Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30032813
Length (bp)256
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032813SMESG000003163.1 SmedASXL_014583SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30032813SMESG000003163.1 dd_Smed_v4_18341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032813SMESG000003163.1 dd_Smed_v6_18341_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:1097])

HSP 1 Score: 90.1225 bits (222), Expect = 9.684e-25
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  443 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 501          

HSP 2 Score: 40.4318 bits (93), Expect = 9.684e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  505 LRKTRHVNILLFMGYSTKPQLA 526          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:1097])

HSP 1 Score: 90.5077 bits (223), Expect = 1.025e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  483 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 541          

HSP 2 Score: 40.4318 bits (93), Expect = 1.025e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  545 LRKTRHVNILLFMGYSTKPQLA 566          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:1097])

HSP 1 Score: 90.1225 bits (222), Expect = 1.033e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  483 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 541          

HSP 2 Score: 40.4318 bits (93), Expect = 1.033e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  545 LRKTRHVNILLFMGYSTKPQLA 566          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:1097])

HSP 1 Score: 90.1225 bits (222), Expect = 1.096e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  443 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 501          

HSP 2 Score: 40.4318 bits (93), Expect = 1.096e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  505 LRKTRHVNILLFMGYSTKPQLA 526          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:1097])

HSP 1 Score: 90.1225 bits (222), Expect = 1.326e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  142 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 200          

HSP 2 Score: 40.0466 bits (92), Expect = 1.326e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  204 LRKTRHVNILLFMGYSTKPQLA 225          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: lin-45 (Raf homolog serine/threonine-protein kinase [Source:UniProtKB/Swiss-Prot;Acc:Q07292])

HSP 1 Score: 63.929 bits (154), Expect = 1.472e-15
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++  +E+WEI   E     ++GSGSFGTV++G + G VAIK+LNV  P P Q  AFKNE
Sbjct:  492 QKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNE 550          

HSP 2 Score: 34.2686 bits (77), Expect = 1.472e-15
Identity = 11/26 (42.31%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ ++KTRH+N+L FMG++  P +A
Sbjct:  550 EVAVLKKTRHLNVLLFMGWVREPEIA 575          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: lin-45 (Raf homolog serine/threonine-protein kinase [Source:UniProtKB/Swiss-Prot;Acc:Q07292])

HSP 1 Score: 63.929 bits (154), Expect = 1.487e-15
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++  +E+WEI   E     ++GSGSFGTV++G + G VAIK+LNV  P P Q  AFKNE
Sbjct:  435 QKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNE 493          

HSP 2 Score: 34.2686 bits (77), Expect = 1.487e-15
Identity = 11/26 (42.31%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ ++KTRH+N+L FMG++  P +A
Sbjct:  493 EVAVLKKTRHLNVLLFMGWVREPEIA 518          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: lin-45 (Raf homolog serine/threonine-protein kinase [Source:UniProtKB/Swiss-Prot;Acc:Q07292])

HSP 1 Score: 63.929 bits (154), Expect = 1.496e-15
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++  +E+WEI   E     ++GSGSFGTV++G + G VAIK+LNV  P P Q  AFKNE
Sbjct:  509 QKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNE 567          

HSP 2 Score: 34.2686 bits (77), Expect = 1.496e-15
Identity = 11/26 (42.31%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ ++KTRH+N+L FMG++  P +A
Sbjct:  567 EVAVLKKTRHLNVLLFMGWVREPEIA 592          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: lin-45 (Raf homolog serine/threonine-protein kinase [Source:UniProtKB/Swiss-Prot;Acc:Q07292])

HSP 1 Score: 63.929 bits (154), Expect = 1.510e-15
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++  +E+WEI   E     ++GSGSFGTV++G + G VAIK+LNV  P P Q  AFKNE
Sbjct:  467 QKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNE 525          

HSP 2 Score: 34.2686 bits (77), Expect = 1.510e-15
Identity = 11/26 (42.31%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ ++KTRH+N+L FMG++  P +A
Sbjct:  525 EVAVLKKTRHLNVLLFMGWVREPEIA 550          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: lin-45 (Raf homolog serine/threonine-protein kinase [Source:UniProtKB/Swiss-Prot;Acc:Q07292])

HSP 1 Score: 63.929 bits (154), Expect = 1.510e-15
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++  +E+WEI   E     ++GSGSFGTV++G + G VAIK+LNV  P P Q  AFKNE
Sbjct:  452 QKPHHEDWEILPNEFIIQYKVGSGSFGTVYRGEFFGTVAIKKLNVVDPTPSQMAAFKNE 510          

