSGGPLVCK+                         +T+ G TS+GNGCA+P +PGVY  +    +WI
Sbjct:   63 ARSRREATSPFIPLRLFGDSNPEPQPGYPRTSPDSKPDELSRHRTGGVPPTPQIVRIRGDLMKMNPNEGRVEV--NYHGVWGLVCGDYVQQIEATLVCHQLGFELGANRVYKNSYYGTGHYKRQDIIVGHVQCKHDGDELTLFDCNRKLMPPCDLNSTTGIECIYNTGCDWGWSSFDGLCYRLETEPKTATEAATACQAKGAKLVSVNSLEEGNYITNMLYTKFRSLNAVWTGGQFGSFR-DVGSQYTSWTFVDTIHMARQ----PLWFPGF-EPGTDQRPAGDPQQRSCIAMSKLFQNPRSRRDV-DVNYFWWDNISCKTRLPFVCQ-KLAVASADCYEGIGTDYRGLAARTDKGTPCQPWGD-NQLINPSTYPNAGLSGHGLCRNPDGDAKPWCWVDNKNNVFGYCSLRQCSDELP------QPQEGPPMTPGFGHEKCDRHEDFFCPSMLSYRPVCVVERQVCDGFVDCVGKEDEDEAFCRNYTCTSDHFYCRKFHKCISMDQVCDGLADCDLGDDET------EEACMSVKAQAEAELANEFQMTAGIDESSVPADAKLAIYYRKTLVQCAKHCDRL-EQFFCKSFIYYRTGEQRFQSKCFLLGSRIT-DPASKADPSIEAKYYEIPETCNDADDFLCNNSHCVKKSQACNGFDDCGDFSDEINSRCGKDPAKNYELVLSGGSDNHEGRIEIRLFNQRGLVCDDGLNAAMADVICQQLGYPGHERFILNAWQQFGRG-TGGFILSGVHCGPGAKNITDCAHRPWGDSGACSVKNVAGLICLIDRPCSMHEVRC--DSRCFPLSKMCDGVPDCSDGWDETECD-ILNVTLSH--NRTAGVVEISRGGIQGVVCDDHFSDEEVKVVCRHLGIPGRGALAQRGQFSTPAGVVMWLQDIRCEGTEASLFDCSLRDWGESTCSIDEAVQLLCGLPE--VTDPETTQAPQTDYSEI-CGKRLAPYSFYRIGGGRNSGITEVPWQVAIRKKVIRPAGLRKDIKLPSSSAWCGGTILSDRWILSAAHCFPYANMPKSAFVVRAGDWNNTAPDQYEREFDVDLLIQHERYTGPPAYDFDISLLRIKPDSRGYLEFNAGVQPACLPRQNQPMNYDPTSKCLISGWGSRGGFDYPEALQMAEVPLIRREVCDRMYEFENITERMFCAGYKEGGIDACQGDSGGPLVCKIVDPGPPAEAGGAAAKGGPLRSGEARHTVVGITSFGNGCAEPNSPGVYTHVPYFRNWI 1267          
BLAST of Neurotrypsin vs. TrEMBL
Match: A0A267FDY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019787g1 PE=3 SV=1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 465/1162 (40.02%), Postives = 663/1162 (57.06%), Query Frame = 1
Query:  337 GAPESPQIIRLRGE-NALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTG--NEKSLVDCPHDSTSYCS-GKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSE------LPPPTATLKPQVTDPMGFGQGGCQSI-QYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDE--KNCTVL-----DESALLKVYDKTD----SKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLT-KLASEEPYKLIAITYPGAHYSMKSDCTAEQ-FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVT--FPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRS-HNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIV-LDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPT----AKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDS-HWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXX-XXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLST-YPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            G P SPQ  RLRGE + +  NEGRVEV    +  WGL C DY+   +ANV CR LGF++ A +   +  +G G++   D  +  ++C     + +L  C H+    CS   +AGV C YN GC  GW +++G CY++ +  M  + A K C+   +KL  +    EN+FI+N+LYT+++ IA  WTGG YA  + D+   +  W +  TIH V   S S LWFPGF  T++D RP G+ + QSC+A+++ F  S  +  V D NYFWWDN+SC  +LP+ICQ  +    SDCY  +G +YRG  +RT +G+ C  W++    VN  T+P  GLG+HN CRNPD D +PWCW +    V+GYC++  C E      LP     LKP       +    C S  QY CPSMI+Y   C+ + +VCD    C+G EDE+   CK   C   +F+C     CI  + VCD + +C  G DE  + C +       ++ + K Y KT+    S I   +  + Y  + + +C  +C  +  +F C +F Y   H +     C LL  K+A   P   +  +    +Y  K  C  +Q F+C    C++ +  C+  D+CGD SDE+  ++     P F +RL+G    YEG+VEV+   EWG +CDDG +    +VVC QLGF    E +     +         L+  + C GTE SL +C HS W++  NC  + +AG+VC  DRACT+ EFRCS    CI LS+VCD T  C+DG+DE   G  T+ +   DGP   SG +E++R G+ G VCDD + D +A V+C  L IPGR +   +  F    G ++ L ++KC+G E +L +C    WG   C  +E + + CGLP+   T    PT    A+V  +A   CG R      GR++ G+ A+ G FPWQVG+R KV + D+   CG +I+++ WI+ AAHC+  PKS Y +R GD DN   +++E+ F+I+ + +HP ++   +YDYD  LI+I+ +    I+FN  VQP CLP+  +     + C +SGWG       P  L+AA VPLI + RC + Y GR+T+RMQCAG+EAGGID+CQGDSGGPLVC ++GVYT+ GATSWG GCA P +PGVYA I+   DWI E
Sbjct:   96 GVPVSPQKARLRGELSHMNPNEGRVEVEYRGT--WGLACGDYFGREEANVYCRNLGFKKGANKPYGRSFFGTGNFKRWDILIGHVKCAAYRGQSNLFQCSHNLMPACSLNNTAGVECTYNEGCEFGWSAYDGLCYRVESGPMTAEDAAKACKAKGAKLVAVNSQGENSFITNMLYTKFQDIAAAWTGGQYARFR-DQLEYD-AWTFKDTIHLVK--SDSKLWFPGF--TESDARPIGNKEKQSCIAISKIFYKSSERRDV-DTNYFWWDNISCKTELPYICQ-KLGTLTSDCYSQSGGNYRGEAARTDKGTPCQPWSE-NRLVNSMTHPGQGLGEHNLCRNPDGDTKPWCWVDNERNVFGYCSLRLCGEGEGGDGLP---TDLKPS------YNHSRCDSPDQYFCPSMINYRPTCVDRRQVCDSHKDCVGGEDEERELCKA-RCNSEQFYCRKSHRCIAISKVCDKQYDCDMGDDETPEACRLHKPEEESDAEVQKDYTKTEKVDESSIPSGTQSVSYYSLSLTQCKTRCDTM-DRFVCAAFIY--NHNATFGIRCTLLAQKIADVRPNDAVGES---VYYEKKQSCNPDQKFQCKNTRCVDKAALCNGYDDCGDFSDEVGPSSCPDPKPTFSVRLSGGRGNYEGRVEVKLFNEWGLMCDDGLNENLGKVVCNQLGFPMGYEKLSKNAKKEYGRGDGKFLMGAVACRGTEASLYDCPHSGWKNIVNCTINNVAGIVCLWDRACTDKEFRCSG--RCIPLSQVCDGTQQCTDGADEESCGTPTLALRNGDGP--SSGFLEITRNGIAGAVCDDMFGDNEAKVVCAQLGIPGRFRLEPEGTFKTPGGTVMWLQDVKCSGSESSLFSCAIRNWGRSLCEIREAVNLRCGLPEPTRTTTQPPTTTTPARVTSSAK-TCGQRIGRFPAGRIINGYPAIRGQFPWQVGIRLKVSETDTRQHCGGTIINDRWIVTAAHCFDYPKSYYAIRVGDLDNMVTEEFERQFDIDLVFIHPQYSGQPSYDYDITLIRIQPDSKGYIEFNAAVQPACLPEKTLQTTRKTVCHISGWGSVGDMQLPRNLMAANVPLIANARCNQLYPGRITDRMQCAGFEAGGIDSCQGDSGGPLVCPIDGVYTLLGATSWGEGCAMPGSPGVYANIRNLRDWIDE 1225          
BLAST of Neurotrypsin vs. TrEMBL
Match: A0A267FXX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004114g1 PE=3 SV=1)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 466/1164 (40.03%), Postives = 668/1164 (57.39%), Query Frame = 1
Query:  337 GAPESPQIIRLRGE-NALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTG--NEKSLVDCPHDSTSYCS-GKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEF-RWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSE------LPPPTATLKPQVTDPMGFGQGGCQSI-QYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDE--KNCTVL-----DESALLKVYDKTD----SKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLT-KLASEEPYKLIAITYPGAHYSMKSDCTAEQ-FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVT--FPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGF-LGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRS-HNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIV-LDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPT----AKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDS-HWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXX-XXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLST-YPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            G P SPQ  RLRGE + +  NEGRVEV    +  WGL C DY+   +ANV CR LGF++ A +   +  +G G++   D  +  ++C     + +L  C H+    CS   +AGV C YN GC  GW +++G CY++ +  M  + A K C+   +KL  +    EN+FI+N+LYT+++ IA  WTGG YA  +    + E+  W +  TIH V   S S LWFPGF  T++D RP G+ + QSC+A+++ F  S  +  V D NYFWWDN+SC  +LP+ICQ  +    SDCY  +G +YRG  +RT +G+ C  W++    VN  T+P  GLG+HN CRNPD D +PWCW +    V+GYC++  C E      LP     LKP       +    C S  QY CPSMI+Y   C+ + +VCD    C+G EDE+   CK   C   +F+C     CI  + VCD + +C  G DE  + C +       ++ + K Y KT+    S I   +  + Y  + + +C  +C  +  +F C +F Y   H +     C LL  K+A   P   +  +    +Y  K  C  +Q F+C    C++ +  C+  D+CGD SDE+  ++     P F +RL+G    YEG+VEV+   EWG +CDDG +    +VVC QLGF +G  +   +A   +G+      L+  + C GTE SL +C HS W++  NC  + +AG+VC  DRACT+ EFRCS    CI L++VCD T  C+DG+DE   G  T+ +   DGP   SG +E++R G+ G VCDD + D +A V+C  L IPGR +   +  F    G ++ L ++KC+G E +L +C    WG   C  +E + + CGLP+   T    PT    A+V  +A   CG R      GR++ G+ A+ G FPWQVG+R KV + D+   CG +I+++ WI+ AAHC+  PKS Y +R GD DN   +++E+ F+I+ + +HP ++   +YDYD  LI+I+ +    I+FN  VQP CLP+  +     + C +SGWG       P  L+AA VPLI + RC + Y GR+T+RMQCAG+EAGGID+CQGDSGGPLVC ++GVYT+ GATSWG GCA P +PGVYA I+   DWI E
Sbjct:   96 GVPVSPQKARLRGELSHMNPNEGRVEVEYRGT--WGLACGDYFGREEANVYCRNLGFKKGANKPYGRSFFGTGNFKRWDILIGHVKCAAYRGQSNLFQCSHNLMPACSLNNTAGVECTYNEGCEFGWSAYDGLCYRVESGPMTAEDAAKACKAKGAKLVAVNSQGENSFITNMLYTKFQDIAAAWTGGQYARFR---DQLEYDAWTFKDTIHLVK--SDSKLWFPGF--TESDARPIGNKEKQSCIAISKIFYKSSERRDV-DTNYFWWDNISCKTELPYICQ-KLGTLTSDCYSQSGGNYRGEAARTDKGTPCQPWSE-NRLVNSMTHPGQGLGEHNLCRNPDGDTKPWCWVDNERNVFGYCSLRLCGEGEGGDGLP---TDLKPS------YNHSRCDSPDQYFCPSMINYRPTCVDRRQVCDSHKDCVGGEDEERELCKA-RCNSEQFYCRKSHRCIAISKVCDKQYDCDMGDDETPEACRLHKPEEESDAEVQKDYTKTEKVDESSIPSGTQSVSYYSLSLTQCKTRCDTM-DRFVCAAFIY--NHNATFGIRCTLLAQKIADVRPNDAVGES---VYYEKKQSCNPDQKFQCKNTRCVDKAALCNGYDDCGDFSDEVGPSSCPDPKPTFSVRLSGGRGNYEGRVEVKLFNEWGLMCDDGLNENLGKVVCNQLGFPMGYEKLTKNAKKEYGRGDG-KFLMGAVACRGTEASLYDCPHSGWKNIVNCTINNVAGIVCLWDRACTDKEFRCSG--RCIPLNQVCDGTQQCTDGADEESCGTPTLALRNGDGP--SSGFLEITRNGIAGAVCDDMFGDNEAKVVCAQLGIPGRFRLEPEGTFKTPGGTVMWLQDVKCSGSESSLFSCAIRNWGRSLCEIREAVNLRCGLPEPTRTTTQPPTTTTPARVTSSAK-TCGQRIGRFPAGRIINGYPAIRGQFPWQVGIRLKVSETDTRQHCGGTIINDRWIVTAAHCFDYPKSYYAIRVGDLDNMVTEEFERQFDIDLVFIHPQYSGQPSYDYDITLIRIQPDSKGYIEFNAAVQPACLPEKTLQTTRKTVCHISGWGSVGDMQLPRNLMAANVPLIANARCNQLYPGRITDRMQCAGFEAGGIDSCQGDSGGPLVCPIDGVYTLLGATSWGEGCAMPGSPGVYANIRNLRDWIDE 1225          
BLAST of Neurotrypsin vs. TrEMBL
Match: A0A1I8IHJ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 460/1163 (39.55%), Postives = 656/1163 (56.41%), Query Frame = 1
Query:  337 GAPESPQIIRLRGE-NALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTG--NEKSLVDCPHDSTSYCS-GKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEF-RWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSE------LPPPTATLKPQVTDPMGFGQGGCQSI-QYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDE--KNCTVL-----DESALLKVYDKTD----SKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLT-KLASEEPYKLIAITYPGAHYSMKSDCTAEQ-FKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVT--FPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRS-HNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPE-GKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIV-LDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPT----AKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDS-HWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXX-XXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLST-YPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            G P SPQ  RLRGE + +  NEGRVEV    +  WGL C DY+   +ANV CR LGF++ A +   +  +G G++   D  +  ++C     + +L  C H+    CS   +AGV C YN GC  GW +++G CY++ +  M  + A K C+   +KL  +    EN+FI+N+LYT+++ IA  WTGG YA  +    + E+  W +  TIH V   S S LWFPGF  T++D RP G+ + QSC+A+++ F  S  +  V D NYFWWDN+SC  +LP+ICQ  +    SDCY  +G +YRG  +RT +G+ C  W++    VN  T+P  GLG+HN CRNPD D +PWCW +    V+GYC++  C E      LP     LKP       +    C S  QY CPSMI+Y   C+ + +VCD    C+G EDE+                     CI  + VCD + +C  G DE  + C +       ++ + K Y KT+    S I   +  + Y  + + +C  +C  +  +F C +F Y   H +     C LL  K+A   P   +  +    +Y  K  C  +Q F+C    C++ +  C+  D+CGD SDE+  ++     P F +RL+G    YEG+VEV+   EWG +CDDG +    +VVC QLGF    E +     +         L+  + C GTE SL +C HS W++  NC  + +AG+VC  DRACT+ EFRCS    CI LS+VCD T  C+DG+DE   G  T+ +   DGP   SG +E++R G+ G VCDD + D +A V+C  L IPGR +   +  F    G ++ L ++KC+G E +L +C    WG   C  +E + + CGLP+   T    PT    A+V  +A   CG R      GR++ G+ A+ G FPWQVG+R KV + D+   CG +I+++ WI+ AAHC+  PKS Y +R GD DN   +++E+ F+I+ + +HP ++   +YDYD  LI+I+ +    I+FN  VQP CLP+  +     + C +SGWG       P  L+AA VPLI + RC + Y GR+T+RMQCAG+EAGGID+CQGDSGGPLVC ++GVYT+ GATSWG GCA P +PGVYA I+   DWI E
Sbjct:   96 GVPVSPQKARLRGELSHMNPNEGRVEVEYRGT--WGLACGDYFGREEANVYCRNLGFKKGANKPYGRSFFGTGNFKRWDILIGHVKCAAYRGQSNLFQCSHNLMPACSLNNTAGVECTYNEGCEFGWSAYDGLCYRVESGPMTAEDAAKACKAKGAKLVAVNSQGENSFITNMLYTKFQDIAAAWTGGQYARFR---DQLEYDAWTFKDTIHLVK--SDSKLWFPGF--TESDARPIGNKEKQSCIAISKIFYKSSERRDV-DTNYFWWDNISCKTELPYICQ-KLGTLTSDCYSQSGGNYRGEAARTDKGTPCQPWSE-NRLVNSMTHPGQGLGEHNLCRNPDGDTKPWCWVDNERNVFGYCSLRLCGEGEGGDGLP---TDLKPS------YNHSRCDSPDQYFCPSMINYRPTCVDRRQVCDSHKDCVGGEDEER------------------ELCIAISKVCDKQYDCDMGDDETPEACRLHKPEEESDAEVQKDYTKTEKVDESSIPSGTQSVSYYSLSLTQCKTRCDTM-DRFVCAAFIY--NHNATFGIRCTLLAQKIADVRPNDAVGES---VYYEKKQSCNPDQKFQCKNTRCVDKAALCNGYDDCGDFSDEVGPSSCPDPKPTFSVRLSGGRGNYEGRVEVKLFNEWGLMCDDGLNENLGKVVCNQLGFPMGYEKLSKNAKKEYGRGDGKFLMGAVACRGTEASLYDCPHSGWKNIVNCTINNVAGIVCLWDRACTDKEFRCSG--RCIPLSQVCDGTQQCTDGADEESCGTPTLALRNGDGP--SSGFLEITRNGIAGAVCDDMFGDNEAKVVCAQLGIPGRFRLEPEGTFKTPGGTVMWLQDVKCSGSESSLFSCAIRNWGRSLCEIREAVNLRCGLPEPTRTTTQPPTTTTPARVTSSA-KTCGQRIGRFPAGRIINGYPAIRGQFPWQVGIRLKVSETDTRQHCGGTIINDRWIVTAAHCFDYPKSYYAIRVGDLDNMVTEEFERQFDIDLVFIHPQYSGQPSYDYDITLIRIQPDSKGYIEFNAAVQPACLPEKTLQTTRKTVCHISGWGSVGDMQLPRNLMAANVPLIANARCNQLYPGRITDRMQCAGFEAGGIDSCQGDSGGPLVCPIDGVYTLLGATSWGEGCAMPGSPGVYANIRNLRDWIDE 1208          
BLAST of Neurotrypsin vs. TrEMBL
Match: A0A267FEP6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020209g1 PE=3 SV=1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 456/1184 (38.51%), Postives = 649/1184 (54.81%), Query Frame = 1
Query:  229 RQAVSEDETT--------FFDQNIPPLTGTGRSNTRFP----MRKVRDGAPESPQIIRLRGE-NALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCT--GNEKSLVDCPHDSTSYCS-GKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCS-ELPPPTATLKPQVTDPM--GFGQGGCQSIQ-YHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKI---LDVSDKLDYIDIPID------------KCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCT-AEQFKCTRGMCIELSKKCDHRDNCGDNSDEID--CTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPW-RSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIV-LDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVD-----------DYDSHWCGASILSEDWIIGAAHCYA---RPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXX-XXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLG--MVPDPNSKCLVSGWGDTLS-TYPEKLLAAEVPLIKHERCFEFYK-GRLTERMQCAGYEAGGIDTCQGDSGGPLVCKV 3603
            R A S  ETT        F D N  P  G  R++         R    G P +PQI+R+RG+   +  NEGRVEV  +   +WGLVC DY   ++A + C QLGF   A    +   YG G +   D  V  +QC   G+E +L DC       C    + G+ C+YN GC  GW SF+G CY++ T+     +A   CQ   +KL  +   +E N+I+N+LYT+++S+  +WTGG +   + D G     W +  TIH   Q     LWFPGF E  TD+RP GDP+ +SC+A+++ F + + +  V DVNYFWWDN+SC  +LPF+CQ  +  + +DCYE  G +YRG  +RT +G+ C  W D    +NP T P AGL  H  CRNPD D +PWCW +  N V+GYC++ +CS ELP      +PQ   PM  GFG   C   + + CPSM+SY   C+ + +VCD    C+GKEDED  FC+ Y C  + F+C     CI    VCDG  +C  G DE       E A + V  + ++++     ++  +D   +P D            +CA+ C  L  QF CKSF Y    E R  S+C LL    + +P      +    +Y +   C  A+ F C    C++ S+ C+  D+CGD SDEI+  C       +E+ L+G  + +EG++E+R   + G VCDDG +   A+V+C+QLG+ G    I +A  +FG+  +   ++  + C     ++ +C H PW  S  C    +AG++C +DR C+  E RC  D  C  LSK+CD   DCSDG DE E    + VTL+   +  +G VE+SRGG++G VCDD + D++  V+CR L IPGR    +  +F   AG ++ L +++C G E +L +C    WGE  C+  E + ++CGLP+  VT P    A     + + CG R   +   R+ GG  +     PWQV +R+KV               S WCG +ILS+ WI+ AAHC+     PKS + VR GDW+N + D+YE+ F+++ LI H  +     YD+D +L++I+ +    ++FN  VQP CLP+    M  DP SKCL+SGWG      YPE L  AEVPLI+ E C   Y+   +TERM CAGY+ GGID CQGDSGGPLVCK+
Sbjct:   64 RHARSRRETTSPFIPLRLFGDSNPEPQPGYPRTSPDSEPDELSRHRTGGVPPTPQIVRIRGDLMKMNPNEGRVEV--NYHGVWGLVCGDYVQQIEATLVCHQLGFELGANRVYKNSYYGTGHYKRQDIIVGHVQCKHDGDELTLFDCKRKLMPPCDLNSTTGIECIYNTGCDWGWSSFDGLCYRLETEPKTAAEAAAACQAKGAKLVSVNSLEEGNYITNMLYTKFRSLNAVWTGGQFGSFR-DVGSQYTSWTFVDTIHMARQ----PLWFPGF-EPGTDQRPAGDPQQRSCIAMSKLFQNPRSRRDV-DVNYFWWDNISCKTRLPFVCQ-KLAVASADCYEGIGTEYRGLAARTDKGTPCQPWGD-NQLINPSTYPNAGLSGHGLCRNPDGDAKPWCWVDNKNNVFGYCSLRQCSDELP------QPQEGPPMTPGFGHEKCDRHEDFFCPSMLSYRPVCVVERQVCDGFVDCVGKEDEDEAFCRNYTCTSDHFYCRKFHKCISMDQVCDGLADCDLGDDET------EEACMSVKAQAEAELANEFQMTAGIDESSVPADAKLAIYYRKTLVQCAKHCDRL-EQFFCKSFIYYRTGEQRFQSKCFLLGSRIT-DPASKADPSIEAKYYEIPETCNDADDFLCNNSHCVKKSQACNGFDDCGDFSDEINSRCGKDPAKNYELVLSGGSDNHEGRIEIRLFNQRGLVCDDGLNAAMADVICQQLGYPGHERFILNAWQQFGRG-TGGFILSGVHCGPGAKNITDCAHRPWGDSGACSVKNVAGLICLIDRPCSMHEVRC--DSRCFPLSKMCDGVPDCSDGWDETECD-ILNVTLSH--NRTAGVVEISRGGIQGVVCDDHFSDEEVKVVCRHLGIPGRGALAQRGQFSTPAGVVMWLQDIRCEGTEASLFDCSLRDWGESTCSIDEAVQLLCGLPE--VTDPETTQAPQTDYSEI-CGKRLAPYSFYRIGGGRNSGITEVPWQVAIRKKVIRPAGLRKDIKLPSSSAWCGGTILSDRWILSAAHCFPYANMPKSAFVVRAGDWNNTAPDQYEREFDVDLLIQHERYTGPPAYDFDISLLRIKPDSRGYLEFNAGVQPACLPRQNQPMNYDPTSKCLISGWGSRGGFDYPEALQMAEVPLIRREVCDRMYEFENITERMFCAGYKEGGIDACQGDSGGPLVCKI 1213          
BLAST of Neurotrypsin vs. Ensembl Cavefish
Match: prss12 (serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-45])

