ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30032811
Length (bp)723
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30032811) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30032811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30032811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30032811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032811

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032811SMESG000053465.1 SmedASXL_011397SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032811SMESG000053465.1 SmedASXL_011397SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD49 (ankyrin repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:25970])

HSP 1 Score: 105.145 bits (261), Expect = 6.255e-27
Identity = 64/191 (33.51%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  137 MFVSNWEED------NTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            ++V N +ED      N   +   E +++ DP + L+  AE   L  ++ LL      +N  D D Y  LHRA Y+GH++  + LI++GA V++ T  GWT LHS+  WN       LL    + N  T+G  T LHLA    D   + L LLL +  +   LKN  E+T  ++  R + Y Y F   + C 
Sbjct:   44 LWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRD-SKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCT 233          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD49 (ankyrin repeat domain 49 [Source:HGNC Symbol;Acc:HGNC:25970])

HSP 1 Score: 105.145 bits (261), Expect = 6.255e-27
Identity = 64/191 (33.51%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  137 MFVSNWEED------NTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            ++V N +ED      N   +   E +++ DP + L+  AE   L  ++ LL      +N  D D Y  LHRA Y+GH++  + LI++GA V++ T  GWT LHS+  WN       LL    + N  T+G  T LHLA    D   + L LLL +  +   LKN  E+T  ++  R + Y Y F   + C 
Sbjct:   44 LWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRD-SKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCT 233          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD39 (ankyrin repeat domain 39 [Source:HGNC Symbol;Acc:HGNC:28640])

HSP 1 Score: 76.2554 bits (186), Expect = 1.420e-16
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  227 SEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            S A  G+L  +K L++  E D +  D+ GY ALH A  NGH    ++L+  GAK ++QT  G TALH + Y    E   LLL+ G N  +  + G T+LH A  +   + +I +LLL H
Sbjct:   37 SAALNGDLGRVKHLIQKAE-DPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPRVVDDDGMTSLHKAAERG--HGDICSLLLQH 152          

HSP 2 Score: 50.0618 bits (118), Expect = 5.063e-7
Identity = 35/102 (34.31%), Postives = 47/102 (46.08%), Query Frame = 2
Query:  278 LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            L +    E+ D  R +  A  NG +   K+LI K    +     G+TALH +         + LL SG   +  T GG TALH A   +  + EI  LLLSH
Sbjct:   20 LGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRA--SYCGHTEIARLLLSH 119          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD39 (ankyrin repeat domain 39 [Source:HGNC Symbol;Acc:HGNC:28640])

HSP 1 Score: 76.2554 bits (186), Expect = 1.420e-16
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  227 SEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            S A  G+L  +K L++  E D +  D+ GY ALH A  NGH    ++L+  GAK ++QT  G TALH + Y    E   LLL+ G N  +  + G T+LH A  +   + +I +LLL H
Sbjct:   37 SAALNGDLGRVKHLIQKAE-DPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPRVVDDDGMTSLHKAAERG--HGDICSLLLQH 152          

HSP 2 Score: 50.0618 bits (118), Expect = 5.063e-7
Identity = 35/102 (34.31%), Postives = 47/102 (46.08%), Query Frame = 2
Query:  278 LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            L +    E+ D  R +  A  NG +   K+LI K    +     G+TALH +         + LL SG   +  T GG TALH A   +  + EI  LLLSH
Sbjct:   20 LGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRA--SYCGHTEIARLLLSH 119          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: CTTNBP2 (cortactin binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15679])

HSP 1 Score: 77.0258 bits (188), Expect = 1.924e-15
Identity = 45/120 (37.50%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  221 LISEAEA-GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            L+ +A A GN+  + +LL    +DIN    DG+ AL+ A  NGH +  + L+S  A+VN+  + G+T L ++      EC+ELL++   N N   +GGQT L+LAC   +   E + LLL
Sbjct:  713 LLQQAAAQGNVTLLSMLLNEEGLDINYSCEDGHSALYSAAKNGHTDCVRLLLSAEAQVNAADKNGFTPLCAAAAQGHFECVELLISYDANINHAADGGQTPLYLACKNGN--KECIKLLL 830          