HSP 2 Score: 34.2686 bits (77), Expect = 1.510e-15
Identity = 11/26 (42.31%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ ++KTRH+N+L FMG++  P +A
Sbjct:  510 EVAVLKKTRHLNVLLFMGWVREPEIA 535          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Raf (gene:FBgn0003079 transcript:FBtr0070401)

HSP 1 Score: 81.6481 bits (200), Expect = 1.311e-19
Identity = 35/62 (56.45%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   10 LEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            L   + S E W I  +E+  GPRIGSGSFGTV++ +WHG VA+K LNV  P+P Q +AFKNE
Sbjct:  412 LRDAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNE 473          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Raf (gene:FBgn0003079 transcript:FBtr0344007)

HSP 1 Score: 81.6481 bits (200), Expect = 1.311e-19
Identity = 35/62 (56.45%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   10 LEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            L   + S E W I  +E+  GPRIGSGSFGTV++ +WHG VA+K LNV  P+P Q +AFKNE
Sbjct:  412 LRDAKSSEENWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNE 473          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: ksr (gene:FBgn0015402 transcript:FBtr0078766)

HSP 1 Score: 49.6766 bits (117), Expect = 2.857e-8
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1
Query:    4 GQLEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQY-KAFKNE 195
            GQ  +   S +EW+I   ++    RIG G FGTV +  WHG+VA+K LN  Y   E   + F++E
Sbjct:  660 GQWRQNSISLKEWDIPYGDLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSE 724          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: ksr (gene:FBgn0015402 transcript:FBtr0344273)

HSP 1 Score: 49.6766 bits (117), Expect = 2.857e-8
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1
Query:    4 GQLEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQY-KAFKNE 195
            GQ  +   S +EW+I   ++    RIG G FGTV +  WHG+VA+K LN  Y   E   + F++E
Sbjct:  660 GQWRQNSISLKEWDIPYGDLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSE 724          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: ksr (gene:FBgn0015402 transcript:FBtr0344272)

HSP 1 Score: 49.6766 bits (117), Expect = 2.857e-8
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 1
Query:    4 GQLEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQY-KAFKNE 195
            GQ  +   S +EW+I   ++    RIG G FGTV +  WHG+VA+K LN  Y   E   + F++E
Sbjct:  660 GQWRQNSISLKEWDIPYGDLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSE 724          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040805-1])

HSP 1 Score: 91.6633 bits (226), Expect = 1.544e-25
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  493 RRDSSDDWEIPEGQITLGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 551          

HSP 2 Score: 41.2022 bits (95), Expect = 1.544e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  555 LRKTRHVNILLFMGYTTKPQLA 576          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040805-1])

HSP 1 Score: 91.6633 bits (226), Expect = 1.610e-25
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  453 RRDSSDDWEIPEGQITLGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 511          

HSP 2 Score: 41.2022 bits (95), Expect = 1.610e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  515 LRKTRHVNILLFMGYTTKPQLA 536          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: araf (A-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-050102-2])

HSP 1 Score: 81.6481 bits (200), Expect = 1.767e-21
Identity = 37/58 (63.79%), Postives = 45/58 (77.59%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS+  WE+  +EV+   RIG+GSFGTVFKG WHG+VAIK L V+ P PEQ +AFKNE
Sbjct:  299 RDSSYYWEVHPREVSMLKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNE 356          

HSP 2 Score: 37.3502 bits (85), Expect = 1.767e-21
Identity = 14/26 (53.85%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++  +RKTRHVNIL FMG+++ P  A
Sbjct:  356 EMQVLRKTRHVNILLFMGFMTRPNFA 381          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: araf (A-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-050102-2])

HSP 1 Score: 81.6481 bits (200), Expect = 1.782e-21
Identity = 37/58 (63.79%), Postives = 45/58 (77.59%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS+  WE+  +EV+   RIG+GSFGTVFKG WHG+VAIK L V+ P PEQ +AFKNE
Sbjct:  295 RDSSYYWEVHPREVSMLKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNE 352          

HSP 2 Score: 37.3502 bits (85), Expect = 1.782e-21
Identity = 14/26 (53.85%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++  +RKTRHVNIL FMG+++ P  A
Sbjct:  352 EMQVLRKTRHVNILLFMGFMTRPNFA 377          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: raf1a (Raf-1 proto-oncogene, serine/threonine kinase a [Source:ZFIN;Acc:ZDB-GENE-990415-41])