HSP 1 Score: 305.064 bits (780), Expect = 5.124e-87
Identity = 195/559 (34.88%), Postives = 292/559 (52.24%), Query Frame = 1
Query: 2086 CDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVG------IKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAG--YEAGGIDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            CDH ++ G     + CT +T     +RL G    +EG++EV Y+G+WG VC+DG+     +VVC+QLG+         + + FG +  P +L+D++ CTG E SL  C  S W  H+C       V C   R                              G   P    ++ V L  G + + GRVE+S GG  GTVCDD + D+DA V+CR L   G A+A     FGEG G I +DN+KCTG E +L +C    +G H C H ED GVIC    +         A V  A    CG +P   ++ R++GG  ++ G +PWQ  VR +    D    CGA++++  W++ +AHC+ R  +    Y+VR GD+     ++ E+ + ++ +I+HP+++  + DYD AL+ + R+ G        ++ +  V PVCLP +   VP  ++ C ++GWGDT   Y + L  AEV ++   +C   Y G  T RM CAG   +   +D+C+GDSGGPLVC +  G + ++G TSWG+ C     PGVY K+   L WI++ T
Sbjct:  303 CDHTEDAG-----VSCTPLT--DGSLRLVGGAAGFEGRLEVHYRGQWGTVCNDGWSTTNTQVVCRQLGY-------SVSPDMFGASSGP-ILLDDVICTGKEPSLTHCSRSDWLRHDCPHSNNVAVACSPQRT-----------------------------GHGVPT---SLPVRLVGGENEREGRVEISVGGQWGTVCDDGWTDQDAEVVCRQLGFSGLAKARVMAYFGEGEGPIHVDNVKCTGGERSLADCIKQPFGTHNCRHSEDAGVICNYGQQ------DNLAGVKDAVSSVCGLKPTHTRQKRIIGGENSLRGGWPWQAAVRLRGSQADGRLVCGATLINSCWVLTSAHCFKRYGNSTRMYKVRVGDYHTLVPEENEEEYGVDRIIIHPHYSAQSNDYDLALVHLIRHGGPEGRGGDCVRQSRSVLPVCLPGRRERVPKGSANCFITGWGDTGRAYSKTLQQAEVRVLSKRQCERRYAGHFTSRMLCAGAALDDRRVDSCRGDSGGPLVCERGGGGWVLYGITSWGHSCRLQDAPGVYTKVSAFLPWIRKIT 808          

HSP 2 Score: 135.191 bits (339), Expect = 2.386e-31
Identity = 90/265 (33.96%), Postives = 124/265 (46.79%), Query Frame = 1
Query: 2113 NSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            N      T+  F P  +RL+G  + YEG+VEV + G+WG VCDD +D   AEVVC+QLG  G   +   A    G  R   +L+DE+ CTG E S+E+C  SPW  HNC   E AGV C                                +DGS          + L  G     GR+E+   G  GTVC+D +   +  V+CR L       ++    FG  +G I+LD++ CTG+E +L +C    W  H C H  ++ V C
Sbjct:  200 NRQAAAVTSAVFIP--VRLSGGQSVYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGTARAWARAYFGSGVGR---VLLDEVSCTGNELSIEQCSKSPWGEHNCDHTEDAGVSC-----------------------------TPLTDGS----------LRLVGGAAGFEGRLEVHYRGQWGTVCNDGWSTTNTQVVCRQL-----GYSVSPDMFGASSGPILLDDVICTGKEPSLTHCSRSDWLRHDCPHSNNVAVAC 415          

HSP 3 Score: 120.939 bits (302), Expect = 5.917e-27
Identity = 89/252 (35.32%), Postives = 116/252 (46.03%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLG-FLGAMESIHSAVNRFGKNRSPNLLVD--EIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +RL G  +K +G VEV   G WG +C + +D K A VVC+QLG    A   + S V      R P  +V    + C+G E  L +C HS W    C   + A V        T++ F                                 + V L+ G     GRVE+   G  GTVCDD +DD DA V+CR L + G A+A     FG G G ++LD + CTG EL++E C    WGEH C H ED GV C
Sbjct:  109 VRLQGGRSKLDGTVEVYLNGVWGTICSNDWDDKDATVVCRQLGQGYKARARVSSLV------RMPLSVVHWRTVGCSGEEGDLLQCPHSVWNGGECANRQAAAV--------TSAVF---------------------------------IPVRLSGGQSVYEGRVEVYHAGQWGTVCDDQWDDNDAEVVCRQLGLGGTARAWARAYFGSGVGRVLLDEVSCTGNELSIEQCSKSPWGEHNCDHTEDAGVSC 313          

HSP 4 Score: 64.6994 bits (156), Expect = 1.291e-9
Identity = 47/124 (37.90%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  322 RKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCVYN 684
            ++   G P S  +  + GEN     EGRVE+  S    WG VCDD W   DA V CRQLGF   A+ A     +G G+  ++   V  ++CTG E+SL DC   P  + +    + AGV C Y 
Sbjct:  418 QRTGHGVPTSLPVRLVGGENE---REGRVEI--SVGGQWGTVCDDGWTDQDAEVVCRQLGFSGLAK-ARVMAYFGEGEGPIH---VDNVKCTGGERSLADCIKQPFGTHNCRHSEDAGVICNYG 532          

HSP 5 Score: 61.6178 bits (148), Expect = 1.048e-8
Identity = 45/116 (38.79%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDC---PHDSTSYCSGKSAGVSCV 678
            A  S   I +R     +  EGRVEVY +    WG VCDD W+  DA V CRQLG    AR   R   +G G   V    + ++ CTGNE S+  C   P    +    + AGVSC 
Sbjct:  205 AVTSAVFIPVRLSGGQSVYEGRVEVYHAGQ--WGTVCDDQWDDNDAEVVCRQLGLGGTARAWARA-YFGSG---VGRVLLDEVSCTGNELSIEQCSKSPWGEHNCDHTEDAGVSCT 314          

HSP 6 Score: 56.6102 bits (135), Expect = 3.217e-7
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 1
Query: 1192 SDCYEDNGL--DYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGV--YGYC 1410
            ++C +  G    YRG I+ T  G+SC  WT+ +        P  GLG HN CRNPD  ++PWC+     G   +GYC
Sbjct:   28 AECAQSRGRAGQYRGSIAVTESGASCMNWTEVSGV--SSRYPGKGLGHHNHCRNPDRRIRPWCFFRTGRGRIDWGYC 102          
BLAST of Neurotrypsin vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 291.582 bits (745), Expect = 2.166e-82
Identity = 197/567 (34.74%), Postives = 294/567 (51.85%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRG-RVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP----KLGMVPDPNSKCLVSGWGDTLSTY-PEKLLAAEVPLIKHERCFEFYKGRLTER-MQCAGYEAGG----IDTCQGDSGGPLVCKVN-GVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS  +C H      N D ++   V+  P+    +RL    N +EG++EV + G+WG VCDD +  + A+VVC+QLGF G  E   +    FG+  +  +L+D+++C G+E+SL ECKHS W  H+C   E  G+ C         E    KD                              + L  G   K GRVE+   G  G+VCD  ++D +AAV+CR L   G ++A     FG G G I L N++CTG+E +L  CP      H C H +D GV+C   D V    P+P   +       CG R    +R  R+VGG++++ G +PWQ  +  K     S   CGA++++  W++ AAHC+ R  S Y V+ GD+     D +E+V  +E + +H  ++N ++++D ALI+++  +G  + FN +    CLP    K G  P   + C+++GWG +   Y P  LL A VPL+   +C + Y  R T   M CAG  +       D+CQGDSGGPLVC+   G + + G  SWG+GC  P  PGVY+++   L WI++ T
Sbjct:  282 ELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFRGGAEL--APAGMFGEG-AGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIRCHRGGEGLREEGGEKKD------------------------------MELVSGESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVC---DYV----PEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRDASRYVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRP---ASCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADSCQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQVT 805          