HSP 2 Score: 68.5514 bits (166), Expect = 1.302e-12
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            D H  L S A+ G+ + +++LL + E  +NA D +G+  L  A   GH E  + LIS  A +N     G T L+ +      ECI+LLL +G N ++ T  G T +H A    ++  + L LL+ H
Sbjct:  743 DGHSALYSAAKNGHTDCVRLLL-SAEAQVNAADKNGFTPLCAAAAQGHFECVELLISYDANINHAADGGQTPLYLACKNGNKECIKLLLEAGTNRSVKTTDGWTPVHAAVDTGNV--DSLKLLMYH 865          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: F26F4.12 (pep chromosome:WBcel235:III:4908960:4910038:-1 gene:WBGene00017831.1 transcript:F26F4.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F26F4.12)

HSP 1 Score: 108.227 bits (269), Expect = 1.362e-28
Identity = 67/197 (34.01%), Postives = 98/197 (49.75%), Query Frame = 2
Query:   86 SSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPE----ILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAY 664
            + +  D++   K  NP MFVS W++D   +    E +   DP ++ ++ AE G LE +K+LLE     +N+ D DGY ALHRA YN H     +L+  GA   S+T  GWT L S+  W   E +  LL+ G + N  + G  TALHLA +     PE     +  LL    I+  +     DT + +  R +   Y
Sbjct:   29 TKELIDEIRDKKESNPGMFVSAWQDDTEGL----EEKNMEDPIEKWLTAAEDGELELVKVLLEETPNLLNSRDADGYTALHRASYNNHSPIVDHLLLSGANKESKTNEGWTPLLSASNWANFEVVGRLLSHGSDVNALSNGNLTALHLAVNSRSEEPENVYMTVRYLLQAPGIDAGVIAGNGDTPLMMARRTSEQLY 221          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: fem-1 (Sex-determining protein fem-1 [Source:UniProtKB/Swiss-Prot;Acc:P17221])

HSP 1 Score: 81.2629 bits (199), Expect = 1.637e-17
Identity = 50/148 (33.78%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  194 EIKADPHKQLISE---------------AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDI 592
            EI ADP  + + E               + AG++E +K+L+E    D+N   N     L  ACY+GH++  KYL+ KGA  +   + G T L  + Y N++  +E LL +GI+ N  TE G TALH A    ++  E++ +LL H  +
Sbjct:   69 EIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIEIVKLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASYRNKVGIVEELLKTGIDVNKKTERGNTALHDAAESGNV--EVVKILLKHGSV 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 66.2402 bits (160), Expect = 3.138e-12
Identity = 40/126 (31.75%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  185 TEAEIKADPHKQ-------LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            T  + KADP+ +       L   A+ G+ E   +L+EN   D+ A+ N+G  A+H      HV  A+ L + GA++NS+T  G+T LH + ++ QL  ++ L+ +G +    T    T LH A  +
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQ 765          

HSP 2 Score: 65.0846 bits (157), Expect = 7.344e-12
Identity = 41/128 (32.03%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            +A+     +  A AG+LE +  LL     DIN  + +G  +LH A   GH E  + LI + A+V++ T+ G TALH +    Q   + +L+ +G N N+ +  G T L++A    + + E++  LL H
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKH 154          

HSP 3 Score: 63.5438 bits (153), Expect = 2.188e-11
Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  266 LLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +L N   +IN++ N GY  LH AC+ G +   K+L+  GA V  +T+  +T LH +       C+  LL +G + N  T  GQT L +A
Sbjct:  707 ILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 57.3806 bits (137), Expect = 2.814e-9
Identity = 32/101 (31.68%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A+   +E    LL+  + D NA+   G+  LH +   GH E +  LI  G+ V ++   G TA+H     + +   ++L N+G   N  T  G T LH+AC
Sbjct:  631 AKKNQMEIASTLLQ-FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC 730          

HSP 5 Score: 54.299 bits (129), Expect = 2.774e-8
Identity = 30/100 (30.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A  G++   K+LL+    D N+   +G+  LH AC    ++  + L+   A + + T+ G T LH + +   +  +  LL  G N ++ T  G+T LHLA
Sbjct:  367 AHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 53.1434 bits (126), Expect = 6.958e-8
Identity = 43/150 (28.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKNAQEDTCMELVTR--HTPYAYFFY 673
            ++ GNLE +++LLE     ++ E  +    LH A +  + + A  L+  GA   +  + G+T LH +   NQ+E    LL    + N  +  G T LHL+    + + EI  LL+ +  D+     N    T M L  +  H P A   Y
Sbjct:  565 SKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQ--EGHKEISGLLIENGSDVGAKANNGL--TAMHLCAQEDHVPVAQILY 709          