HSP 1 Score: 80.8777 bits (198), Expect = 6.099e-21
Identity = 36/59 (61.02%), Postives = 44/59 (74.58%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +RDS+  WEI   EV    RIGSGSFGTV KG WHG+VA+K L V+ P PEQ++AF+NE
Sbjct:  342 KRDSSYYWEIEANEVVLLSRIGSGSFGTVHKGKWHGDVAVKVLKVTNPTPEQFQAFRNE 400          

HSP 2 Score: 36.5798 bits (83), Expect = 6.099e-21
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  400 EVAVLRKTRHVNILLFMGYMTKGNLA 425          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:779570])

HSP 1 Score: 93.2041 bits (230), Expect = 7.501e-25
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  250 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 308          

HSP 2 Score: 37.7354 bits (86), Expect = 7.501e-25
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRL 253
            +RKTRHVNIL FMGY + P+L
Sbjct:  312 LRKTRHVNILLFMGYSTKPQL 332          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:779570])

HSP 1 Score: 92.8189 bits (229), Expect = 8.535e-25
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  324 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 382          

HSP 2 Score: 38.1206 bits (87), Expect = 8.535e-25
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRL 253
            +RKTRHVNIL FMGY + P+L
Sbjct:  386 LRKTRHVNILLFMGYSTKPQL 406          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:779570])

HSP 1 Score: 91.2781 bits (225), Expect = 1.489e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  460 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 518          

HSP 2 Score: 38.891 bits (89), Expect = 1.489e-24
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRL 253
            +RKTRHVNIL FMGY + P+L
Sbjct:  522 LRKTRHVNILLFMGYSTKPQL 542          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:779570])

HSP 1 Score: 91.6633 bits (226), Expect = 1.503e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  418 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 476          

HSP 2 Score: 38.1206 bits (87), Expect = 1.503e-24
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRL 253
            +RKTRHVNIL FMGY + P+L
Sbjct:  480 LRKTRHVNILLFMGYSTKPQL 500          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: BRAF (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:779570])

HSP 1 Score: 90.8929 bits (224), Expect = 1.971e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  435 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 493          

HSP 2 Score: 38.891 bits (89), Expect = 1.971e-24
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRL 253
            +RKTRHVNIL FMGY + P+L
Sbjct:  497 LRKTRHVNILLFMGYSTKPQL 517          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Braf (Braf transforming gene [Source:MGI Symbol;Acc:MGI:88190])

HSP 1 Score: 90.1225 bits (222), Expect = 6.497e-25
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  427 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 485          

HSP 2 Score: 40.4318 bits (93), Expect = 6.497e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  489 LRKTRHVNILLFMGYSTKPQLA 510          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Braf (Braf transforming gene [Source:MGI Symbol;Acc:MGI:88190])

HSP 1 Score: 90.1225 bits (222), Expect = 7.283e-25
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  480 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 538          

HSP 2 Score: 40.4318 bits (93), Expect = 7.283e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  542 LRKTRHVNILLFMGYSTKPQLA 563          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Raf1 (v-raf-leukemia viral oncogene 1 [Source:MGI Symbol;Acc:MGI:97847])

HSP 1 Score: 79.337 bits (194), Expect = 1.682e-20
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +RDS+  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V  P PEQ +AF+NE
Sbjct:  335 QRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNE 393          

HSP 2 Score: 36.5798 bits (83), Expect = 1.682e-20
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  393 EVAVLRKTRHVNILLFMGYMTKDNLA 418          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Raf1 (v-raf-leukemia viral oncogene 1 [Source:MGI Symbol;Acc:MGI:97847])

HSP 1 Score: 79.337 bits (194), Expect = 1.682e-20
Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +RDS+  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V  P PEQ +AF+NE
Sbjct:  335 QRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNE 393          

HSP 2 Score: 36.5798 bits (83), Expect = 1.682e-20
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  393 EVAVLRKTRHVNILLFMGYMTKDNLA 418          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Araf (Araf proto-oncogene, serine/threonine kinase [Source:MGI Symbol;Acc:MGI:88065])

HSP 1 Score: 75.485 bits (184), Expect = 2.719e-19
Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS   WE+   EV    RIG+GSFGTVF+G WHG+VA+K L V+ P  EQ +AFKNE
Sbjct:  295 RDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNE 352          