HSP 2 Score: 153.295 bits (386), Expect = 4.569e-37
Identity = 98/255 (38.43%), Postives = 131/255 (51.37%), Query Frame = 1
Query: 2143 TFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            T PP  +RL G    +EG+VEV + G WG +CDD +D   AEVVC+QLG  G  ++   A   FG+   P + +D ++CTG E SL+EC HS W  HNC   E AGV C                             N  +DG           V L DG +   GR+E+   G  GTVCDD++ ++ A V+CR L   G A+      FGEGAG I+LD+++C G E +L  C    WG H C+H ED+G+ C
Sbjct:  205 TGPP--LRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWA--HFGQGSGP-IQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC-----------------------------NPYTDGV----------VRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFRGGAELAPAGMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIRC 415          

HSP 3 Score: 115.546 bits (288), Expect = 2.974e-25
Identity = 83/250 (33.20%), Postives = 117/250 (46.80%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGF-LGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +RL G  +   G++EV   G+WG VCD  +  + A VVC+QLG   G   +++   + FG   S       + C G E SL EC+   + + +C     AG+VC                                      PEG     + L  G +   GRVE+   G  G++CDD +DD DA V+CR L + G  +A     FG+G+G I LD ++CTG EL+L+ CP   W +H C H ED GV C
Sbjct:   97 VRLVGGSSSKSGRLEVYLNGQWGSVCDTHWTDRDASVVCRQLGLGYGIPYTLNKQHSYFGPG-SGLFHYARLGCRGNERSLLECRSRKFVTSDCSHGSEAGLVCS------------------------------------PPEGT-GPPLRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC 308          

HSP 4 Score: 62.7734 bits (151), Expect = 4.894e-9
Identity = 35/78 (44.87%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            EGRVEVY      WG +CDD W+ +DA V CRQLG     + A     +G+G   +    +  +QCTGNE SL +CPH
Sbjct:  219 EGRVEVYHDGR--WGSICDDQWDDMDAEVVCRQLGLGGIPK-AWSWAHFGQGSGPIQ---LDAVQCTGNELSLDECPH 290          

HSP 5 Score: 62.003 bits (149), Expect = 7.168e-9
Identity = 33/85 (38.82%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 1153 LPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            +PF+   ++P S S+ + + G  Y G +S+T  GS C KWT+    V  Q  P  GLG+H++CRNPD +  PWC+   ++G  G+
Sbjct:    7 VPFLL-FSVPLSCSEGFTELGY-YNGTVSQTDSGSPCLKWTEFPDYV--QQYPGRGLGEHSYCRNPDRESNPWCFFRQSSGAIGW 87          

HSP 6 Score: 61.2326 bits (147), Expect = 1.254e-8
Identity = 40/97 (41.24%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  343 PESPQIIRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL  G+N     EGR+EVY S    WG VCDD W    A V CRQLGFR  A E      +G G        +  +QC G+E SL++C H
Sbjct:  310 PYTDGVVRLVDGDNPW---EGRLEVYHSGD--WGTVCDDNWTEQHAQVVCRQLGFRGGA-ELAPAGMFGEG---AGLILLDDVQCEGSESSLLECKH 397          

HSP 7 Score: 59.6918 bits (143), Expect = 3.971e-8
Identity = 40/101 (39.60%), Postives = 55/101 (54.46%), Query Frame = 1
Query:  388 TANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP---HDSTSYCSGKSAGVSCVY 681
            +  EGRVEV+ +    WG VCD  WN ++A V CRQLGF   ++ A     +G G   ++   +  ++CTG E SL +CP    DS     G+ AGV C Y
Sbjct:  439 SRKEGRVEVFLNGE--WGSVCDSGWNDVNAAVVCRQLGFTGVSK-ARPMGYFGAGKGPIH---LANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDY 533          

HSP 8 Score: 56.225 bits (134), Expect = 4.443e-7
Identity = 40/114 (35.09%), Postives = 59/114 (51.75%), Query Frame = 1
Query: 2608 VTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKR---FGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPP 2940
            V L  G  +KSGR+E+   G  G+VCD  + D+DA+V+CR L +        +K+   FG G+G      L C G E +L  C   K+    C+H  + G++C  P+   T PP
Sbjct:   97 VRLVGGSSSKSGRLEVYLNGQWGSVCDTHWTDRDASVVCRQLGLGYGIPYTLNKQHSYFGPGSGLFHYARLGCRGNERSLLECRSRKFVTSDCSHGSEAGLVCSPPEG--TGPP 208          
BLAST of Neurotrypsin vs. Ensembl Cavefish
Match: si:ch211-51a6.2 (neurotrypsin-like [Source:NCBI gene;Acc:103031031])

HSP 1 Score: 290.426 bits (742), Expect = 7.467e-82
Identity = 201/564 (35.64%), Postives = 299/564 (53.01%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFE-AVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGM--VPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGG--IDTCQGDSGGPLVCK-VNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS ++C H      N D ++   V+  P+    +RL G+   +EG++E+ + GEWG VCDD +    A+VVC+QLG+      +  A +   +  +  +L+DE+KC G E SL EC+H+ W  H+C   E  G+ C  +RA                      +TND    +  P     V+  L  G   K GRVE+   GL G+VCDD ++D +A V+CR L   G ++A     FGEG G I LDN++C G E +L  CP      H C H ED GVIC    + V+QP   ++     A   CG RP   +R R + G + ++ G +PWQV +  +      H  CGA++++  W++ AAHC+ R  +D   Y +R GD+     D +E+    E + LH  +++  ++ D AL++++  DG  + FN +    CLP      V  P + C+++GWG T S Y   LL A +PL+   +C + Y  R T RM CAG  +    +D+CQGDSGGPLVC+  NG +T+ G  SWG+GC  P  PGVY ++   L WI++ T
Sbjct:  306 ELSLEECPHMPWGQHNCDHMEDAGVSCNPYTDGVLRLVGADGPWEGRLEIYHSGEWGTVCDDNWTEHHAQVVCRQLGYSRGRAEV--APDGAYEEGTGMILLDEVKCRGDERSLLECEHAVWGRHDCSHSEDVGIRC--ERAV---------------------ETNDVP--AVPPVAGPLVR--LVAGESRKEGRVEVFINGLWGSVCDDGWNDINAGVVCRQLGFVGMSKARSMAYFGEGQGPIHLDNVRCVGTESSLGECPADGPNTHDCRHSEDAGVIC----DYVSQPADDSS----MAMQSCGLRPNTQRRRRRIIGGDKSLRGDWPWQVSLWLRAQSKRIHPLCGATLINSCWVVTAAHCFKRFGTDPSRYILRLGDYHTEERDDFERTLSPERIELHRKYHSQGWENDIALVRLKGTDGNCVSFNPHTNAACLPNQSAKKVKRP-AACVITGWGVTDSEYSRTLLQAWLPLLPSGKCKKRYGSRFTSRMLCAGSLSNHRRVDSCQGDSGGPLVCQGTNGRWTLTGVISWGHGCGDPSYPGVYTRVSRFLKWIEKVT 831          

HSP 2 Score: 159.458 bits (402), Expect = 6.139e-39
Identity = 113/327 (34.56%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 2074 LSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIP-GRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAF 3051
            +S  C+H +  G     + C         +RL G + ++EG+VEV + G+WG +CDD +D   AEVVC+QLG  G  ++     + FGK   P +L+D ++CTG E SLEEC H PW  HNC   E AGV C                             N  +DG         +++  ADGP    GR+E+   G  GTVCDD++ +  A V+CR L    GRA+   D  + EG G I+LD +KC G+E +L  C    WG H C+H ED+G+ C    E    P  P     P   L  G      K GRV      ++G+ 
Sbjct:  209 VSGDCNHGNEAG-----VVCAAPEGNGTPLRLVGGLEEFEGRVEVYHNGKWGTICDDHWDDIDAEVVCRQLGLGGVPKAW--TWSHFGKGSGP-ILLDGVQCTGNELSLEECPHMPWGQHNCDHMEDAGVSC-----------------------------NPYTDG--------VLRLVGADGP--WEGRLEIYHSGEWGTVCDDNWTEHHAQVVCRQLGYSRGRAEVAPDGAYEEGTGMILLDEVKCRGDERSLLECEHAVWGRHDCSHSEDVGIRCERAVETNDVPAVPPV-AGPLVRLVAGES---RKEGRVEVFINGLWGSV 484          

HSP 3 Score: 127.487 bits (319), Expect = 5.662e-29
Identity = 91/250 (36.40%), Postives = 119/250 (47.60%), Query Frame = 1
Query: 2164 RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNR--FGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            RL G  +   G++EV   G WG VCD     + A V+C+QLG    +  I +A+    FG   S     + + C G ENSL ECK   + S +C     AGVVC                                      PEG  T  + L  G +   GRVE+   G  GT+CDD +DD DA V+CR L + G  +A     FG+G+G I+LD ++CTG EL+LE CP   WG+H C H ED GV C
Sbjct:  125 RLIGGQSNKSGRLEVYLNGRWGTVCDTHLTDRDASVICRQLG----LGEIGTALQHSYFGPG-SGLFHYERLGCRGNENSLLECKSRKFVSGDCNHGNEAGVVCAA------------------------------------PEGNGT-PLRLVGGLEEFEGRVEVYHNGKWGTICDDHWDDIDAEVVCRQLGLGGVPKAWTWSHFGKGSGPILLDGVQCTGNELSLEECPHMPWGQHNCDHMEDAGVSC 332          

HSP 4 Score: 67.3958 bits (163), Expect = 1.848e-10
Identity = 38/88 (43.18%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  367 LRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            LR    L   EGRVEVY +    WG +CDD+W+ +DA V CRQLG     +  T    +G+G   +    +  +QCTGNE SL +CPH
Sbjct:  233 LRLVGGLEEFEGRVEVYHNGK--WGTICDDHWDDIDAEVVCRQLGLGGVPKAWT-WSHFGKGSGPI---LLDGVQCTGNELSLEECPH 314          

HSP 5 Score: 63.5438 bits (153), Expect = 2.473e-9
Identity = 39/102 (38.24%), Postives = 53/102 (51.96%), Query Frame = 1
Query: 2614 LADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPD 2919
            L  G   KSGR+E+   G  GTVCD    D+DA+VICR L +     A++   FG G+G    + L C G E +L  C   K+    C H  + GV+C  P+
Sbjct:  126 LIGGQSNKSGRLEVYLNGRWGTVCDTHLTDRDASVICRQLGLGEIGTALQHSYFGPGSGLFHYERLGCRGNENSLLECKSRKFVSGDCNHGNEAGVVCAAPE 227          

HSP 6 Score: 62.7734 bits (151), Expect = 4.363e-9
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  343 PESPQIIRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYC-SGKSAGVSCVY 681
            P +  ++RL  GE   +  EGRVEV+ +   LWG VCDD WN ++A V CRQLGF   ++ A     +G G   ++   +  ++C G E SL +CP D  +T  C   + AGV C Y
Sbjct:  454 PVAGPLVRLVAGE---SRKEGRVEVFING--LWGSVCDDGWNDINAGVVCRQLGFVGMSK-ARSMAYFGEGQGPIH---LDNVRCVGTESSLGECPADGPNTHDCRHSEDAGVICDY 561          

HSP 7 Score: 62.003 bits (149), Expect = 8.521e-9
Identity = 35/96 (36.46%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  343 PESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL G +     EGR+E+Y S    WG VCDD W    A V CRQLG+ R   E      Y  G   +    + +++C G+E+SL++C H
Sbjct:  334 PYTDGVLRLVGADG--PWEGRLEIYHSGE--WGTVCDDNWTEHHAQVVCRQLGYSRGRAEVAPDGAYEEGTGMI---LLDEVKCRGDERSLLECEH 422          

HSP 8 Score: 57.7658 bits (138), Expect = 1.738e-7
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1168 QMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            Q + P S S+ + + G  Y G +S+T  G  C KWT+    +  Q  P+ GLGDH++CRNPD +  PWC+    +G  G+
Sbjct:   38 QSSGPLSCSEGFTELGY-YNGSVSQTDSGFPCLKWTEFPDYM--QQYPDRGLGDHSYCRNPDREANPWCFFRQRSGAIGW 114          
BLAST of Neurotrypsin vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 282.337 bits (721), Expect = 1.466e-79
Identity = 196/570 (34.39%), Postives = 291/570 (51.05%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRG-RVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP----KLGMVPDPNSKCLVSGWGDTLSTY-PEKLLAAEVPLIKHERCFEFYKGRLTER-MQCAGYEAGG----IDTCQGDSGGPLVCKVN-GVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS  +C H      N D ++   V+  P+    +RL    N +EG++EV + G+WG VCDD +  + A+VVC+QLGF             F    +  +L+D+++C G+E+SL ECKHS W  H+C   E                     D +C S +  C                  V V L  G   K GRVE+   G  G+VCD  ++D +AAV+CR L   G ++A     FG G G I L N++CTG+E +L  CP      H C H +D GV+C   D V    P+P   +       CG R    +R  R+VGG++++ G +PWQ  +  K     S   CGA++++  W++ AAHC+ R  SD   Y V+ GD+     D +E+V  +E + +H  ++N ++++D ALI+++  +G  + FN +    CLP    K G  P   + C+++GWG +   Y P  LL A VPL+   +C + Y  R T   M CAG  +       D+CQGDSGGPLVC+   G + + G  SWG+GC  P  PGVY+++   L WI++ T
Sbjct:  271 ELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFR----------YNFSAEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSE---------------------DVVCSSQATHC------------------VLVRLVSGESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVC---DYV----PEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRSGSDASRYVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRP---ASCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADSCQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQVT 781          

HSP 2 Score: 135.191 bits (339), Expect = 1.835e-31
Identity = 94/256 (36.72%), Postives = 126/256 (49.22%), Query Frame = 1
Query: 2128 DCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDI 2895
            DCT    PP  +RL G    +EG+VEV + G WG +CDD +D   AEVVC+QLG  G  ++   A   FG+   P + +D ++CTG E SL+EC HS W  HNC   E AGV C                             N  +DG           V L DG +   GR+E+   G  GTVCDD++ ++ A V+CR L         +     EGAG I+LD+++C G E +L  C    WG H C+H ED+
Sbjct:  192 DCTG---PP--LRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWA--HFGQGSGP-IQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC-----------------------------NPYTDGV----------VRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQL-------GFRYNFSAEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDV 393          

HSP 3 Score: 103.219 bits (256), Expect = 1.884e-21
Identity = 79/249 (31.73%), Postives = 108/249 (43.37%), Query Frame = 1
Query: 2161 IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            +RL G  +   G++EV   G+WG VCD  +  + A VVC+QLG   A++  +     FG   S       + C G E SL EC+   +                V   CT    R                                    L  G +   GRVE+   G  G++CDD +DD DA V+CR L + G  +A     FG+G+G I LD ++CTG EL+L+ CP   W +H C H ED GV C
Sbjct:  107 VRLVGGSSSKSGRLEVYLNGQWGSVCDTHWTDRDASVVCRQLGLGYALQHSY-----FGPG-SGLFHYARLGCRGNERSLLECRSRKF----------------VTSDCTGPPLR------------------------------------LVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC 297          

HSP 4 Score: 62.7734 bits (151), Expect = 4.744e-9
Identity = 43/114 (37.72%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  289 GTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            G  RS      RK        P +  + GE      EGRVEVY      WG +CDD W+ +DA V CRQLG     + A     +G+G   +    +  +QCTGNE SL +CPH
Sbjct:  175 GNERSLLECRSRKFVTSDCTGPPLRLVGGEEDF---EGRVEVYHDGR--WGSICDDQWDDMDAEVVCRQLGLGGIPK-AWSWAHFGQGSGPIQ---LDAVQCTGNELSLDECPH 279          

HSP 5 Score: 62.3882 bits (150), Expect = 6.224e-9
Identity = 33/85 (38.82%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 1153 LPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            +PF+   ++P S S+ + + G  Y G +S+T  GS C KWT+    V  Q  P  GLG+H++CRNPD +  PWC+   ++G  G+
Sbjct:   17 VPFLL-FSVPLSCSEGFTELGY-YNGTVSQTDSGSPCLKWTEFPDYV--QQYPGRGLGEHSYCRNPDRESNPWCFFRQSSGAIGW 97          