HSP 7 Score: 51.6026 bits (122), Expect = 2.537e-7
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  323 LHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            LH A + GHV  AK L+ + A  NS+   G+T LH +   N+++ +ELLL         TE G T LH+A     I   I+  LL     N D++  + +T + L  R
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI--NIVIYLLQQ-GANPDVETVRGETPLHLAAR 467          

HSP 8 Score: 48.1358 bits (113), Expect = 2.882e-6
Identity = 34/97 (35.05%), Postives = 45/97 (46.39%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            GN + I ILL     + NA   D Y  LH A   G  E A  L+   A     T+ G+T LH +  +  LE + LLL  G   +I  +   T LH+A
Sbjct:  502 GNTD-IVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 9 Score: 47.7506 bits (112), Expect = 3.719e-6
Identity = 31/100 (31.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  +  A  +LL+N E + +     G+  LH A + GH    + L+ KGA VN Q +   + LH +  W +     LLL+ G   +  T+   T LH A
Sbjct:  202 AKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCA 300          

HSP 10 Score: 47.3654 bits (111), Expect = 6.078e-6
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            D +  L   A+ G  E   ILL++   D       G+  LH A   G++E  + L+ +G  V+ + +   T LH + ++N  +   LLL +G +     + G T LH+A  K  +  EI + LL
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDH-NADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQM--EIASTLL 643          

HSP 11 Score: 46.595 bits (109), Expect = 8.742e-6
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A   N +   +LLEN      A   +GY  LH A     +E A  L+   A  N++++ G+T LH S      E   LL+ +G +       G TA+HL C++ D  P    L  +  +IN
Sbjct:  598 AHYNNDKVAMLLLEN-GASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQEDHVPVAQILYNNGAEIN 716          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 66.2402 bits (160), Expect = 3.138e-12
Identity = 40/126 (31.75%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  185 TEAEIKADPHKQ-------LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            T  + KADP+ +       L   A+ G+ E   +L+EN   D+ A+ N+G  A+H      HV  A+ L + GA++NS+T  G+T LH + ++ QL  ++ L+ +G +    T    T LH A  +
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQ 765          

HSP 2 Score: 65.0846 bits (157), Expect = 7.344e-12
Identity = 41/128 (32.03%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            +A+     +  A AG+LE +  LL     DIN  + +G  +LH A   GH E  + LI + A+V++ T+ G TALH +    Q   + +L+ +G N N+ +  G T L++A    + + E++  LL H
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKH 154          

HSP 3 Score: 63.5438 bits (153), Expect = 2.188e-11
Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  266 LLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +L N   +IN++ N GY  LH AC+ G +   K+L+  GA V  +T+  +T LH +       C+  LL +G + N  T  GQT L +A
Sbjct:  707 ILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 57.3806 bits (137), Expect = 2.814e-9
Identity = 32/101 (31.68%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A+   +E    LL+  + D NA+   G+  LH +   GH E +  LI  G+ V ++   G TA+H     + +   ++L N+G   N  T  G T LH+AC
Sbjct:  631 AKKNQMEIASTLLQ-FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC 730          

HSP 5 Score: 54.299 bits (129), Expect = 2.774e-8
Identity = 30/100 (30.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A  G++   K+LL+    D N+   +G+  LH AC    ++  + L+   A + + T+ G T LH + +   +  +  LL  G N ++ T  G+T LHLA
Sbjct:  367 AHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 53.1434 bits (126), Expect = 6.958e-8
Identity = 43/150 (28.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKNAQEDTCMELVTR--HTPYAYFFY 673
            ++ GNLE +++LLE     ++ E  +    LH A +  + + A  L+  GA   +  + G+T LH +   NQ+E    LL    + N  +  G T LHL+    + + EI  LL+ +  D+     N    T M L  +  H P A   Y
Sbjct:  565 SKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQ--EGHKEISGLLIENGSDVGAKANNGL--TAMHLCAQEDHVPVAQILY 709          