HSP 2 Score: 36.5798 bits (83), Expect = 2.719e-19
Identity = 14/26 (53.85%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++  +RKTRHVNIL FMG+++ P  A
Sbjct:  352 EMQVLRKTRHVNILLFMGFMTRPGFA 377          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P27966|RMIL_AVEVR (Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 OX=11950 GN=V-RMIL PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.940e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:   69 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 127          

HSP 2 Score: 40.4318 bits (93), Expect = 3.940e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  131 LRKTRHVNILLFMGYSTKPQLA 152          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P15056|BRAF_HUMAN (Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4)

HSP 1 Score: 90.1225 bits (222), Expect = 4.607e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  443 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 501          

HSP 2 Score: 40.4318 bits (93), Expect = 4.607e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  505 LRKTRHVNILLFMGYSTKPQLA 526          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P28028|BRAF_MOUSE (Serine/threonine-protein kinase B-raf OS=Mus musculus OX=10090 GN=Braf PE=1 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 4.957e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  480 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 538          

HSP 2 Score: 40.4318 bits (93), Expect = 4.957e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  542 LRKTRHVNILLFMGYSTKPQLA 563          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q04982|BRAF_CHICK (Serine/threonine-protein kinase B-raf OS=Gallus gallus OX=9031 GN=BRAF PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 5.701e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  483 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 541          

HSP 2 Score: 40.4318 bits (93), Expect = 5.701e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  545 LRKTRHVNILLFMGYSTKPQLA 566          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P34908|BRAF_COTJA (Serine/threonine-protein kinase B-raf OS=Coturnix japonica OX=93934 GN=BRAF PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.941e-24
Identity = 38/59 (64.41%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI + ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  483 RRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 541          

HSP 2 Score: 40.4318 bits (93), Expect = 5.941e-24
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  545 LRKTRHVNILLFMGYSTKPQLA 566          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A2H1C707 (Protein kinase domain-containing protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_09722 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.799e-28
Identity = 48/59 (81.36%), Postives = 53/59 (89.83%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            R+DSNEEWEI   E+TKGPRIGSGSFGTVFKGYWHG+VAIKELNV+ P P+Q KAFKNE
Sbjct:    1 RKDSNEEWEIPSSEITKGPRIGSGSFGTVFKGYWHGDVAIKELNVTDPTPQQLKAFKNE 59          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A3P8HFH2 (Protein kinase domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS19979 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.810e-28
Identity = 48/62 (77.42%), Postives = 55/62 (88.71%), Query Frame = 1
Query:   10 LEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++ RR SN+EWEI+ +E+TKGPRIGSGSFGTVFKGYWHGNVAIKELNV  P P+Q KAFKNE
Sbjct:   12 IDMRRGSNDEWEINGQEITKGPRIGSGSFGTVFKGYWHGNVAIKELNVVDPTPQQLKAFKNE 73          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A183Q043 (Protein kinase domain-containing protein OS=Schistosoma mattheei OX=31246 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 5.367e-28
Identity = 48/62 (77.42%), Postives = 55/62 (88.71%), Query Frame = 1
Query:   10 LEKRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++ RR SN+EWEI+ +E+TKGPRIGSGSFGTVFKGYWHGNVAIKELNV  P P+Q KAFKNE
Sbjct:   12 IDMRRGSNDEWEINGQEITKGPRIGSGSFGTVFKGYWHGNVAIKELNVVDPTPQQLKAFKNE 73          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2LQ94 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005622 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.398e-27
Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEI   E+TKGPRIGSGSFGTVFKGYWHGNVAIKELNV+ PNP+Q +AFKNE
Sbjct:  448 RRDSNEEWEIPTAEITKGPRIGSGSFGTVFKGYWHGNVAIKELNVTNPNPQQLEAFKNE 506          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G7YGF3 (Serine/threonine-protein kinase-transforming protein Rmil OS=Clonorchis sinensis OX=79923 GN=CLF_107251 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.398e-27
Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEI   E+TKGPRIGSGSFGTVFKGYWHGNVAIKELNV+ PNP+Q +AFKNE
Sbjct:  448 RRDSNEEWEIPTAEITKGPRIGSGSFGTVFKGYWHGNVAIKELNVTNPNPQQLEAFKNE 506          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040805-1])

HSP 1 Score: 92.0485 bits (227), Expect = 9.126e-26
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  452 RRDSSDDWEIPEGQITLGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE 510          