HSP 6 Score: 60.8474 bits (146), Expect = 1.923e-8
Identity = 41/117 (35.04%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP---HDSTSYCSGKSAGVSCVY 681
            + ++   + +R  +  +  EGRVEV+ +    WG VCD  WN ++A V CRQLGF   ++ A     +G G   ++   +  ++CTG E SL +CP    DS     G+ AGV C Y
Sbjct:  396 SSQATHCVLVRLVSGESRKEGRVEVFLNGE--WGSVCDSGWNDVNAAVVCRQLGFTGVSK-ARPMGYFGAGKGPIH---LANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDY 506          

HSP 7 Score: 56.225 bits (134), Expect = 4.660e-7
Identity = 39/97 (40.21%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  343 PESPQIIRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL  G+N     EGR+EVY S    WG VCDD W    A V CRQLGFR            G G   ++D     +QC G+E SL++C H
Sbjct:  299 PYTDGVVRLVDGDNPW---EGRLEVYHSGD--WGTVCDDNWTEQHAQVVCRQLGFRYNFSAE------GAGLILLDD-----VQCEGSESSLLECKH 379          

HSP 8 Score: 52.373 bits (124), Expect = 7.135e-6
Identity = 36/100 (36.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  361 IRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS--TSYCSG 654
            +RL G +  ++  GR+EVY +    WG VCD +W   DA+V CRQLG       A +   +G G      +   ++ C GNE+SL++C      TS C+G
Sbjct:  107 VRLVGGS--SSKSGRLEVYLNGQ--WGSVCDTHWTDRDASVVCRQLGLGY----ALQHSYFGPGS---GLFHYARLGCRGNERSLLECRSRKFVTSDCTG 195          
BLAST of Neurotrypsin vs. Ensembl Cavefish
Match: si:ch73-127m5.1 (si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-25])

HSP 1 Score: 278.87 bits (712), Expect = 1.012e-78
Identity = 194/567 (34.22%), Postives = 293/567 (51.68%), Query Frame = 1
Query: 2071 ELS-KKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRG-RVVGGFEAVYGAFPWQVGVRQKVDDYDSH-WCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP----KLGMVPDPNSKCLVSGWGDTLSTY-PEKLLAAEVPLIKHERCFEFYKGRLTER-MQCAGYEAGG----IDTCQGDSGGPLVCKVN-GVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQT 3720
            ELS  +C H      N D ++   V+  P+    +RL    N +EG++EV + G+WG VCDD +  + A+VVC+QLGF        SA N      +  +L+D+++C G+E+SL ECKHS W  H+C   E  G+   ++   T+  F      +   +S                            G   K GRVE+   G  G+VCD  ++D +AAV+CR L   G ++A     FG G G I L N++CTG+E +L  CP      H C H +D GV+C   D V    P+P   +       CG R    +R  R+VGG++++ G +PWQ  +  K     S   CGA++++  W++ AAHC+ R  S Y V+ GD+     D +E+V  +E + +H  ++N ++++D ALI+++  +G  + FN +    CLP    K G  P   + C+++GWG +   Y P  LL A VPL+   +C + Y  R T   M CAG  +       D+CQGDSGGPLVC+   G + + G  SWG+GC  P  PGVY+++   L WI++ T
Sbjct:  214 ELSLDECPHSGWEKHNCDHMEDAGVSCNPYTDGVVRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGF----RYNFSAGNCMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGIPTYLN--LTSGWFWVLLGVLVRLVS----------------------------GESRKEGRVEVFLNGEWGSVCDSGWNDVNAAVVCRQLGFTGVSKARPMGYFGAGKGPIHLANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVC---DYV----PEPETDIAIVGTHTCGIRGGAERRSKRIVGGYKSLRGDWPWQASLWLKSQSKGSQPLCGATLINSCWLLTAAHCFKRDASRYVVKLGDYHTEEQDDFERVLPLERVEVHRKYSNESWEHDVALIRLKGAEGKCVSFNPHTNAACLPAPGSKWGKRP---ASCVITGWGVSGKMYHPRTLLQAWVPLLPTWQCKKRYGERFTSHSMLCAGSMSSDHRHHADSCQGDSGGPLVCQGEAGRWVLTGVISWGHGCGDPSYPGVYSRVSRYLPWIEQVT 736          

HSP 2 Score: 147.132 bits (370), Expect = 2.999e-35
Identity = 98/258 (37.98%), Postives = 131/258 (50.78%), Query Frame = 1
Query: 2128 DCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGV 2901
            DC   T PP  +RL G    +EG+VEV + G WG +CDD +D   AEVVC+QLG  G  ++   A   FG+   P + +D ++CTG E SL+EC HS W  HNC   E AGV C                             N  +DG           V L DG +   GR+E+   G  GTVCDD++ ++ A V+CR L       A  +  FGEGAG I+LD+++C G E +L  C    WG H C+H ED+G+
Sbjct:  132 DCHQGTGPP--LRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWA--HFGQGSGP-IQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC-----------------------------NPYTDGV----------VRLVDGDNPWEGRLEVYHSGDWGTVCDDNWTEQHAQVVCRQLGFRYNFSA-GNCMFGEGAGLILLDDVQCEGSESSLLECKHSVWGRHDCSHSEDVGI 344          

HSP 3 Score: 82.0333 bits (201), Expect = 5.418e-15
Identity = 49/116 (42.24%), Postives = 66/116 (56.90%), Query Frame = 1
Query: 2560 DCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            DC  G+  P       + L  G +   GRVE+   G  G++CDD +DD DA V+CR L + G  +A     FG+G+G I LD ++CTG EL+L+ CP   W +H C H ED GV C
Sbjct:  132 DCHQGTGPP-------LRLVGGEEDFEGRVEVYHDGRWGSICDDQWDDMDAEVVCRQLGLGGIPKAWSWAHFGQGSGPIQLDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC 240          

HSP 4 Score: 62.7734 bits (151), Expect = 4.724e-9
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  397 EGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCS---GKSAGVSC 675
            EGRVEVY      WG +CDD W+ +DA V CRQLG     + A     +G+G   +    +  +QCTGNE SL +CPH      +    + AGVSC
Sbjct:  151 EGRVEVYHDGR--WGSICDDQWDDMDAEVVCRQLGLGGIPK-AWSWAHFGQGSGPIQ---LDAVQCTGNELSLDECPHSGWEKHNCDHMEDAGVSC 240          

HSP 5 Score: 62.003 bits (149), Expect = 8.136e-9
Identity = 33/85 (38.82%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 1153 LPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            +PF+   ++P S S+ + + G  Y G +S+T  GS C KWT+    V  Q  P  GLG+H++CRNPD +  PWC+   ++G  G+
Sbjct:   48 VPFLL-FSVPLSCSEGFTELGY-YNGTVSQTDSGSPCLKWTEFPDYV--QQYPGRGLGEHSYCRNPDRESNPWCFFRQSSGAIGW 128          

HSP 6 Score: 59.6918 bits (143), Expect = 4.296e-8
Identity = 40/101 (39.60%), Postives = 55/101 (54.46%), Query Frame = 1
Query:  388 TANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCP---HDSTSYCSGKSAGVSCVY 681
            +  EGRVEV+ +    WG VCD  WN ++A V CRQLGF   ++ A     +G G   ++   +  ++CTG E SL +CP    DS     G+ AGV C Y
Sbjct:  370 SRKEGRVEVFLNGE--WGSVCDSGWNDVNAAVVCRQLGFTGVSK-ARPMGYFGAGKGPIH---LANVRCTGKESSLGECPAKGSDSHVCKHGQDAGVVCDY 464          

HSP 7 Score: 58.9214 bits (141), Expect = 7.210e-8
Identity = 39/97 (40.21%), Postives = 50/97 (51.55%), Query Frame = 1
Query:  343 PESPQIIRL-RGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  ++RL  G+N     EGR+EVY S    WG VCDD W    A V CRQLGFR            G G   ++D     +QC G+E SL++C H
Sbjct:  242 PYTDGVVRLVDGDNPW---EGRLEVYHSGD--WGTVCDDNWTEQHAQVVCRQLGFRYNFSAGNCMFGEGAGLILLDD-----VQCEGSESSLLECKH 328          
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006128.1 (pep scaffold:Pmarinus_7.0:GL484169:9759:12797:-1 gene:ENSPMAG00000005545.1 transcript:ENSPMAT00000006128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 9.590e-41
Identity = 98/253 (38.74%), Postives = 131/253 (51.78%), Query Frame = 1
Query: 2980 CGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDY--RVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTL---STYPEKLLAAEVPLIKHERCFE-FYKGR-LTERMQCAGYEAGGIDTCQGDSGGPLVCK-VNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIK 3711
            CG +     R R+VGG  A  G +PWQ  +R    +Y SH CGAS++SE W++ AAHC+    + Y  +V  G      D     +  + E+I H  +N +  DYD AL+++       + FN+ V P+CLP      P P   C +SGWG T    S     LL A + +  HE C      G  +T RM C G+ AG I +CQGDSGGPL C+  +  + + G TSWG GCA P  P VY K    L WIK
Sbjct:    4 CGVQNSAGGRDRIVGGTPATSGKWPWQASLR----NYGSHVCGASLISERWLVAAAHCFMYSSNVYEWQVYLGI-TYIYDSANAVIVNVAEIITHERFNISTIDYDIALVRLSDP----VSFNHRVSPICLPPSTSHFPQPGKTCFISGWGRTSLAESGIHYDLLEAPMQIFSHEACSSNLMNGNFITTRMICIGHPAGAISSCQGDSGGPLACQGTDKAWYLSGVTSWGFGCALPMKPVVYTKTSKFLPWIK 247          
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Match: si:dkey-33m11.8 (si:dkey-33m11.8 [Source:ZFIN;Acc:ZDB-GENE-141215-49])

HSP 1 Score: 146.747 bits (369), Expect = 1.820e-39
Identity = 90/235 (38.30%), Postives = 123/235 (52.34%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLS-TYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            R+VGGFE    + P+Q  ++Q       H+CG ++++  W++ AAHC      D RV  G+    + +  EQ F +E  I H  ++ A  D D  L+K+ R        N  VQPV L + G   +  + CLVSGWG   +   P+ L A  +       C + Y G LT+ M CA Y AGG D CQGDSGGPL+C  NG   + G  SWG GCA P  PGVY K+   + WI+ 
Sbjct:   21 RIVGGFEVARNSLPYQASLQQN----GVHYCGGTLINAKWVLTAAHCEI-TSLDLRV-LGEHSLGNVEGKEQTFMVERAIRHAGYDPATVDNDIMLLKLPR----AAVLNAAVQPVQLARAGARLEDGTSCLVSGWGTVGNGVMPDALRAVYLDTTSRGYCNDAYSGTLTDNMFCAVYAAGGRDACQGDSGGPLIC--NG--ALNGIVSWGYGCAYPNYPGVYTKVSNYITWIEN 241          
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002258.1 (pep scaffold:Pmarinus_7.0:GL487751:502724:507790:1 gene:ENSPMAG00000002029.1 transcript:ENSPMAT00000002258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 5.896e-39
Identity = 90/254 (35.43%), Postives = 140/254 (55.12%), Query Frame = 1
Query: 2971 GLKCGH---RPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTL--STYPEKLLAAEV-PLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            G KCG    +P++    RV+ G EAV G++PWQV ++ + D +  H+CG SI+   W+I AAHC  +P +++R+  G+ D +S+ +  Q+  +E+ I HP ++    + D  L+K++        F + V P+CLP+      P +   V+GWG T   + Y    L   V PLI  E C +++   + + M CAG  A G  TC GDSGGPL  + +G++ + G TSWGN       P VY ++   +DWI E
Sbjct:   16 GQKCGSPSIQPVISGFSRVINGEEAVPGSWPWQVSLQYE-DGF--HFCGGSIIDPYWVITAAHCDFKP-ANHRIIVGEHDKSSNVENIQILYVEKAITHPLYDANTINNDILLLKLKEPA----FFGDTVSPICLPRATDTFSPGTHAAVTGWGVTRWNANYGSSTLQQTVLPLISTEDCKKWWGSYIMDPMICAG--ANGHSTCMGDSGGPLTVQKDGMWVLAGLTSWGNSRCDTSVPVVYTRVTTFVDWIAE 259          
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009259.1 (pep scaffold:Pmarinus_7.0:GL478809:471847:475891:1 gene:ENSPMAG00000008373.1 transcript:ENSPMAT00000009259.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 5.222e-38
Identity = 87/236 (36.86%), Postives = 123/236 (52.12%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTY--PEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
             +VGG+E    + PWQV +     +   H+CG S++S +W++ AAHCY +  S   VR G+ +    +  EQ  +  + I HP +++A  D D  LIK+          N Y Q V LP   +       C +SGWG+T ++   P+ L+  + P++    C   Y G +T  M C GY  GG D+CQGDSGGP+VC  NG   + G  SWG GCA P  PGVY K+     WI  
Sbjct:   21 HIVGGYECAAHSQPWQVSL-----NIGYHFCGGSLISSEWVVSAAHCY-QTASRISVRIGEHNIFVTEGTEQRIQASKAIRHPQYSSATIDNDIMLIKLSSPA----TLNQYAQAVPLPSSCV--GTGVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDITNNMICLGYLEGGKDSCQGDSGGPVVC--NG--QLQGIVSWGRGCALPNYPGVYTKVCNYNSWIAS 240          
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004829.1 (pep scaffold:Pmarinus_7.0:GL487651:3325:6603:-1 gene:ENSPMAG00000004392.1 transcript:ENSPMAT00000004829.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 9.387e-38
Identity = 87/236 (36.86%), Postives = 123/236 (52.12%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTY--PEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
             +VGG+E    + PWQV +     +   H+CG S++S +W++ AAHCY +  S   VR G+ +    +  EQ  +  + I HP +N+A  D D  LIK+          N Y Q + LP   +       C +SGWG+T ++   P+ L+  + P++    C   Y G +T  M C GY  GG D+CQGDSGGP+VC  NG   + G  SWG GCA P  PGVY K+     WI  
Sbjct:   21 HIVGGYECAAHSQPWQVSL-----NIGYHFCGGSLISSEWVVSAAHCY-QTASRISVRIGEHNIFVTEGTEQRIQASKAIRHPQYNSATIDNDIMLIKLSSPA----TLNQYAQAIPLPSSCV--GTGVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDITNNMICLGYLEGGKDSCQGDSGGPVVC--NG--QLQGIVSWGRGCALPNYPGVYTKVCNYNSWIAS 240          
BLAST of Neurotrypsin vs. Ensembl Nematostella
Match: EDO37083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGX1])

HSP 1 Score: 174.866 bits (442), Expect = 3.021e-48
Identity = 100/267 (37.45%), Postives = 147/267 (55.06%), Query Frame = 1
Query: 2929 TQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYA-RPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXX-XXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLS--TYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            T+PP PT +   A+   CG RP      R+VGG  A  G +PWQ  +R         +CG S++   W++ A HC + R  +D  +R G  +  ++   EQ  ++E++I+HP +          ALIK+ +        N +V  VCLP     P   ++C ++GWG   S  T P+ L  A VP++   RC + Y G++ + M CAG + GGIDTCQGDSGGP+VC+  G + I GATSWG GCAQP   GVYA ++  + W++ +
Sbjct:   43 TRPPFPTTQAPVAS---CGVRPST----RIVGGTAAKQGDWPWQAQLR---STSGFPFCGGSLIHPQWVLTATHCVSSRRPTDLNIRLGAHNRRANLGMEQDIKVEKIIMHPGYRKPVGLAHDIALIKLLKP----ANLNRHVNLVCLPDAVPAPTDGTRCWITGWGRLASGGTAPDILQQASVPVVSRARCEKAYPGKIHDSMLCAGLDQGGIDTCQGDSGGPMVCESRGRFYIHGATSWGYGCAQPGKFGVYAHVKNLVAWVRSE 295          
BLAST of Neurotrypsin vs. Ensembl Nematostella
Match: EDO31703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX50])