HSP 7 Score: 51.6026 bits (122), Expect = 2.537e-7
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  323 LHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            LH A + GHV  AK L+ + A  NS+   G+T LH +   N+++ +ELLL         TE G T LH+A     I   I+  LL     N D++  + +T + L  R
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI--NIVIYLLQQ-GANPDVETVRGETPLHLAAR 467          

HSP 8 Score: 48.1358 bits (113), Expect = 2.882e-6
Identity = 34/97 (35.05%), Postives = 45/97 (46.39%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            GN + I ILL     + NA   D Y  LH A   G  E A  L+   A     T+ G+T LH +  +  LE + LLL  G   +I  +   T LH+A
Sbjct:  502 GNTD-IVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 9 Score: 47.7506 bits (112), Expect = 3.719e-6
Identity = 31/100 (31.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  +  A  +LL+N E + +     G+  LH A + GH    + L+ KGA VN Q +   + LH +  W +     LLL+ G   +  T+   T LH A
Sbjct:  202 AKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCA 300          

HSP 10 Score: 47.3654 bits (111), Expect = 6.078e-6
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            D +  L   A+ G  E   ILL++   D       G+  LH A   G++E  + L+ +G  V+ + +   T LH + ++N  +   LLL +G +     + G T LH+A  K  +  EI + LL
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDH-NADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQM--EIASTLL 643          

HSP 11 Score: 46.595 bits (109), Expect = 8.742e-6
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A   N +   +LLEN      A   +GY  LH A     +E A  L+   A  N++++ G+T LH S      E   LL+ +G +       G TA+HL C++ D  P    L  +  +IN
Sbjct:  598 AHYNNDKVAMLLLEN-GASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQEDHVPVAQILYNNGAEIN 716          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 66.2402 bits (160), Expect = 3.164e-12
Identity = 40/126 (31.75%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  185 TEAEIKADPHKQ-------LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            T  + KADP+ +       L   A+ G+ E   +L+EN   D+ A+ N+G  A+H      HV  A+ L + GA++NS+T  G+T LH + ++ QL  ++ L+ +G +    T    T LH A  +
Sbjct:  641 TLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQ 765          

HSP 2 Score: 65.0846 bits (157), Expect = 7.473e-12
Identity = 41/128 (32.03%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            +A+     +  A AG+LE +  LL     DIN  + +G  +LH A   GH E  + LI + A+V++ T+ G TALH +    Q   + +L+ +G N N+ +  G T L++A    + + E++  LL H
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ--ENHEEVVKYLLKH 154          

HSP 3 Score: 63.5438 bits (153), Expect = 2.268e-11
Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  266 LLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +L N   +IN++ N GY  LH AC+ G +   K+L+  GA V  +T+  +T LH +       C+  LL +G + N  T  GQT L +A
Sbjct:  707 ILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 57.3806 bits (137), Expect = 2.863e-9
Identity = 32/101 (31.68%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A+   +E    LL+  + D NA+   G+  LH +   GH E +  LI  G+ V ++   G TA+H     + +   ++L N+G   N  T  G T LH+AC
Sbjct:  631 AKKNQMEIASTLLQ-FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC 730          

HSP 5 Score: 54.299 bits (129), Expect = 2.796e-8
Identity = 30/100 (30.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A  G++   K+LL+    D N+   +G+  LH AC    ++  + L+   A + + T+ G T LH + +   +  +  LL  G N ++ T  G+T LHLA
Sbjct:  367 AHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 6 Score: 53.1434 bits (126), Expect = 7.014e-8
Identity = 43/150 (28.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKNAQEDTCMELVTR--HTPYAYFFY 673
            ++ GNLE +++LLE     ++ E  +    LH A +  + + A  L+  GA   +  + G+T LH +   NQ+E    LL    + N  +  G T LHL+    + + EI  LL+ +  D+     N    T M L  +  H P A   Y
Sbjct:  565 SKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQ--EGHKEISGLLIENGSDVGAKANNGL--TAMHLCAQEDHVPVAQILY 709          

HSP 7 Score: 51.6026 bits (122), Expect = 2.605e-7
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  323 LHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            LH A + GHV  AK L+ + A  NS+   G+T LH +   N+++ +ELLL         TE G T LH+A     I   I+  LL     N D++  + +T + L  R
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAI--NIVIYLLQQ-GANPDVETVRGETPLHLAAR 467          