HSP 2 Score: 41.2022 bits (95), Expect = 9.126e-26
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  514 LRKTRHVNILLFMGYTTKPQLA 535          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: raf1a (Raf-1 proto-oncogene, serine/threonine kinase a [Source:ZFIN;Acc:ZDB-GENE-990415-41])

HSP 1 Score: 83.9593 bits (206), Expect = 6.429e-22
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +RDSN  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V+ P PEQ++AF+NE
Sbjct:  330 KRDSNYYWEIEASEVVLHSRIGSGSFGTVYKGKWHGDVAVKILKVTDPTPEQFQAFRNE 388          

HSP 2 Score: 36.1946 bits (82), Expect = 6.429e-22
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  388 EVAVLRKTRHVNILLFMGYMTKDNLA 413          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: araf (A-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043654])

HSP 1 Score: 81.6481 bits (200), Expect = 1.500e-21
Identity = 36/58 (62.07%), Postives = 44/58 (75.86%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS+  WE+  +EV    RIGSGSFGTV+KG WHG+VAIK L V+ P PEQ +AF+NE
Sbjct:  298 RDSSYYWEVHSREVNMQKRIGSGSFGTVYKGKWHGDVAIKILKVTEPTPEQLQAFRNE 355          

HSP 2 Score: 37.3502 bits (85), Expect = 1.500e-21
Identity = 14/26 (53.85%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++  +RKTRHVNIL FMG+++ P  A
Sbjct:  355 EMQVLRKTRHVNILLFMGFMTKPHFA 380          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: raf1b (RAF proto-oncogene serine/threonine-protein kinase [Source:NCBI gene;Acc:103027930])

HSP 1 Score: 82.8037 bits (203), Expect = 1.724e-21
Identity = 36/60 (60.00%), Postives = 46/60 (76.67%), Query Frame = 1
Query:   16 KRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++RDS+  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V+ P PEQ++AF+NE
Sbjct:  312 EKRDSSYYWEIDASEVVLHSRIGSGSFGTVYKGKWHGDVAVKILKVTDPTPEQFQAFRNE 371          

HSP 2 Score: 36.1946 bits (82), Expect = 1.724e-21
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  371 EVAVLRKTRHVNILLFMGYMTKDNLA 396          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: raf1b (RAF proto-oncogene serine/threonine-protein kinase [Source:NCBI gene;Acc:103027930])

HSP 1 Score: 82.4185 bits (202), Expect = 1.917e-21
Identity = 36/60 (60.00%), Postives = 46/60 (76.67%), Query Frame = 1
Query:   16 KRRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            ++RDS+  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V+ P PEQ++AF+NE
Sbjct:  323 EKRDSSYYWEIDASEVVLHSRIGSGSFGTVYKGKWHGDVAVKILKVTDPTPEQFQAFRNE 382          

HSP 2 Score: 36.5798 bits (83), Expect = 1.917e-21
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  382 EVAVLRKTRHVNILLFMGYMTKDNLA 407          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-040805-1])

HSP 1 Score: 92.0485 bits (227), Expect = 1.778e-26
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTV+KG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  462 RRDSSDDWEIPEGQITAGQRIGSGSFGTVYKGKWHGDVAVKMLNVTDPTPQQLQAFKNE 520          

HSP 2 Score: 41.2022 bits (95), Expect = 1.778e-26
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  524 LRKTRHVNILLFMGYTTKPQLA 545          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009961.1 (pep scaffold:Pmarinus_7.0:GL485736:601:10038:-1 gene:ENSPMAG00000008997.1 transcript:ENSPMAT00000009961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 1.037e-24
Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS+  WE+ E+EVT   RIGSGSFGTV+KG WHG+VA+K L V+ P P+Q +AFKNE
Sbjct:  314 RDSSYYWEVKEEEVTLVKRIGSGSFGTVYKGKWHGDVAVKILKVTGPTPQQLEAFKNE 371          

HSP 2 Score: 43.5134 bits (101), Expect = 1.037e-24
Identity = 17/26 (65.38%), Postives = 23/26 (88.46%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++ PRLA
Sbjct:  371 EVAVLRKTRHVNILLFMGYMTQPRLA 396          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006323.1 (pep scaffold:Pmarinus_7.0:GL480385:15686:21285:-1 gene:ENSPMAG00000005719.1 transcript:ENSPMAT00000006323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.400e-8
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 1
Query:   34 EEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +EW+I  +++     IG G FG V++G WHG VAI+ + +   N    K FK E
Sbjct:    9 QEWDIPYEQLAVDELIGRGRFGKVYRGRWHGQVAIRLIEMERDNEAFVKLFKRE 62          