HSP 1 Score: 174.481 bits (441), Expect = 3.090e-48
Identity = 114/284 (40.14%), Postives = 162/284 (57.04%), Query Frame = 1
Query: 2902 ICGLPD--EVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVG---VRQKVDDYDSHWCGASILSEDWIIGAAHCYARPK--SDYRVRTGDWDNASDDKYEQVFEIEELILHPNWX-XXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTY--PEKLLAAEVPLIKHERCFEFYKG---RLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
             C +P   +  T  P+    +DP + +KCG +       R+VGG  A  GA+PWQ+    V  KV     H CG S+++ +WI+ AAHC+A  K   DY +  G+ D  + D YEQ  ++E +ILHP +  + N+DYD ALIK+       +++N+ V+PVCLP L    + N++C +SGWG        P  L  A VPL+  + C + Y     +++ RM+CAGY AGGID CQGDSGGPLVCK   V+ + GA SWG GCA+    GVYA +     W++ 
Sbjct:   11 FCTVPTTTQAPTTLPRTERPIDPGS-VKCGTKG--KGNTRIVGGTRAKKGAWPWQISMNYVHNKVTK-TPHICGGSVVAPEWIVTAAHCFAYSKDAKDYTIAVGEHDLNATDGYEQRPDVERIILHPKYAPHNNHDYDVALIKLASP----LQYNDRVRPVCLPSLKEDLEENTQCYISGWGHLQEAGHGPWVLHQAAVPLVSRDTCQKAYNDLHYKVSSRMRCAGYGAGGIDACQGDSGGPLVCKEGDVWYLMGAISWGVGCARGGRYGVYADMMDLKYWVQS 286          
BLAST of Neurotrypsin vs. Ensembl Nematostella
Match: EDO42420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T0])

HSP 1 Score: 171.014 bits (432), Expect = 1.463e-47
Identity = 95/244 (38.93%), Postives = 134/244 (54.92%), Query Frame = 1
Query: 2998 VHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCY-ARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXX-XXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLS--TYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            V    R+VGG  A  G +PWQ  +R         +CG +++  +W++ A HC      S   +R G          EQ F +  L+ HPN++    Y  D AL+K++R      K + YV   CLP     P    +C ++GWG   S  + P+ L  A VP++   RC + Y+G++ E M CAG +AGG+D CQGDSGGP+VC+  G + I GATSWGNGCA P   GVYA+++  LDWIK +
Sbjct:   12 VSHHARIVGGTTAQQGGWPWQAQLRTSTG---YPYCGGTLIHPEWVLTATHCLKGETASRVHIRLGAHRRTKGSGNEQDFRVIRLVTHPNYHRPVGYANDIALLKLDRP----AKLDRYVNFACLPDQVPEPKEGDRCYITGWGKLSSHGSAPDILQQATVPVVGRARCMKAYRGQIHESMLCAGLDAGGVDACQGDSGGPMVCENAGRFYIQGATSWGNGCAAPGKFGVYARVKYVLDWIKSE 248          
BLAST of Neurotrypsin vs. Ensembl Nematostella
Match: EDO47761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX8])

HSP 1 Score: 164.466 bits (415), Expect = 2.231e-45
Identity = 95/243 (39.09%), Postives = 140/243 (57.61%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVG-VRQKVDDYDSHWCGASILSEDWIIGAAHCY--ARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWG---DTLSTYPEKLLAAEVPLIKHERCF--EFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVC---KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWI 3708
            R+VGG  A  GA+PWQV  +  K  D  + +CG S++  +W++ AAHC+   + KS Y +R G+ +   D+  EQ F IE+  +HP ++    D D ALIK++R        N  V  +CLP+      P +KC +SGWG   +   +  + L+ A+VPL+  ++C   + Y  R+TE M CAG   GG+D+CQGDSGGP VC   +    +T+ G TSWG GCA+    G+YA ++  L WI
Sbjct:    1 RIVGGVVAKPGAWPWQVALIWAKGHDKGAQFCGGSLIDPEWVLTAAHCFEITKDKSQYMLRLGEHNFNEDEGTEQDFYIEKYYIHPKYDEKTTDNDMALIKLDRP----ATLNKRVNTICLPEADDEFKPGTKCTISGWGALQEGAGSTSKVLMQAKVPLVSRDQCSHQQSYGDRITENMLCAGMRQGGVDSCQGDSGGPFVCTNPENPRQWTLVGVTSWGKGCARALKYGIYANVRRYLHWI 239          
BLAST of Neurotrypsin vs. Ensembl Nematostella
Match: EDO34807 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB8])

HSP 1 Score: 158.303 bits (399), Expect = 2.110e-43
Identity = 88/238 (36.97%), Postives = 136/238 (57.14%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPK--SDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTL---STYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIK 3711
            RV+GG +A+ GA+PWQ+ ++ + +      CG S++S  W++ AAHC AR    + Y++  G+ +   ++  E+   ++++I HP +NN     D ALI++        K ++ V PVCLP  G      S+C ++GWG      S++P  L  A +P +   +C +  +      M CAG   GGID CQGDSGGPLVC+  G + I GATSWG+GCA P   GVYA ++  + W++
Sbjct:    2 RVIGGKDAIPGAWPWQIALKSRGNFI----CGGSLVSSTWVVTAAHCVARSSNPAQYQIIVGEHNRNVNEVTEETLNVKKVIAHPQYNNPRLSNDIALIELASPA----KLSSRVNPVCLPPHGYKLPAGSRCFITGWGKIKHPGSSHP-ILQQAMIPSLSEAQCKQKAQQSGCNSMLCAGLYNGGIDACQGDSGGPLVCETGGQFYIHGATSWGHGCAAPGKYGVYAHVKNLIGWVR 230          
BLAST of Neurotrypsin vs. Ensembl Medaka
Match: prss12 (serine protease 12 [Source:NCBI gene;Acc:105358156])

HSP 1 Score: 323.939 bits (829), Expect = 3.875e-93
Identity = 270/883 (30.58%), Postives = 407/883 (46.09%), Query Frame = 1
Query: 1192 SDCYEDNGLD--YRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGV--YGYCAIGKCS-ELPPPTATLKPQVTDPMGFGQG-------GCQSIQYHCPSM---ISYNRQCIP-----KNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTD-SKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQF---KCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVN-----RFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHW-CGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIK-----IERNDGVGIKFNNYVQPVCLP-KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGG--IDTCQGDSGGPLVC-KVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            +DC    G D  YRG I  T  GS C  WT+ A     + +P  G+G+HN CRNPD+ ++PWC+     G   +GYC   + S  L    + L  +V   +G   G       G +     C  +   IS   + +P     K  +  K  HC G E+ D   C K      E   A+ + CI +  V         G  E   TV       +V+       I D  D+ D  D  +      C+ L    A K++      +S                          G  +  +  CT  +    +CT+    E    C H ++ G     + C  +T      RL G    +EG++E+ YQG+WG VCDDG+    ++VVC+QLG+      +    +     RFG    P +L+D++ CTG E SL  C    W  H+C   E   + C       N E                       +G   P    +++V LA G  ++ GRVEL   G  GTVCDD + D+DA V+CR L   G A+A     FGEG G I +DN+ C G+E ++ +C     G H C H ED GVIC   D    Q     AK DPA  L CG R +  ++ R++GG  ++ G +PWQ  +R +    D    CGA+++   W++ +AHC+ R  +    Y+VR GD+ +   ++YE+ + +++++ HP +++ + DYD AL+      + +  G  + F+ +V PVCLP +   +    S C ++GWGDT  +Y + L  A + L+    C ++Y    T RM CAG       +D+C+GDSGGPLVC +  G + I+G TSWG+ C   ++PGVY K+     WI++
Sbjct:   32 TDCVRSRGKDGFYRGSIDVTESGSRCMNWTEVAGF--QERHPGKGIGEHNHCRNPDSRIRPWCFFRNHKGRIDWGYCDCKQGSVRLQGGRSKLDGRVEVYLGGVWGSVCSNDWGDEDAAVVCRQLDEGISGRARAVPLFRTSKTRIHWKEVHCRG-EEPDLLHCSKSTWNGEECLTAAAVTCIQQKTVVTLPMRLIGGESESEGTV-------EVFHAGQWGSICD--DQWDDSDAEV-----VCRQLGLSGAAKAWGQAHFGKS-------------------------SGRVWLDEVRCTGNELSLEQCTKSAWGE--HNCLHSEDAG-----VSCHPLT--DGATRLVGGAGSHEGRLEIFYQGQWGTVCDDGWTKSNSQVVCRQLGYRTGETLLLEGPDIPPGPRFGVGSGP-ILLDDVNCTGKEPSLLLCSRREWLCHDCSHQEDVHIAC-------NPEI----------------------NGESLPA---SLRVRLAGGESSREGRVELYLFGQWGTVCDDGWTDQDAEVVCRQLGYSGAAKARLMAYFGEGTGPIHMDNVNCIGDERSIADCIKQMPGTHNCRHSEDAGVIC---DYGEPQHSTKEAK-DPAISL-CGLRLVHTRQRRIIGGENSLRGGWPWQAAIRLRGSKGDGRLVCGATLIDTCWVLTSAHCFKRYGNSTKLYKVRVGDYHSLVPEEYEEEYGVDKIVFHPRYHSHSNDYDLALVHLSPGAVRQTAGECVSFSRHVLPVCLPARKERLLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRLCQQYYHSAFTSRMLCAGSVQSDRRVDSCRGDSGGPLVCERPGGGWVIYGVTSWGHACRTQQSPGVYTKVSAFSFWIRK 825          

HSP 2 Score: 60.4622 bits (145), Expect = 2.634e-8
Identity = 41/114 (35.96%), Postives = 57/114 (50.00%), Query Frame = 1
Query:  352 PQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHD--STSYCS-GKSAGVSCVYN 684
            P  +R+R     ++ EGRVE+Y      WG VCDD W   DA V CRQLG+   A+ A     +G G   ++   +  + C G+E+S+ DC      T  C   + AGV C Y 
Sbjct:  444 PASLRVRLAGGESSREGRVELYLFGQ--WGTVCDDGWTDQDAEVVCRQLGYSGAAK-ARLMAYFGEGTGPIH---MDNVNCIGDERSIADCIKQMPGTHNCRHSEDAGVICDYG 551          

HSP 3 Score: 55.0694 bits (131), Expect = 1.171e-6
Identity = 37/99 (37.37%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  388 TANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDS---TSYCSGKSAGVSC 675
            + +EG VEV+ +    WG +CDD W+  DA V CRQLG    A+ A  Q  +G+   S     + +++CTGNE SL  C   +    +    + AGVSC
Sbjct:  228 SESEGTVEVFHAGQ--WGSICDDQWDDSDAEVVCRQLGLSGAAK-AWGQAHFGK---SSGRVWLDEVRCTGNELSLEQCTKSAWGEHNCLHSEDAGVSC 320          
BLAST of Neurotrypsin vs. Ensembl Medaka
Match: si:ch73-127m5.1 (neurotrypsin [Source:NCBI gene;Acc:101157816])

HSP 1 Score: 218.394 bits (555), Expect = 1.236e-57
Identity = 184/598 (30.77%), Postives = 271/598 (45.32%), Query Frame = 1
Query: 1984 IAITYPGAHYSMKSD-CTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFE---IRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYG--AFPWQVGV-RQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSD---YRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLP-----KLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTER-MQCAGYEAGGI----DTCQGDSGGPLVCK-VNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            IA  +  AH+   S     +  KCT         +C H D    N D ++   V+  P+    +RL G  + +EG+VEV + G+WG VCDD +  + AEVVC+QLG+ G  E +   +  FGK  +  +L+D++ C G+E SL +C+H  W   +C   E  GV C+V  +   +E         IS S                       V L  G   K GRVE+   G  G++CD  ++D +AAV+CR L   GRA A     FG+G G I LD ++CTG+E  L  CP        C  +ED GV C         P +   K  P   L CG R +V   G+     E       +PWQV V  Q   + +   C  +++S  W++ +A C +R  SD   Y VR G          EQ    E L+LH  +   +  +D AL+K+    G  + F+      CLP     K G +P      + +GW       P+ ++A+ VPL+   +C + +    +     CA           D CQG+SGG LVC+  +G + + G  S G GCA P +P +Y ++     W+ E
Sbjct:  277 IAKAWSWAHFGQGSGPILLDAVKCTGNEL--FLDQCSHGDWEQHNCDHMEDAGVSCSPYTDGVVRLVGGDSPWEGRVEVFHNGDWGTVCDDHWSQQHAEVVCRQLGYRGHAEVVTDGL--FGKG-AGLILLDDVHCEGSETSLLDCRHGIWGRTDCSHSEDVGVRCRVRSSQETNEVP------VISPST-------------------GPLVRLVGGSSRKEGRVEVYLHGDWGSICDSGWNDLNAAVVCRQLGHSGRATAAVG--FGQGKGPIHLDQVRCTGKEEFLGECPSLGQSIQGCGRREDAGVKCD------ATPHEAAVKTKPEE-LSCGLRKMVEVEGKKRNHEEESMSRTTWPWQVSVWLQSQKEGEGPLCSGTLISPCWVLTSAFCLSRFGSDPTIYVVRVG--------ASEQTLTPERLVLHRKFKGQSGGHDLALLKLPSTKGHCLTFDPNTNAACLPGTDGAKEGNIPASCVVMVTTGWAG-----PDSVVASWVPLMSPWQCKKRFGNSFSSHGTLCAASPPDTSLLRGDGCQGNSGGGLVCQDESGRWVLTGVVSGGYGCADPSSPALYTRVSRFRSWMDE 822          

HSP 2 Score: 152.525 bits (384), Expect = 1.222e-36
Identity = 109/311 (35.05%), Postives = 147/311 (47.27%), Query Frame = 1
Query: 2107 GDNSDEIDCTTVTFPPF----EIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGG 3027
            GD S   + T V  PP      +RL      +EG+VEV + G WG VCDD +D + AEVVC+QLGF G  ++   A   FG+   P +L+D +KCTG E  L++C H  W  HNC   E AGV C                                      P     V++   D P    GRVE+   G  GTVCDD +  + A V+CR L   G A+ + D  FG+GAG I+LD++ C G E +L +C    WG   C+H ED+GV C +     +Q       + P+ G      P+V    R+VGG
Sbjct:  209 GDCSHGNEATLVCAPPEGSGPPLRLVEGEEDFEGRVEVFHAGRWGTVCDDQWDDRDAEVVCRQLGFGGIAKAWSWA--HFGQGSGP-ILLDAVKCTGNELFLDQCSHGDWEQHNCDHMEDAGVSCS-------------------------------------PYTDGVVRLVGGDSP--WEGRVEVFHNGDWGTVCDDHWSQQHAEVVCRQLGYRGHAEVVTDGLFGKGAGLILLDDVHCEGSETSLLDCRHGIWGRTDCSHSEDVGVRCRVRS---SQETNEVPVISPSTG------PLV----RLVGG 464          

HSP 3 Score: 111.694 bits (278), Expect = 4.800e-24
Identity = 82/248 (33.06%), Postives = 118/248 (47.58%), Query Frame = 1
Query: 2164 RLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVIC 2907
            RL GS     G+VE+   G+WG VC+  +  + A V+C+QLGF     ++  +  +FG   S     + + C G E +L +C+   + + +C     A +VC                                 +GS  P       + L +G +   GRVE+   G  GTVCDD +DD+DA V+CR L   G A+A     FG+G+G I+LD +KCTG EL L+ C    W +H C H ED GV C
Sbjct:  123 RLVGSSISGSGRVEIYLNGQWGAVCNSHWTDRDASVICRQLGFGDIGTALQHS--QFGSG-SGLFHYERLGCRGDEGTLMKCQSRTFVTGDCSHGNEATLVCAP------------------------------PEGSGPP-------LRLVEGEEDFEGRVEVFHAGRWGTVCDDQWDDRDAEVVCRQLGFGGIAKAWSWAHFGQGSGPILLDAVKCTGNELFLDQCSHGDWEQHNCDHMEDAGVSC 330          

HSP 4 Score: 63.929 bits (154), Expect = 2.379e-9
Identity = 37/97 (38.14%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            +P +  ++RL G +  +  EGRVEV+ +    WG VCDD+W+   A V CRQLG+R  A E      +G+G        +  + C G+E SL+DC H
Sbjct:  331 SPYTDGVVRLVGGD--SPWEGRVEVFHNGD--WGTVCDDHWSQQHAEVVCRQLGYRGHA-EVVTDGLFGKG---AGLILLDDVHCEGSETSLLDCRH 419          