HSP 8 Score: 48.1358 bits (113), Expect = 2.879e-6
Identity = 34/97 (35.05%), Postives = 45/97 (46.39%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            GN + I ILL     + NA   D Y  LH A   G  E A  L+   A     T+ G+T LH +  +  LE + LLL  G   +I  +   T LH+A
Sbjct:  502 GNTD-IVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVA 597          

HSP 9 Score: 47.7506 bits (112), Expect = 3.817e-6
Identity = 31/100 (31.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  +  A  +LL+N E + +     G+  LH A + GH    + L+ KGA VN Q +   + LH +  W +     LLL+ G   +  T+   T LH A
Sbjct:  202 AKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCA 300          

HSP 10 Score: 47.3654 bits (111), Expect = 6.127e-6
Identity = 36/124 (29.03%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            D +  L   A+ G  E   ILL++   D       G+  LH A   G++E  + L+ +G  V+ + +   T LH + ++N  +   LLL +G +     + G T LH+A  K  +  EI + LL
Sbjct:  523 DNYSPLHIAAKEGQEEVAGILLDH-NADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQM--EIASTLL 643          

HSP 11 Score: 46.595 bits (109), Expect = 8.892e-6
Identity = 37/121 (30.58%), Postives = 55/121 (45.45%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A   N +   +LLEN      A   +GY  LH A     +E A  L+   A  N++++ G+T LH S      E   LL+ +G +       G TA+HL C++ D  P    L  +  +IN
Sbjct:  598 AHYNNDKVAMLLLEN-GASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL-CAQEDHVPVAQILYNNGAEIN 716          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: l(2)35Be (gene:FBgn0261881 transcript:FBtr0080728)

HSP 1 Score: 95.5153 bits (236), Expect = 9.961e-24
Identity = 64/178 (35.96%), Postives = 92/178 (51.69%), Query Frame = 2
Query:   62 MSDGEFNESSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAE---AGNLEAIKILLENLEID---INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            M D + ++     +K+  AK     MFVS W++D   +       I+ D + Q   E     A N   I  + E L++D   +NA+DNDGY  LHRA YN  V+ AK L+   A  N++T+LGWT LHS+  WN  +C  LLL  G + N  ++G QT LH+  +  +       LLL
Sbjct:    1 MGDYDSDDEKSQVEKLRHAKVPRG-MFVSGWDDDADEL-------IEEDKNPQSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLL 170          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 74.7146 bits (182), Expect = 5.866e-15
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  185 TEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            TE   + D +   +  A AGNLE +   L+N  IDIN  + +G  ALH A  +GH+     L+ +GA V+S T+ G TALH +    Q E ++LLL    + N+ ++ G T L++A    + +  ++ LLLS+
Sbjct:    3 TENGAQGDGNTSFLRAARAGNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQ--ENHDAVVRLLLSN 132          

HSP 2 Score: 62.7734 bits (151), Expect = 5.630e-11
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA----CSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  +++A +ILL +    ++    D   ALH A + GHV  AK L+ + A  N++   G+T LH +   N+L+ +ELLL  G + +  TE G T LH+A    C    IY      LL H D + D+   + +T + L  R
Sbjct:  312 AQGEHVDAARILLYH-RAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIY------LLQH-DASPDVPTVRGETPLHLAAR 445          

HSP 3 Score: 59.3066 bits (142), Expect = 8.323e-10
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKN--------AQED 622
            A+ G+++  ++LL+  E D++A+  +G   LH AC+  + + A  L+ KGA  ++  + G T LH +   NQ++    LL  G   N  ++ G T LHL  S  + + EI  LL+ H   +N   KN        AQED
Sbjct:  543 AKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL--SSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQED 678          

HSP 4 Score: 59.3066 bits (142), Expect = 9.047e-10
Identity = 33/100 (33.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  N+   +IL +N   +I+     GY  LH A + G     ++L+  GA V++ T +G+T LH +        + LLL    N N  T  GQT LH+A
Sbjct:  675 AQEDNVNVAEILEKN-GANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 5 Score: 58.151 bits (139), Expect = 2.101e-9
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            GN++ + +LL++    ++A   D Y ALH A   G  E A  LI  GA +++ T+ G+T LH +  +  ++  +LLL    + +   + G T LH+AC
Sbjct:  480 GNVDIVMLLLQH-GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC 576          