HSP 2 Score: 25.7942 bits (55), Expect = 1.400e-8
Identity = 9/18 (50.00%), Postives = 12/18 (66.67%), Query Frame = 2
Query:  194 RKTRHVNILFFMGYISTP 247
            R+TRH N++ FMG    P
Sbjct:   67 RQTRHENVVLFMGACMNP 84          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO47089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN75])

HSP 1 Score: 88.1965 bits (217), Expect = 3.675e-24
Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            R +S ++WEI E EV  GPRIGSGS+GTV+KG WHG VAIK LNV+ P P Q +AFKNE
Sbjct:  421 RANSTDDWEILEGEVQMGPRIGSGSYGTVYKGNWHGAVAIKTLNVTDPTPTQLQAFKNE 479          

HSP 2 Score: 38.1206 bits (87), Expect = 3.675e-24
Identity = 15/26 (57.69%), Postives = 22/26 (84.62%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVN+L FMG +S P+LA
Sbjct:  479 EVAVLRKTRHVNVLLFMGCMSKPKLA 504          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO47467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM99])

HSP 1 Score: 49.2914 bits (116), Expect = 1.146e-8
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:   37 EWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFK 189
            EW +  +E+     +GSG FG V++G WHG VA+K + +  P  EQ  AFK
Sbjct:    3 EWVVPFEEIEIFDVLGSGRFGKVYRGRWHGEVAVKMIEIDNPTEEQLNAFK 53          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101155814])

HSP 1 Score: 92.4337 bits (228), Expect = 8.316e-26
Identity = 40/59 (67.80%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTVFKG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  412 RRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKWHGDVAVKMLNVTDPTPQQLQAFKNE 470          

HSP 2 Score: 41.2022 bits (95), Expect = 8.316e-26
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  474 LRKTRHVNILLFMGYTTKPQLA 495          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101155814])

HSP 1 Score: 92.0485 bits (227), Expect = 9.254e-26
Identity = 40/59 (67.80%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTVFKG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  457 RRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKWHGDVAVKMLNVTDPTPQQLQAFKNE 515          

HSP 2 Score: 41.2022 bits (95), Expect = 9.254e-26
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  519 LRKTRHVNILLFMGYTTKPQLA 540          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: braf (B-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101155814])

HSP 1 Score: 92.0485 bits (227), Expect = 1.046e-25
Identity = 40/59 (67.80%), Postives = 50/59 (84.75%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDS+++WEI E ++T G RIGSGSFGTVFKG WHG+VA+K LNV+ P P+Q +AFKNE
Sbjct:  457 RRDSSDDWEIPEGQITLGQRIGSGSFGTVFKGKWHGDVAVKMLNVTDPTPQQLQAFKNE 515          

HSP 2 Score: 41.2022 bits (95), Expect = 1.046e-25
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGY + P+LA
Sbjct:  519 LRKTRHVNILLFMGYTTKPQLA 540          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: araf (A-Raf proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101159594])

HSP 1 Score: 79.7221 bits (195), Expect = 2.551e-21
Identity = 36/58 (62.07%), Postives = 43/58 (74.14%), Query Frame = 1
Query:   22 RDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RDS+  WE+  +EV    RIG+GSFGTV+KG WHG+VAIK L V  P PEQ +AFKNE
Sbjct:  296 RDSSYYWEVHSREVQIQKRIGTGSFGTVYKGKWHGDVAIKILKVKEPTPEQLQAFKNE 353          

HSP 2 Score: 38.5058 bits (88), Expect = 2.551e-21
Identity = 15/26 (57.69%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++  +RKTRHVNIL FMGY++ P  A
Sbjct:  353 EMQVLRKTRHVNILLFMGYMTKPNFA 378          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: raf1a (Raf-1 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101173784])

HSP 1 Score: 80.4925 bits (197), Expect = 4.692e-21
Identity = 36/59 (61.02%), Postives = 44/59 (74.58%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            +RDS+  WEI   EV    RIGSGSFGTV+KG WHG+VA+K L V+ P PEQ +AF+NE
Sbjct:  242 KRDSSYYWEIEASEVYLHSRIGSGSFGTVYKGKWHGDVAVKILKVTDPTPEQLQAFRNE 300          