HSP 5 Score: 60.4622 bits (145), Expect = 2.419e-8
Identity = 42/115 (36.52%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  340 APESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH--DSTSYCSGKS-AGVSC 675
            +P +  ++RL G +  +  EGRVEVY      WG +CD  WN L+A V CRQLG   +A  A     +G+G   ++   + +++CTG E+ L +CP    S   C  +  AGV C
Sbjct:  452 SPSTGPLVRLVGGS--SRKEGRVEVYLHGD--WGSICDSGWNDLNAAVVCRQLGHSGRATAAV---GFGQGKGPIH---LDQVRCTGKEEFLGECPSLGQSIQGCGRREDAGVKC 556          

HSP 6 Score: 60.077 bits (144), Expect = 3.541e-8
Identity = 31/80 (38.75%), Postives = 47/80 (58.75%), Query Frame = 1
Query: 1168 QMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGY 1407
            Q ++P S S+ + + G  Y G +S+T  G+ C KWT+    V     P  GLGDH++CRNPD +  PWC+   ++G  G+
Sbjct:   36 QNSVPLSCSEGFTELGY-YNGTVSQTDSGAPCLKWTEFPDYV--MQYPGRGLGDHSYCRNPDRESNPWCFFRQSSGAIGW 112          

HSP 7 Score: 57.7658 bits (138), Expect = 1.544e-7
Identity = 37/93 (39.78%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  352 PQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPH 630
            P +  + GE      EGRVEV+  ++  WG VCDD W+  DA V CRQLGF   A+ A     +G+G   +    +  ++CTGNE  L  C H
Sbjct:  229 PPLRLVEGEEDF---EGRVEVF--HAGRWGTVCDDQWDDRDAEVVCRQLGFGGIAK-AWSWAHFGQGSGPI---LLDAVKCTGNELFLDQCSH 312          

HSP 8 Score: 55.0694 bits (131), Expect = 1.137e-6
Identity = 32/96 (33.33%), Postives = 50/96 (52.08%), Query Frame = 1
Query: 2632 AKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPD 2919
            + SGRVE+   G  G VC+  + D+DA+VICR L       A++  +FG G+G    + L C G+E  L  C    +    C+H  +  ++C  P+
Sbjct:  130 SGSGRVEIYLNGQWGAVCNSHWTDRDASVICRQLGFGDIGTALQHSQFGSGSGLFHYERLGCRGDEGTLMKCQSRTFVTGDCSHGNEATLVCAPPE 225          
BLAST of Neurotrypsin vs. Ensembl Medaka
Match: tmprss5 (transmembrane serine protease 5 [Source:NCBI gene;Acc:101167385])

HSP 1 Score: 162.54 bits (410), Expect = 3.929e-44
Identity = 95/247 (38.46%), Postives = 138/247 (55.87%), Query Frame = 1
Query: 2989 RPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLS---TYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            + I  K  R++GG EA  G +PWQV +         H CG SI++  WI+ AAHC+      YR     ++ +      Q +++E++I + N+N+  +D D ALIK+       + F + ++P+CLP+        ++C +SGWG T       P+ L  A VPLI  ++C     Y G +T RM CAGY  G +D CQGDSGGPLVC+ + V+ + G  SWG GCA+P +PGVY K+   L WI E
Sbjct:   14 QSITTKLPRIIGGAEAALGRWPWQVSLYYS----SRHTCGGSIITRQWIVTAAHCH------YRSEIQGFNQSLTAV--QRWKLEKIIYNKNYNHRTHDSDIALIKLR----TPLNFTDTIRPICLPQYKYDLPGGTQCWISGWGYTKPDDVQSPDTLKEAPVPLISTKKCNSSCMYNGEITPRMLCAGYTEGKVDACQGDSGGPLVCQEDTVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLSWIYE 244          
BLAST of Neurotrypsin vs. Ensembl Medaka
Match: tmprss5 (transmembrane serine protease 5 [Source:NCBI gene;Acc:101167385])

HSP 1 Score: 166.007 bits (419), Expect = 9.006e-44
Identity = 103/267 (38.58%), Postives = 144/267 (53.93%), Query Frame = 1
Query: 2947 TAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHC---YARPK-SDYRVRTGDWDNASDDKYEQV-FEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLS---TYPEKLLAAEVPLIKHERCFE--FYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQ 3717
            T KV      +CG R    K  R++GG EA  G +PWQV +         H CG SI++  WI+ AAHC   Y  P+ S + V  G    +S    +     +E++I + N+N+  +D D ALIK+       + F + ++P+CLP+        ++C +SGWG T       P+ L  A VPLI  ++C     Y G +T RM CAGY  G +D CQGDSGGPLVC+ + V+ + G  SWG GCA+P +PGVY K+   L WI E 
Sbjct:  123 TGKVIALQCFECGTRA---KLPRIIGGAEAALGRWPWQVSLYYS----SRHTCGGSIITRQWIVTAAHCVHNYRLPQVSSWVVYAGIVTRSSAKMVQHTGHAVEKIIYNKNYNHRTHDSDIALIKLR----TPLNFTDTIRPICLPQYKYDLPGGTQCWISGWGYTKPDDVQSPDTLKEAPVPLISTKKCNSSCMYNGEITPRMLCAGYTEGKVDACQGDSGGPLVCQEDTVWRLVGVVSWGTGCAEPNHPGVYTKVAEFLSWIYEM 378          
BLAST of Neurotrypsin vs. Ensembl Medaka
Match: ENSORLT00000007900.2 (trypsin-like [Source:NCBI gene;Acc:101170788])

HSP 1 Score: 157.532 bits (397), Expect = 1.579e-42
Identity = 92/239 (38.49%), Postives = 129/239 (53.97%), Query Frame = 1
Query: 3013 RVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLST-----YPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE 3714
            ++VGGFE    + P+QV +    +     +CG ++LSE W++ AAHC   PKS+  VR G+ D    +  EQ     + I HPN++    D D  LIK+          N++V+P  LP      +  + C +SGWG+  S+     YP+KL   + PL+  E CF  Y  ++TE M CAGY  GG D+CQGDSGGP+ C       + G  SWG+GCA    PGVY K+   + WIKE
Sbjct:   21 KIVGGFECQKNSVPYQVSLFTGYN-----YCGGTLLSEQWVLSAAHC--EPKSNLEVRLGEHDIWEPEGTEQHIMSAKFIRHPNYDPRTQDNDIMLIKLSEP----ATLNSFVRPAVLPS--KCENDGTMCRISGWGNIRSSDEGSRYPDKLQCLDAPLLSDETCFNAYPFQITENMICAGYLEGGKDSCQGDSGGPMTCDGE----LQGVVSWGHGCAMKNKPGVYTKVCNYVSWIKE 242          
BLAST of Neurotrypsin vs. Planmine SMEST
Match: SMESG000016088.1 (SMESG000016088.1)

HSP 1 Score: 2459.87 bits (6374), Expect = 0.000e+0
Identity = 1199/1204 (99.58%), Postives = 1202/1204 (99.83%), Query Frame = 1
Query:  115 MKLAVLAFCLVLTTNAAIIKSQYDKYDHFFQPSLTRHKRQAVSEDETTFFDQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPPPTATLKPQVTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXXXXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            MKLAVLAFCLVLTTNAAIIKSQY+KYD+FFQ SLTRHKRQAVSEDETTFFDQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPPPTATLKPQVTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRD+CGDNSDE DCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCDDDYDDKDAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWNNANYDYDYALIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL
Sbjct:    1 MKLAVLAFCLVLTTNAAIIKSQYEKYDNFFQASLTRHKRQAVSEDETTFFDQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPPPTATLKPQVTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDDCGDNSDETDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCDDDYDDKDAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWNNANYDYDYALIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 1204          
BLAST of Neurotrypsin vs. Planmine SMEST
Match: SMESG000016089.1 (SMESG000016089.1)

HSP 1 Score: 1514.21 bits (3919), Expect = 0.000e+0
Identity = 722/1206 (59.87%), Postives = 914/1206 (75.79%), Query Frame = 1
Query:  121 LAVLAFCLVLTTNAAIIKSQYDKYDHFFQPSLTRHKRQAVSEDETTFFDQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPP-PTATLKPQVTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLP--DEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXX-XXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            + ++ FC    T A  +++  +     F     RHKRQA    E TFF+ N   +   GRS + +P+R V DGAPE+P+ +R+R +    ANEGRVEVY+S +K WGLVCDDYWN+ DANV+C+QLGF   AREATRQD +GRG W+  DY + KI+C G+E S+ +C H+ +S CSG S+GVSC++N GC  GW+SFNG CYQ+  + + +K+A+++C++ NSKLA+IL   ENNF+SNVLY+Q+K I Q+WTGGYYA++K++ G+   RWNW STIHNVDQW+TS LWF G+ E K+DKRP GD K +SC+ALNR + DSQR N +YDVNYFWWDNLSCN KLPFICQ    + R+DCYE NG  YRG  SRT QG+ CAKW++P+ TVN +T+P AGLGDHN+CRNPDND+ PWCW N   GVYGYC + KCS+ P  P  T  P+++DP G G GGC   Q++CPSM SYNR+C+  + VCD++  C G EDE+  FCK + C+ NEF+C +D FCILK+++CDG+R+C+D +DEKNC++++E+ +L  YDK  SKIL V DK+ Y ++ +++C +KC++++ QF C+S NYLPP+E+R  SEC L+ +L SE P  L  I YPG HYS+K+DCT  ++KC+ GMCI LSK CD R++CGDNSDE++C +VTFPPFEIRLTGS N +EGKVE+RYQGEWG++CDD F I  A V+CKQLGF+ A+E +H +  +FGK R P +L+DE+KC GTE S+EEC H  WR HNC+ +EIAGV+CKVDRACTN+EFRC KDK CI +S++CD   DCSD SDEPEG+C + V L +GPD+ SGRVE+ R   KGTVCDD + D +A+VICRML I GRAQA+ D RFG G G IVL N +C G E +L  C  FKWGEHKC+HKED GVICGLP  +  +T       K +   GL CG +PI  +RGRVVGGFE VYGAFPWQVGVR +V DYD HWCG SILSEDWII A+HCY +PK+ Y VRTGDW+N   D YEQ FEIEEL L+P +     +D+D ALIKI+RN+G+GI FN++VQPVCLPK GMVPD  +KCLVSGWGDTL    EKLLAAEVPLIK ERC EFYK R+T+RMQCAGYEAGGIDTCQGDSGGPLVC+VNG+YTIFGATSWG+GCA P++PGVYAK+   LD++KE+TG 
Sbjct:    4 ILIIWFCACANTQAFQLENSENV---LFHSHFQRHKRQAPLGIEKTFFNDNPEVVITEGRSKSIYPIRSVLDGAPETPERLRIRSDGKSAANEGRVEVYNSKTKKWGLVCDDYWNLPDANVSCKQLGFVNAAREATRQDHHGRGKWTKKDYIIDKIKCLGSEASIFECSHEMSSTCSGGSSGVSCIFNGGCSYGWVSFNGVCYQVVNKILTFKKAEEYCKNQNSKLAYILDRNENNFLSNVLYSQFKKIHQVWTGGYYAKIKMNTGKIVKRWNWQSTIHNVDQWNTSYLWFQGYGEIKSDKRPLGDVKKKSCLALNRLYGDSQRSNEIYDVNYFWWDNLSCNTKLPFICQKITTRGRTDCYEGNGATYRGTTSRTNQGTKCAKWSNPSLTVNDKTHPNAGLGDHNYCRNPDNDIMPWCWVNTDVGVYGYCVMEKCSDKPSLPLVTELPRISDPPGKGNGGCADNQFYCPSMTSYNRKCLALSRVCDQVNDCSGLEDENPEFCKTFFCQANEFYCKADTFCILKSNICDGQRHCSDNADEKNCSIINETEILVKYDKFKSKILMVPDKIVYANLRLEECVQKCRVIYPQFGCRSLNYLPPNETRIFSECHLMKQLQSEIPDSLKHINYPGDHYSLKTDCTG-KYKCSSGMCIALSKSCDGRNDCGDNSDEMNCPSVTFPPFEIRLTGSKNDWEGKVEIRYQGEWGYICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICKVDRACTNTEFRCQKDKTCIKMSQMCDGKVDCSDRSDEPEGQCFLSVKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVICRMLGISGRAQAVTDTRFGSGVGEIVLSNPRCRGNETSLVQCNSFKWGEHKCSHKEDAGVICGLPILEHPITTTATSLKKSEQVPGLTCGRKPITQRRGRVVGGFETVYGAFPWQVGVRHRVGDYDIHWCGGSILSEDWIISASHCYEKPKNRYFVRTGDWNNNEMDIYEQSFEIEELFLNPKYKGPPTFDFDTALIKIKRNNGIGIIFNDHVQPVCLPKPGMVPDLKTKCLVSGWGDTLVETAEKLLAAEVPLIKAERCKEFYKDRITDRMQCAGYEAGGIDTCQGDSGGPLVCQVNGIYTIFGATSWGDGCAVPRSPGVYAKVDSMLDFVKEKTGF 1205          
BLAST of Neurotrypsin vs. Planmine SMEST
Match: SMESG000016089.1 (SMESG000016089.1)