HSP 6 Score: 57.7658 bits (138), Expect = 2.851e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            D +  L   A+ G  E   +L+EN    ++A    G+  LH     GH++ A+ L+ K A V++Q + G T LH + ++N  +   LLL  G + +   + G T LH+A  K
Sbjct:  501 DMYTALHIAAKEGQDEVAAVLIEN-GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARK 611          

HSP 7 Score: 53.1434 bits (126), Expect = 1.055e-7
Identity = 37/117 (31.62%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G+ + + +LLE     I+A+  +G   LH A    HV+ A+ L+   A V+  T    TALH + +   +   +LLL+   + N     G T LH+AC K  +  +++ LLL H
Sbjct:  279 ARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRL--KVVELLLRH 392          

HSP 8 Score: 52.373 bits (124), Expect = 1.551e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            A+  +++A  +LL+N + + +     G+  LH A + G+   A  LI KGA VN   +   + LH +  W +   + LLL  G N    T  G T LH  C+    + +++ +LL
Sbjct:  180 AKKDDVKAATLLLDN-DHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHEQVVDMLL 291          

HSP 9 Score: 51.6026 bits (122), Expect = 3.379e-7
Identity = 33/107 (30.84%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            H  L   A    ++    LLE   +  NAE   G+  LH +   GH E +  LI   A VN   + G T +H     + +   E+L  +G N ++ T+ G T LH+A
Sbjct:  602 HTPLHIAARKNQMDIATTLLEYGAL-ANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 10 Score: 47.3654 bits (111), Expect = 6.851e-6
Identity = 38/127 (29.92%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNA 613
            A A   + I+ILL N    ++A   +    LH A   G+V+    L+  GA+V++ T+  +TALH +    Q E   +L+ +G   +  T+ G T LHL  +K+        LL    D++   KN 
Sbjct:  444 ARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNG 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 74.3294 bits (181), Expect = 6.015e-15
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  185 TEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            TE   + D +   +  A AGNLE +   L+N  IDIN  + +G  ALH A  +GH+     L+ +GA V+S T+ G TALH +    Q E ++LLL    + N+ ++ G T L++A    + +  ++ LLLS+
Sbjct:    3 TENGAQGDGNTSFLRAARAGNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQ--ENHDAVVRLLLSN 132          

HSP 2 Score: 62.7734 bits (151), Expect = 5.697e-11
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA----CSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  +++A +ILL +    ++    D   ALH A + GHV  AK L+ + A  N++   G+T LH +   N+L+ +ELLL  G + +  TE G T LH+A    C    IY      LL H D + D+   + +T + L  R
Sbjct:  312 AQGEHVDAARILLYH-RAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIY------LLQH-DASPDVPTVRGETPLHLAAR 445          

HSP 3 Score: 59.3066 bits (142), Expect = 8.059e-10
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKN--------AQED 622
            A+ G+++  ++LL+  E D++A+  +G   LH AC+  + + A  L+ KGA  ++  + G T LH +   NQ++    LL  G   N  ++ G T LHL  S  + + EI  LL+ H   +N   KN        AQED
Sbjct:  543 AKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL--SSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQED 678          

HSP 4 Score: 58.9214 bits (141), Expect = 8.761e-10
Identity = 33/100 (33.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  N+   +IL +N   +I+     GY  LH A + G     ++L+  GA V++ T +G+T LH +        + LLL    N N  T  GQT LH+A
Sbjct:  675 AQEDNVNVAEILEKN-GANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 5 Score: 58.151 bits (139), Expect = 2.036e-9
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            GN++ + +LL++    ++A   D Y ALH A   G  E A  LI  GA +++ T+ G+T LH +  +  ++  +LLL    + +   + G T LH+AC
Sbjct:  480 GNVDIVMLLLQH-GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC 576          

HSP 6 Score: 57.7658 bits (138), Expect = 2.713e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            D +  L   A+ G  E   +L+EN    ++A    G+  LH     GH++ A+ L+ K A V++Q + G T LH + ++N  +   LLL  G + +   + G T LH+A  K
Sbjct:  501 DMYTALHIAAKEGQDEVAAVLIEN-GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARK 611          

HSP 7 Score: 52.7582 bits (125), Expect = 1.037e-7
Identity = 37/117 (31.62%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G+ + + +LLE     I+A+  +G   LH A    HV+ A+ L+   A V+  T    TALH + +   +   +LLL+   + N     G T LH+AC K  +  +++ LLL H
Sbjct:  279 ARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRL--KVVELLLRH 392          