HSP 2 Score: 36.5798 bits (83), Expect = 4.692e-21
Identity = 15/26 (57.69%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            +++ +RKTRHVNIL FMGY++   LA
Sbjct:  300 EVAVLRKTRHVNILLFMGYMTKDNLA 325          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000003163.1 (SMESG000003163.1)

HSP 1 Score: 129.798 bits (325), Expect = 4.665e-38
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE
Sbjct:  643 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 701          

HSP 2 Score: 44.2838 bits (103), Expect = 4.665e-38
Identity = 19/22 (86.36%), Postives = 20/22 (90.91%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGYIS PRLA
Sbjct:  705 LRKTRHVNILLFMGYISKPRLA 726          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000003163.1 (SMESG000003163.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.031e-37
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE
Sbjct:  661 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 719          

HSP 2 Score: 44.2838 bits (103), Expect = 1.031e-37
Identity = 19/22 (86.36%), Postives = 20/22 (90.91%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGYIS PRLA
Sbjct:  723 LRKTRHVNILLFMGYISKPRLA 744          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000003163.1 (SMESG000003163.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.048e-37
Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE
Sbjct:  659 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 717          

HSP 2 Score: 44.669 bits (104), Expect = 1.048e-37
Identity = 19/22 (86.36%), Postives = 20/22 (90.91%), Query Frame = 2
Query:  191 MRKTRHVNILFFMGYISTPRLA 256
            +RKTRHVNIL FMGYIS PRLA
Sbjct:  721 LRKTRHVNILLFMGYISKPRLA 742          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000018974.1 (SMESG000018974.1)

HSP 1 Score: 107.842 bits (268), Expect = 2.133e-30
Identity = 49/59 (83.05%), Postives = 52/59 (88.14%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEI E ++T+G RIGSGSFGTVFKGYWHGNVAIKELNVS P P Q KAFKNE
Sbjct:  692 RRDSNEEWEILESDITRGSRIGSGSFGTVFKGYWHGNVAIKELNVSEPTPLQLKAFKNE 750          

HSP 2 Score: 40.4318 bits (93), Expect = 2.133e-30
Identity = 18/26 (69.23%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++S +RKTRHVNIL FMG I  PRLA
Sbjct:  750 EVSMLRKTRHVNILLFMGCIYVPRLA 775          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000018974.1 (SMESG000018974.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.343e-30
Identity = 49/59 (83.05%), Postives = 52/59 (88.14%), Query Frame = 1
Query:   19 RRDSNEEWEISEKEVTKGPRIGSGSFGTVFKGYWHGNVAIKELNVSYPNPEQYKAFKNE 195
            RRDSNEEWEI E ++T+G RIGSGSFGTVFKGYWHGNVAIKELNVS P P Q KAFKNE
Sbjct:  406 RRDSNEEWEILESDITRGSRIGSGSFGTVFKGYWHGNVAIKELNVSEPTPLQLKAFKNE 464          