HSP 1 Score: 1513.82 bits (3918), Expect = 0.000e+0
Identity = 722/1206 (59.87%), Postives = 914/1206 (75.79%), Query Frame = 1
Query:  121 LAVLAFCLVLTTNAAIIKSQYDKYDHFFQPSLTRHKRQAVSEDETTFFDQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEVYDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSVNDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISFNGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKSIAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETKTDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFICQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPEAGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPP-PTATLKPQVTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDHGFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESALLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPPHESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGMCIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRYQGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLVDEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSKDKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRGGLKGTVCXXXXXXXXAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLKCTGEELNLENCPFFKWGEHKCTHKEDIGVICGLP--DEVVTQPPKPTAKVDPAAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGASILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPNWXX-XXXXXXXXLIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVSGWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDTCQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKEQTGL 3726
            + ++ FC    T A  +++  +     F     RHKRQA    E TFF+ N   +   GRS + +P+R V DGAPE+P+ +R+R +    ANEGRVEVY+S +K WGLVCDDYWN+ DANV+C+QLGF   AREATRQD +GRG W+  DY + KI+C G+E S+ +C H+ +S CSG S+GVSC++N GC  GW+SFNG CYQ+  + + +K+A+++C++ NSKLA+IL   ENNF+SNVLY+Q+K I Q+WTGGYYA++K++ G+   RWNW STIHNVDQW+TS LWF G+ E K+DKRP GD K +SC+ALNR + DSQR N +YDVNYFWWDNLSCN KLPFICQ    + R+DCYE NG  YRG  SRT QG+ CAKW++P+ TVN +T+P AGLGDHN+CRNPDND+ PWCW N   GVYGYC + KCS+ P  P  T  P+++DP G G GGC   Q++CPSM SYNR+C+  + VCD++  C G EDE+  FCK + C+ NEF+C +D FCILK+++CDG+R+C+D +DEKNC++++E+ +L  YDK  SKIL V DK+ Y ++ +++C +KC++++ QF C+S NYLPP+E+R  SEC L+ +L SE P  L  I YPG HYS+K+DCT  ++KC+ GMCI LSK CD R++CGDNSDE++C +VTFPPFEIRLTGS N +EGKVE+RYQGEWG++CDD F I  A V+CKQLGF+ A+E +H +  +FGK R P +L+DE+KC GTE S+EEC H  WR HNC+ +EIAGV+CKVDRACTN+EFRC KDK CI +S++CD   DCSD SDEPEG+C + V L +GPD+ SGRVE+ R   KGTVCDD + D +A+VICRML I GRAQA+ D RFG G G IVL N +C G E +L  C  FKWGEHKC+HKED GVICGLP  +  +T       K +   GL CG +PI  +RGRVVGGFE VYGAFPWQVGVR +V DYD HWCG SILSEDWII A+HCY +PK+ Y VRTGDW+N   D YEQ FEIEEL L+P +     +D+D ALIKI+RN+G+GI FN++VQPVCLPK GMVPD  +KCLVSGWGDTL    EKLLAAEVPLIK ERC EFYK R+T+RMQCAGYEAGGIDTCQGDSGGPLVC+VNG+YTIFGATSWG+GCA P++PGVYAK+   LD++KE+TG 
Sbjct:    5 ILIIWFCACANTQAFQLENSENV---LFHSHFQRHKRQAPLGIEKTFFNDNPEVVITEGRSKSIYPIRSVLDGAPETPERLRIRSDGKSAANEGRVEVYNSKTKKWGLVCDDYWNLPDANVSCKQLGFVNAAREATRQDHHGRGKWTKKDYIIDKIKCLGSEASIFECSHEMSSTCSGGSSGVSCIFNGGCSYGWVSFNGVCYQVVNKILTFKKAEEYCKNQNSKLAYILDRNENNFLSNVLYSQFKKIHQVWTGGYYAKIKMNTGKIVKRWNWQSTIHNVDQWNTSYLWFQGYGEIKSDKRPLGDVKKKSCLALNRLYGDSQRSNEIYDVNYFWWDNLSCNTKLPFICQKITTRGRTDCYEGNGATYRGTTSRTNQGTKCAKWSNPSLTVNDKTHPNAGLGDHNYCRNPDNDIMPWCWVNTDVGVYGYCVMEKCSDKPSLPLVTELPRISDPPGKGNGGCADNQFYCPSMTSYNRKCLALSRVCDQVNDCSGLEDENPEFCKTFFCQANEFYCKADTFCILKSNICDGQRHCSDNADEKNCSIINETEILVKYDKFKSKILMVPDKIVYANLRLEECVQKCRVIYPQFGCRSLNYLPPNETRIFSECHLMKQLQSEIPDSLKHINYPGDHYSLKTDCTG-KYKCSSGMCIALSKSCDGRNDCGDNSDEMNCPSVTFPPFEIRLTGSKNDWEGKVEIRYQGEWGYICDDRFTISEAHVICKQLGFIEALEYVHGSGVKFGKVRDPIILLDELKCKGTEFSIEECPHDVWRKHNCKSEEIAGVICKVDRACTNTEFRCQKDKTCIKMSQMCDGKVDCSDRSDEPEGQCFLSVKLVNGPDSYSGRVEIQRSLSKGTVCDDGFTDSEASVICRMLGISGRAQAVTDTRFGSGVGEIVLSNPRCRGNETSLVQCNSFKWGEHKCSHKEDAGVICGLPILEHPITTTATSLKKSEQVPGLTCGRKPITQRRGRVVGGFETVYGAFPWQVGVRHRVGDYDIHWCGGSILSEDWIISASHCYEKPKNRYFVRTGDWNNNEMDIYEQSFEIEELFLNPKYKGPPTFDFDTALIKIKRNNGIGIIFNDHVQPVCLPKPGMVPDLKTKCLVSGWGDTLVETAEKLLAAEVPLIKAERCKEFYKDRITDRMQCAGYEAGGIDTCQGDSGGPLVCQVNGIYTIFGATSWGDGCAVPRSPGVYAKVDSMLDFVKEKTGF 1206          
BLAST of Neurotrypsin vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 1036.94 bits (2680), Expect = 0.000e+0
Identity = 510/620 (82.26%), Postives = 537/620 (86.61%), Query Frame = -2
Query: 4252 ARSMKGINGNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKMLNGFIEKKLIDEEVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVETIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVDLGDGKNGYKKIEPKYVLVLPYSEGFTNYKRKLGKLIGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLQTRVQKHSRLRGVSNIIEHRKMCKGTTDLKDFKILYKNFNNKWERILGEALVIKSQSPKINVQSA--TNLLRLF 6105
            +RS+KGIN NYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQK+LNGFIEKKLIDE+VGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM          F+           +EC                                   LVETIDLCCALWNENDSEHHILD RAFRKL+EFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFL FENQKHVEPFLHFMNSLHKN+VFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEF+YKRNMVKGLIYRSW+LSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSV LGDGKNG+KKIEPKYVLVLPYSEGFTNYKRKL K +GNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVY FTCNGCNATYIGETSRHL TRV  H +L+G++NI EH + CK    + DF+IL ++FNN WER++ EAL+I+S  PKINVQSA  TN+L +F
Sbjct: 2377 SRSIKGINDNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKILNGFIEKKLIDEKVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM----------FV-----------YECT----------------------------------LVETIDLCCALWNENDSEHHILDGRAFRKLIEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLEFENQKHVEPFLHFMNSLHKNLVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVSLGDGKNGFKKIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEHNRGCKSEIGMSDFRILLRSFNNYWERVICEALLIRSLDPKINVQSAVTTNVLNVF 2941          
BLAST of Neurotrypsin vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 526/685 (76.79%), Postives = 565/685 (82.48%), Query Frame = -2
Query: 4252 KLINLRKIFGISKFSVENTVINLSKIVLNDDEERVLKFGPNHCIKN-RLDETKLCAKIESLYFHIARSMKGINGNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKMLNGFIEKKLIDEEVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVETIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVDLGDGKNGYKKIEPKYVLVLPYSEGFTNYKRKLGKLIGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLQTRVQKHSRLRGVSNIIEHRKMCKGTTDLKDFKILYKNFNNKWERILGEALVIKSQSPKINVQSA--TNLLRLF 6297
            K +N+ K+ G +   +++    + K    DD   +  +  N  IKN   D+ K  A I  L  + +RS+KGIN NYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQK+LNGFIEKKLIDE+VGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM          F+           +EC                                   LVETIDLCCALWNENDSEHHILD RAFRKL+EFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFL FENQKHVEPFLHFMNSLHKN+VFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEF+YKRNMVKGLIYRSW+LSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSV LGDGKNG+KKIEPKYVLVLPYSEGFTNYKRKL K +GNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVY FTCNGCNATYIGETSRHL TRV  H +L+G++NI EH + CK    + DF+IL ++FNN WER++ EAL+I+S  PKINVQSA  TN+L +F
Sbjct: 1357 KGLNVHKMLGEAVIHLDDIEF-VKKNSKKDDAVDLKAYEYNIQIKNIEDDDGKNIADILHL-MNKSRSIKGINDNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKILNGFIEKKLIDEKVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM----------FV-----------YECT----------------------------------LVETIDLCCALWNENDSEHHILDGRAFRKLIEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLEFENQKHVEPFLHFMNSLHKNLVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVSLGDGKNGFKKIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEHNRGCKSEIGMSDFRILLRSFNNYWERVICEALLIRSLDPKINVQSAVTTNVLNVF 1984          
The following BLAST results are available for this feature:
BLAST of Neurotrypsin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRSS128.077e-8636.12serine protease 12 [Source:HGNC Symbol;Acc:HGNC:94... [more]
TMPRSS23.480e-4531.71transmembrane serine protease 2 [Source:HGNC Symbo... [more]
TMPRSS23.480e-4531.71transmembrane serine protease 2 [Source:HGNC Symbo... [more]
TMPRSS23.533e-4531.71transmembrane serine protease 2 [Source:HGNC Symbo... [more]
TMPRSS26.487e-4531.71transmembrane serine protease 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svh-11.217e-5032.41HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-15.459e-3234.57TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-37.117e-1330.04TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
lrp-21.347e-1228.93Low-density lipoprotein RecePtor related [Source:... [more]
try-33.268e-1231.20TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
teq3.066e-9334.78gene:FBgn0023479 transcript:FBtr0076525[more]
teq1.064e-9234.78gene:FBgn0023479 transcript:FBtr0344980[more]
teq2.125e-9234.78gene:FBgn0023479 transcript:FBtr0344981[more]
CG319541.497e-4040.57gene:FBgn0051954 transcript:FBtr0077563[more]
CG81723.567e-3835.11gene:FBgn0033362 transcript:FBtr0301191[more]
back to top
BLAST of Neurotrypsin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss123.706e-8834.56serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
prss122.440e-8734.40serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
BX511095.22.533e-8734.40serine protease 12 [Source:NCBI gene;Acc:566809][more]
si:ch211-51a6.21.108e-8636.40si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-1... [more]
si:ch211-51a6.26.006e-8436.40si:ch211-51a6.2 [Source:ZFIN;Acc:ZDB-GENE-090313-1... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000001560.11.112e-9037.04neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
ENSXETT00000001537.11.167e-9037.04neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
ENSXETT00000001485.12.819e-9036.86neurotrypsin-like [Source:NCBI gene;Acc:100497588][more]
tmem132a2.402e-8134.85transmembrane protein 132A [Source:Xenbase;Acc:XB-... [more]
tmem132a1.749e-8034.85transmembrane protein 132A [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prss121.507e-8635.58protease, serine 12 neurotrypsin (motopsin) [Sourc... [more]
Tmprss22.782e-4631.53transmembrane protease, serine 2 [Source:MGI Symbo... [more]
Tmprss154.035e-4629.60transmembrane protease, serine 15 [Source:MGI Symb... [more]
Tmprss154.721e-4629.60transmembrane protease, serine 15 [Source:MGI Symb... [more]
F115.449e-4440.08coagulation factor XI [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Neurotrypsin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5G265|NETR_SAGLB1.396e-8636.48Neurotrypsin OS=Saguinus labiatus OX=78454 GN=PRSS... [more]
sp|G3V801|NETR_RAT4.654e-8635.58Neurotrypsin OS=Rattus norvegicus OX=10116 GN=Prss... [more]
sp|Q5G267|NETR_MACMU5.192e-8636.30Neurotrypsin OS=Macaca mulatta OX=9544 GN=PRSS12 P... [more]
sp|O08762|NETR_MOUSE1.054e-8535.58Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE... [more]
sp|Q5G268|NETR_NOMLE1.647e-8536.12Neurotrypsin OS=Nomascus leucogenys OX=61853 GN=PR... [more]
back to top
BLAST of Neurotrypsin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GUN80.000e+038.01Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FDY50.000e+040.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FXX80.000e+040.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IHJ70.000e+039.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FEP60.000e+038.51Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss125.124e-8734.88serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
si:ch73-127m5.12.166e-8234.74si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch211-51a6.27.467e-8235.64neurotrypsin-like [Source:NCBI gene;Acc:103031031][more]
si:ch73-127m5.11.466e-7934.39si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
si:ch73-127m5.11.012e-7834.22si:ch73-127m5.1 [Source:ZFIN;Acc:ZDB-GENE-130531-2... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006128.19.590e-4138.74pep scaffold:Pmarinus_7.0:GL484169:9759:12797:-1 g... [more]
si:dkey-33m11.81.820e-3938.30si:dkey-33m11.8 [Source:ZFIN;Acc:ZDB-GENE-141215-4... [more]
ENSPMAT00000002258.15.896e-3935.43pep scaffold:Pmarinus_7.0:GL487751:502724:507790:1... [more]
ENSPMAT00000009259.15.222e-3836.86pep scaffold:Pmarinus_7.0:GL478809:471847:475891:1... [more]
ENSPMAT00000004829.19.387e-3836.86pep scaffold:Pmarinus_7.0:GL487651:3325:6603:-1 ge... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neurotrypsin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO370833.021e-4837.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317033.090e-4840.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424201.463e-4738.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477612.231e-4539.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348072.110e-4336.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neurotrypsin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss123.875e-9330.58serine protease 12 [Source:NCBI gene;Acc:105358156... [more]
si:ch73-127m5.11.236e-5730.77neurotrypsin [Source:NCBI gene;Acc:101157816][more]
tmprss53.929e-4438.46transmembrane serine protease 5 [Source:NCBI gene;... [more]
tmprss59.006e-4438.58transmembrane serine protease 5 [Source:NCBI gene;... [more]
ENSORLT00000007900.21.579e-4238.49trypsin-like [Source:NCBI gene;Acc:101170788][more]
back to top
BLAST of Neurotrypsin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016088.10.000e+099.58SMESG000016088.1[more]
SMESG000016089.10.000e+059.87SMESG000016089.1[more]
SMESG000016089.10.000e+059.87SMESG000016089.1[more]
SMESG000050479.10.000e+082.26SMESG000050479.1[more]
SMESG000050479.10.000e+076.79SMESG000050479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032823 ID=SMED30032823|Name=Neurotrypsin|organism=Schmidtea mediterranea sexual|type=transcript|length=7054bp
CTCAGTTCATACTTGAATAAAGAGGAAATTAGACCTTTGAGTCGAATTAA
ATACAACCACTAATAAATAAATACCGAACGAAAATTTAATAAATTTATTA
TTATATTATTCGGTATGAAATTAGCGGTATTAGCATTTTGCTTAGTGCTG
ACAACGAATGCCGCGATTATTAAAAGCCAATATGACAAATATGATCACTT
TTTCCAGCCATCATTAACAAGACACAAACGGCAGGCAGTATCAGAAGATG
AGACGACATTTTTCGATCAAAACATTCCACCACTCACCGGAACTGGAAGA
TCAAACACTAGATTTCCAATGAGAAAGGTACGCGATGGAGCTCCAGAATC
GCCACAAATAATTAGGTTACGAGGTGAAAATGCATTGACAGCTAATGAAG
GTCGAGTGGAAGTCTATGATTCGAACTCAAAGCTCTGGGGATTAGTGTGT
GACGATTATTGGAATATTTTGGATGCCAATGTCACCTGCCGACAACTCGG
ATTTCGCAGAAAAGCTCGTGAAGCAACTCGACAGGATCGTTATGGAAGAG
GTGATTGGTCTGTCAACGACTACACAGTCCATAAGATCCAGTGTACAGGC
AACGAAAAAAGTCTCGTTGATTGCCCGCACGATTCTACTTCATATTGTTC
TGGAAAATCAGCCGGAGTTAGTTGCGTTTACAATTTAGGATGTCCCAATG
GCTGGATATCATTCAATGGAGCTTGTTATCAAATTAACACTCAACAAATG
GATTATAAACAAGCTGACAAGTTCTGTCAAGATCACAATTCAAAATTAGC
CTTTATTTTGAAAGCCAAAGAAAATAATTTTATTTCCAATGTTCTTTATA
CACAATATAAAAGTATCGCACAAATATGGACCGGTGGTTATTACGCAGAA
GTGAAATTAGACGAAGGCCGATCAGAATTCCGATGGAATTGGTACTCTAC
AATTCATAATGTAGATCAGTGGAGCACTTCAAATTTGTGGTTTCCTGGAT
TTTATGAGACTAAAACTGACAAACGACCTCAAGGTGACCCAAAAACCCAA
TCATGTGTGGCCCTCAATCGGGCCTTTGCAGACTCTCAAAGACAAAATAC
AGTGTATGATGTAAATTACTTTTGGTGGGATAATCTTTCCTGCAACGAAA
AACTACCTTTTATCTGCCAAATGAATATCCCACAATCGAGATCTGACTGC
TATGAAGATAACGGTTTGGATTATCGTGGTAGAATATCAAGAACAGTTCA
AGGTTCATCTTGTGCTAAATGGACAGATCCGGCAGCAACTGTGAATCCTC
AGACTAATCCGGAGGCTGGTCTCGGAGATCACAACTTTTGCCGAAATCCA
GATAATGATTTACAACCCTGGTGTTGGACTAATCCTACAAATGGTGTTTA
CGGCTACTGTGCCATTGGGAAATGTTCAGAATTGCCTCCGCCAACTGCAA
CATTGAAGCCCCAAGTTACTGATCCTATGGGATTCGGTCAAGGAGGCTGT
CAATCAATTCAATATCATTGCCCATCTATGATTTCATACAACCGACAGTG
CATTCCTAAAAATGAGGTCTGTGACAAAATACCCCATTGCTTGGGGAAAG
AAGATGAAGATCATGGATTTTGTAAGAAATATCTTTGCAAAGAAAATGAA
TTTTTCTGTGCCTCAGACATGTTTTGCATTCTAAAAACACATGTTTGTGA
CGGAAAACGCAATTGTGCAGATGGATCAGATGAAAAGAATTGTACAGTTT
TAGATGAATCTGCATTACTAAAGGTTTATGATAAGACTGACTCAAAAATT
CTTGATGTTTCCGATAAGCTTGACTACATAGACATACCAATAGACAAGTG
CGCAGAAAAATGCAAAATTCTCTTTCATCAATTTGCCTGTAAAAGCTTCA
ATTATTTGCCACCTCACGAGTCTCGTACGCATAGTGAATGCAGACTTCTA
ACAAAATTGGCATCAGAAGAGCCGTATAAACTAATTGCAATTACATATCC
GGGAGCACATTACAGCATGAAATCCGACTGCACCGCTGAACAGTTCAAAT
GCACTAGAGGAATGTGCATTGAGCTTTCAAAAAAATGCGATCATAGGGAT
AACTGTGGAGACAATTCAGACGAGATCGATTGCACAACAGTTACATTCCC
ACCGTTCGAGATCAGACTGACTGGCAGTGTCAACAAATACGAAGGAAAAG
TCGAAGTCCGTTATCAGGGTGAATGGGGCTTCGTTTGCGATGATGGATTT
GATATTAAAGCTGCTGAAGTTGTTTGCAAACAATTGGGATTTTTGGGTGC
CATGGAATCCATCCATTCTGCTGTAAACCGTTTCGGAAAAAATCGCTCTC
CAAATCTATTGGTCGACGAAATCAAATGCACTGGTACTGAAAATTCTTTA
GAAGAATGTAAACATAGCCCATGGAGATCACACAATTGTCGACCGGATGA
AATTGCAGGAGTTGTTTGCAAGGTTGATCGGGCATGTACAAATTCCGAGT
TCCGATGTTCCAAAGACAAGATGTGTATCAGTCTCAGTAAGGTATGCGAT
AAAACAAATGATTGTTCCGATGGTAGTGATGAGCCAGAAGGAAAATGCAC
CGTGAAAGTAACGCTTGCTGATGGACCTGACGCAAAATCGGGTCGTGTTG
AACTTAGTAGAGGTGGATTAAAGGGCACGGTTTGTGATGATGACTACGAC
GATAAAGACGCAGCCGTTATTTGCAGAATGCTTCAGATTCCAGGACGAGC
TCAGGCAATTAAAGATAAACGATTCGGAGAAGGAGCCGGAGCTATTGTTT
TGGATAATTTAAAATGTACAGGTGAAGAACTTAATTTAGAGAATTGTCCA
TTTTTTAAATGGGGAGAACATAAATGTACTCATAAAGAGGATATTGGAGT
TATTTGTGGGCTACCTGATGAAGTGGTAACTCAACCACCAAAGCCTACTG
CAAAAGTCGACCCAGCTGCCGGATTAAAATGCGGTCACAGACCAATTGTG
CACAAAAGAGGGCGAGTGGTTGGTGGATTTGAAGCTGTTTACGGAGCTTT
TCCATGGCAAGTTGGAGTAAGACAAAAAGTTGACGATTACGATTCTCATT
GGTGTGGAGCTTCTATTTTGAGTGAAGATTGGATTATTGGAGCAGCCCAT
TGCTACGCTCGACCTAAGAGCGATTATCGAGTTCGAACAGGAGATTGGGA
TAACGCTTCCGATGATAAATATGAACAAGTATTTGAAATTGAAGAGCTTA
TTCTCCATCCAAACTGGAATAATGCAAATTACGACTATGATTATGCCTTG
ATCAAAATTGAAAGAAACGATGGAGTTGGAATCAAATTCAACAATTACGT
CCAACCAGTATGTTTGCCTAAGCTAGGCATGGTGCCTGATCCAAATTCTA
AATGCCTAGTTTCGGGCTGGGGAGATACTCTTTCTACTTATCCGGAAAAA
CTGTTAGCTGCAGAAGTGCCTCTAATTAAACATGAAAGATGCTTTGAATT
TTATAAAGGCCGACTGACAGAAAGAATGCAGTGCGCTGGTTATGAAGCGG
GGGGTATTGATACTTGTCAAGGTGACAGTGGTGGACCATTGGTTTGTAAA
GTTAACGGAGTATACACGATTTTTGGAGCAACTTCATGGGGCAATGGATG
TGCTCAACCAAAAAATCCTGGTGTTTATGCCAAAATTCAAATGCAGCTTG
ACTGGATCAAGGAACAAACTGGATTGTAACTTGTAGTCCGAAAACTAAAT
GACAAATTAGTGCAATTTCATTGAATATAGAACTGTTTCCATTTTTTCAG
ACTAATCAAAATTTATTCATTGTTAGAAGAACTTTTTTTGTTTTTCACCT
CTGATTTCTTTATAAGTGACATAATATTTTCTACAAAATTTGACTATGAA
TCAGATTTATTTAAGGTATTCACGAATTTTCGGCACAGCCTTTTTCAAGT
GATTTCCGACAATTCGTGAATGCCTTAAATAAATGTCACTTATAAAGAAA
TCAGATGTGAAACACCAAAAGTCCTTATATTAGTATAAATTATCTAAGTC
ATCCATTTTGCCTTGAATATTTCTAAATAATTATCATAATAACGAAAAAT
GACCAATTATTAATAAAAACTCAATAAAGCCAAATAAAAGAAATATATTT
CGAGGAAATTATCCTCATCTTCAGTCTGCCATCATAATCTTTGTCAAATG
TTATATAGGGAAACAATTATGATGTAATAGTTACGATTTAATGATTTAAT
TAAATAATCTCAATAAATTTGTTGCTGATTGAACGTTTATTTTAGGGGAT
TGTGATTTAATCACCAACGCCTCACCTAAAATTCTTTCCCACTTATTATT
GAAGTTTTTATATAAAATTTTAAAATCTTTTAAATCAGTTGTTCCTTTGC
ACATTTTTCTATGCTCAATAATATTACTCACGCCTCTCAATCGGCTATGT
TTCTGAACCCGTGTTTGAAGATGACGGGAAGTCTCTCCAATGTATGTGGC
ATTACACCCATTACATGTAAATTGATAAACGAGATCAGAACACAATCCAA
CCGGAGTTTTTGATTTATTAATAAACATATTGCGTACCTTACACGAATTA
GAGACGATCTTATACTCTAAATTTCCTATCAGTTTACCCAACTTCCTCTT
ATAATTTGTAAAGCCTTCAGAGTACGGCAATACTAACACATATTTAGGCT
CAATTTTTTTATATCCATTTTTACCATCACCCAGATCAACACTCAATTCA
CACCCATCCGACAAATTACATTCAGACTTTCCACAACATGGATCCTTAGG
ATTTTTAATCAATTTATCAACAGTTTCTTTTATCATCAACAATAAAAATG
ATTTAGAATATCCATTCTTTATCAACAACTCAACCAATTTATCAACACTT
TTTACCGAATTAGCAAAAGTAGAAGATAAAGCCCATGAACGATAAATCAA
TCCTTTCACCATATTTCTCTTATACTTAAATTCACAAAAGCTTTCTGGAG
AAGTATAAAGACCAGTATCAGTTGGTTTTCTATAAATCTCTGTCTCATAC
TGTTTATCTTTGCGTTGAATTAACAAATCCAAAAACGCAATTGATGACTT
TCTCTCCGTTTCACATGTGAATACAATGTTTTTATGTAAACTGTTCATAA
AATGCAAAAACGGTTCTACATGTTTCTGGTTTTCAAATATAAGAAAAATA
TCATCCACATACCTTTTATAAACAAAAGGTTTTTCAAATTGGAAAGAAGC
AATTTTCTTTTCCAAACTAGCCAAAAATATTGATGCCATCGTTGGTGCTA
AAGGGGAACCCATAGCGACTCCATCTATTTGTTGATACCATTCATCATTG
AAAAGAAAATTGACATTTGAAGTAGCAAATTCAAGAAGTTTTCGAAATGC
CCTTCTATCCAAAATGTGATGTTCCGAATCATTTTCATTCCACAACGCAC
AGCATAAGTCAATCGTCTCAACCAGTGGCACATTCGTAAACAAACTACAA
ACATCAAACGAAACCATAACATCATTCATACTTCGTTTTTGTAGCTTTGC
AATACAAGAAACAAACTCAAAGCTATCCTTACATTCAAACTCTGATCGCA
TTAACGGTTTTAATAATCCATCTAAAAACTTTGCTATTTTATACTGGGCA
GTACCAACCATCGACAAAACTGGTCTCATAGGTACACCATCTTTATGGAT
TTTTGGTAGCCCATATAGTTTAGCTGGCTGCGATCCTATTGGACGAATAG
ACTTACCTACCTCTTCATCAATAAGCTTCTTCTCAATAAAACCATTTAAC
ATTTTTTGCACAAACTCTTCATCCTTAAGAGGAGGCAATTTTCCATTCTT
CCGACCCTTTGGCAATTTCACAAACTGAGGAGAATTTAACAAATCATTCA
ACTTATTTACATACACATCATGGTCAAGAATAACTATCCCATTTCCTTTG
TCAAACTTACAGATATTTATATTTTTTTTAGCTAAGTTTTTTAAAGTCAT
AAAATCCCTAATATTCTGCTTTTTGTTTTTATCGATATACTCCATCGTAC
TTGCACTTAACGAGCTCTTCACATAATTACCATTAATGCCTTTCATCGAT
CGGGCTATATGAAAATATAAACTTTCAATTTTTGCACACAATTTTGTTTC
ATCCAAGCGATTCTTAATACAGTGATTTGGACCAAATTTTAAAACACGCT
CTTCATCATCATTCAACACTATTTTACTCAAATTTATCACAGTATTCTCC
ACACTAAATTTAGAAATCCCAAATATTTTTCTCAAATTAATCAATTTTTT
AATATGAGCATCCTCTTTAGATTTTATTTGCACAATCGAATTTTTGATAC
ACCATTCTACACATACCTGTAAACAAAACTCATTCGTAGCATTATTTAAC
ATTAATCCAATATTTGTTAGTTTTTTATCAATGGAAGTTCTCCTTATTTT
TTCTGATTCCAACATTCTTCTTAACGTTCTTCTCTGTATTAACAAGTCTC
AAGAAAACTAATGTCTAGTTCCTTTCTTTTGAGGGAGTTATAAACCTTCA
TAAACCTTTTGAATATTGGAACAGCTGCAGCATGATTTATAAATAAATAA
TTAAATAAATTTGGCAACGATTTAATTAAAAGATAACGCCAATAAAAAAC
CTTTCGTACGATATATTTCGATAGCACAGCTATCATCTTCAGGTACTCAA
AACCAACTAAAAATATTATGAATTAACTTATAATTTAAACAAATTATTTT
TTTATATTAATTTAATTTGTTATTGCTGGTGAAATTTCACAGACAGAAAT
GCACAGCGCTTTATAATCAATATTTTATCTCTGGGTATTGTCTTATTCCG
GAGTTTTTCCATTGCGCACTATACCAAGTGCACTCATAATAGATATCTAT
TGAGATATCTGAGCCCGGGGGTGTAATTGTCATGAATCGATATTGGTATC
AATGCTAATGCCTGGACACAATCTATAGTTATAAAATGTTATAAACACCG
ATATGAATATTGATGTCATCATTTGATCTAGTTTCAATGCTGTGGGGTAA
ATGG
back to top

protein sequence of SMED30032823-orf-1

>SMED30032823-orf-1 ID=SMED30032823-orf-1|Name=SMED30032823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1205bp
MKLAVLAFCLVLTTNAAIIKSQYDKYDHFFQPSLTRHKRQAVSEDETTFF
DQNIPPLTGTGRSNTRFPMRKVRDGAPESPQIIRLRGENALTANEGRVEV
YDSNSKLWGLVCDDYWNILDANVTCRQLGFRRKAREATRQDRYGRGDWSV
NDYTVHKIQCTGNEKSLVDCPHDSTSYCSGKSAGVSCVYNLGCPNGWISF
NGACYQINTQQMDYKQADKFCQDHNSKLAFILKAKENNFISNVLYTQYKS
IAQIWTGGYYAEVKLDEGRSEFRWNWYSTIHNVDQWSTSNLWFPGFYETK
TDKRPQGDPKTQSCVALNRAFADSQRQNTVYDVNYFWWDNLSCNEKLPFI
CQMNIPQSRSDCYEDNGLDYRGRISRTVQGSSCAKWTDPAATVNPQTNPE
AGLGDHNFCRNPDNDLQPWCWTNPTNGVYGYCAIGKCSELPPPTATLKPQ
VTDPMGFGQGGCQSIQYHCPSMISYNRQCIPKNEVCDKIPHCLGKEDEDH
GFCKKYLCKENEFFCASDMFCILKTHVCDGKRNCADGSDEKNCTVLDESA
LLKVYDKTDSKILDVSDKLDYIDIPIDKCAEKCKILFHQFACKSFNYLPP
HESRTHSECRLLTKLASEEPYKLIAITYPGAHYSMKSDCTAEQFKCTRGM
CIELSKKCDHRDNCGDNSDEIDCTTVTFPPFEIRLTGSVNKYEGKVEVRY
QGEWGFVCDDGFDIKAAEVVCKQLGFLGAMESIHSAVNRFGKNRSPNLLV
DEIKCTGTENSLEECKHSPWRSHNCRPDEIAGVVCKVDRACTNSEFRCSK
DKMCISLSKVCDKTNDCSDGSDEPEGKCTVKVTLADGPDAKSGRVELSRG
GLKGTVCDDDYDDKDAAVICRMLQIPGRAQAIKDKRFGEGAGAIVLDNLK
CTGEELNLENCPFFKWGEHKCTHKEDIGVICGLPDEVVTQPPKPTAKVDP
AAGLKCGHRPIVHKRGRVVGGFEAVYGAFPWQVGVRQKVDDYDSHWCGAS
ILSEDWIIGAAHCYARPKSDYRVRTGDWDNASDDKYEQVFEIEELILHPN
WNNANYDYDYALIKIERNDGVGIKFNNYVQPVCLPKLGMVPDPNSKCLVS
GWGDTLSTYPEKLLAAEVPLIKHERCFEFYKGRLTERMQCAGYEAGGIDT
CQGDSGGPLVCKVNGVYTIFGATSWGNGCAQPKNPGVYAKIQMQLDWIKE
QTGL*
back to top

protein sequence of SMED30032823-orf-2

>SMED30032823-orf-2 ID=SMED30032823-orf-2|Name=SMED30032823-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=740bp
MLESEKIRRTSIDKKLTNIGLMLNNATNEFCLQVCVEWCIKNSIVQIKSK
EDAHIKKLINLRKIFGISKFSVENTVINLSKIVLNDDEERVLKFGPNHCI
KNRLDETKLCAKIESLYFHIARSMKGINGNYVKSSLSASTMEYIDKNKKQ
NIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVK
LPKGRKNGKLPPLKDEEFVQKMLNGFIEKKLIDEEVGKSIRPIGSQPAKL
YGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFE
FVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVETIDLCCALWNENDSEHH
ILDRRAFRKLLEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLAS
LEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFT
CETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFKYKR
NMVKGLIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVD
KLIKNPKDPCCGKSECNLSDGCELSVDLGDGKNGYKKIEPKYVLVLPYSE
GFTNYKRKLGKLIGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFT
CNGCNATYIGETSRHLQTRVQKHSRLRGVSNIIEHRKMCKGTTDLKDFKI
LYKNFNNKWERILGEALVIKSQSPKINVQSATNLLRLFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0006508proteolysis
GO:0006030chitin metabolic process
GO:0006898receptor-mediated endocytosis
Vocabulary: molecular function
TermDefinition
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
GO:0005515protein binding
GO:0005044scavenger receptor activity
GO:0004252serine-type endopeptidase activity
GO:0008061chitin binding
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002172LDrepeatLR_classA_rpt
IPR001190SRCR
IPR000001Kringle
IPR017448SRCR-like_dom
IPR001304C-type_lectin-like
IPR001254Trypsin_dom
IPR016186C-type_lectin-like/link_sf
IPR023415LDLR_class-A_CS
IPR018056Kringle_CS
IPR033116TRYPSIN_SER
IPR009003Peptidase_S1_PA
IPR013806Kringle-like
IPR016187CTDL_fold
IPR000477RT_dom
IPR000305GIY-YIG_endonuc
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005576extracellular region