HSP 2 Score: 40.817 bits (94), Expect = 3.343e-30
Identity = 18/26 (69.23%), Postives = 21/26 (80.77%), Query Frame = 2
Query:  179 KLSKMRKTRHVNILFFMGYISTPRLA 256
            ++S +RKTRHVNIL FMG I  PRLA
Sbjct:  464 EVSMLRKTRHVNILLFMGCIYVPRLA 489          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRAF9.684e-2564.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.025e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.033e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.096e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.326e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-451.472e-1550.85Raf homolog serine/threonine-protein kinase [Sour... [more]
lin-451.487e-1550.85Raf homolog serine/threonine-protein kinase [Sour... [more]
lin-451.496e-1550.85Raf homolog serine/threonine-protein kinase [Sour... [more]
lin-451.510e-1550.85Raf homolog serine/threonine-protein kinase [Sour... [more]
lin-451.510e-1550.85Raf homolog serine/threonine-protein kinase [Sour... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Raf1.311e-1956.45gene:FBgn0003079 transcript:FBtr0070401[more]
Raf1.311e-1956.45gene:FBgn0003079 transcript:FBtr0344007[more]
ksr2.857e-840.00gene:FBgn0015402 transcript:FBtr0078766[more]
ksr2.857e-840.00gene:FBgn0015402 transcript:FBtr0344273[more]
ksr2.857e-840.00gene:FBgn0015402 transcript:FBtr0344272[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
braf1.544e-2566.10B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf1.610e-2566.10B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
araf1.767e-2163.79A-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
araf1.782e-2163.79A-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
raf1a6.099e-2161.02Raf-1 proto-oncogene, serine/threonine kinase a [S... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRAF7.501e-2564.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF8.535e-2564.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.489e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.503e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
BRAF1.971e-2464.41B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Braf6.497e-2564.41Braf transforming gene [Source:MGI Symbol;Acc:MGI:... [more]
Braf7.283e-2564.41Braf transforming gene [Source:MGI Symbol;Acc:MGI:... [more]
Raf11.682e-2061.02v-raf-leukemia viral oncogene 1 [Source:MGI Symbol... [more]
Raf11.682e-2061.02v-raf-leukemia viral oncogene 1 [Source:MGI Symbol... [more]
Araf2.719e-1958.62Araf proto-oncogene, serine/threonine kinase [Sour... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27966|RMIL_AVEVR3.940e-2464.41Serine/threonine-protein kinase-transforming prote... [more]
sp|P15056|BRAF_HUMAN4.607e-2464.41Serine/threonine-protein kinase B-raf OS=Homo sapi... [more]
sp|P28028|BRAF_MOUSE4.957e-2464.41Serine/threonine-protein kinase B-raf OS=Mus muscu... [more]
sp|Q04982|BRAF_CHICK5.701e-2464.41Serine/threonine-protein kinase B-raf OS=Gallus ga... [more]
sp|P34908|BRAF_COTJA5.941e-2464.41Serine/threonine-protein kinase B-raf OS=Coturnix ... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1C7073.799e-2881.36Protein kinase domain-containing protein (Fragment... [more]
A0A3P8HFH24.810e-2877.42Protein kinase domain-containing protein OS=Schist... [more]
A0A183Q0435.367e-2877.42Protein kinase domain-containing protein OS=Schist... [more]
A0A4S2LQ941.398e-2784.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YGF31.398e-2784.75Serine/threonine-protein kinase-transforming prote... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
braf9.126e-2666.10B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
raf1a6.429e-2262.71Raf-1 proto-oncogene, serine/threonine kinase a [S... [more]
araf1.500e-2162.07A-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
raf1b1.724e-2160.00RAF proto-oncogene serine/threonine-protein kinase... [more]
raf1b1.917e-2160.00RAF proto-oncogene serine/threonine-protein kinase... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
braf1.778e-2666.10B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
ENSPMAT00000009961.11.037e-2463.79pep scaffold:Pmarinus_7.0:GL485736:601:10038:-1 ge... [more]
ENSPMAT00000006323.11.400e-838.89pep scaffold:Pmarinus_7.0:GL480385:15686:21285:-1 ... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO470893.675e-2466.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474671.146e-843.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
braf8.316e-2667.80B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf9.254e-2667.80B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
braf1.046e-2567.80B-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
araf2.551e-2162.07A-Raf proto-oncogene, serine/threonine kinase [Sou... [more]
raf1a4.692e-2161.02Raf-1 proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003163.14.665e-38100.00SMESG000003163.1[more]
SMESG000003163.11.031e-37100.00SMESG000003163.1[more]
SMESG000003163.11.048e-37100.00SMESG000003163.1[more]
SMESG000018974.12.133e-3083.05SMESG000018974.1[more]
SMESG000018974.13.343e-3083.05SMESG000018974.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032813 ID=SMED30032813|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=256bp
ATGGGACAACTAGAAAAAAGACGAGATTCTAATGAAGAATGGGAAATTTC
AGAAAAAGAAGTAACTAAAGGTCCACGAATTGGTTCAGGTTCTTTTGGAA
CGGTTTTCAAAGGCTACTGGCATGGAAATGTGGCTATTAAGGAACTAAAT
GTCAGCTATCCAAATCCAGAGCAATATAAAGCTTTCAAAAATGAGAAAGA
CAAGACATGTTAATATTCTGTTCTTCATGGGTTACATATCGACACCAAGA
TTGGCT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0005057signal transducer activity, downstream of receptor
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 6..63
e-value: 1.6E-17
score: 65.3
NoneNo IPR availablePANTHERPTHR23257:SF727coord: 2..59
NoneNo IPR availablePANTHERPTHR23257SERINE-THREONINE PROTEIN KINASEcoord: 2..59
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 21..41
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 4..60