HSP 8 Score: 52.373 bits (124), Expect = 1.431e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            A+  +++A  +LL+N + + +     G+  LH A + G+   A  LI KGA VN   +   + LH +  W +   + LLL  G N    T  G T LH  C+    + +++ +LL
Sbjct:  180 AKKDDVKAATLLLDN-DHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHEQVVDMLL 291          

HSP 9 Score: 51.2174 bits (121), Expect = 3.208e-7
Identity = 33/107 (30.84%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            H  L   A    ++    LLE   +  NAE   G+  LH +   GH E +  LI   A VN   + G T +H     + +   E+L  +G N ++ T+ G T LH+A
Sbjct:  602 HTPLHIAARKNQMDIATTLLEYGAL-ANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 10 Score: 47.3654 bits (111), Expect = 6.480e-6
Identity = 38/127 (29.92%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNA 613
            A A   + I+ILL N    ++A   +    LH A   G+V+    L+  GA+V++ T+  +TALH +    Q E   +L+ +G   +  T+ G T LHL  +K+        LL    D++   KN 
Sbjct:  444 ARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNG 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 73.9442 bits (180), Expect = 8.166e-15
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  185 TEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            TE   + D +   +  A AGNLE +   L+N  IDIN  + +G  ALH A  +GH+     L+ +GA V+S T+ G TALH +    Q E ++LLL    + N+ ++ G T L++A    + +  ++ LLLS+
Sbjct:    3 TENGAQGDGNTSFLRAARAGNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQ--ENHDAVVRLLLSN 132          

HSP 2 Score: 62.3882 bits (150), Expect = 7.610e-11
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA----CSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  +++A +ILL +    ++    D   ALH A + GHV  AK L+ + A  N++   G+T LH +   N+L+ +ELLL  G + +  TE G T LH+A    C    IY      LL H D + D+   + +T + L  R
Sbjct:  312 AQGEHVDAARILLYH-RAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIY------LLQH-DASPDVPTVRGETPLHLAAR 445          

HSP 3 Score: 58.9214 bits (141), Expect = 1.064e-9
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKN--------AQED 622
            A+ G+++  ++LL+  E D++A+  +G   LH AC+  + + A  L+ KGA  ++  + G T LH +   NQ++    LL  G   N  ++ G T LHL  S  + + EI  LL+ H   +N   KN        AQED
Sbjct:  543 AKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL--SSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQED 678          

HSP 4 Score: 58.9214 bits (141), Expect = 1.125e-9
Identity = 33/100 (33.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  N+   +IL +N   +I+     GY  LH A + G     ++L+  GA V++ T +G+T LH +        + LLL    N N  T  GQT LH+A
Sbjct:  675 AQEDNVNVAEILEKN-GANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 5 Score: 57.7658 bits (138), Expect = 2.540e-9
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            GN++ + +LL++    ++A   D Y ALH A   G  E A  LI  GA +++ T+ G+T LH +  +  ++  +LLL    + +   + G T LH+AC
Sbjct:  480 GNVDIVMLLLQH-GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC 576          

HSP 6 Score: 57.3806 bits (137), Expect = 3.352e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            D +  L   A+ G  E   +L+EN    ++A    G+  LH     GH++ A+ L+ K A V++Q + G T LH + ++N  +   LLL  G + +   + G T LH+A  K
Sbjct:  501 DMYTALHIAAKEGQDEVAAVLIEN-GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARK 611          

HSP 7 Score: 52.7582 bits (125), Expect = 1.276e-7
Identity = 37/117 (31.62%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G+ + + +LLE     I+A+  +G   LH A    HV+ A+ L+   A V+  T    TALH + +   +   +LLL+   + N     G T LH+AC K  +  +++ LLL H
Sbjct:  279 ARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRL--KVVELLLRH 392          

HSP 8 Score: 52.373 bits (124), Expect = 1.825e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            A+  +++A  +LL+N + + +     G+  LH A + G+   A  LI KGA VN   +   + LH +  W +   + LLL  G N    T  G T LH  C+    + +++ +LL
Sbjct:  180 AKKDDVKAATLLLDN-DHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHEQVVDMLL 291          

HSP 9 Score: 51.2174 bits (121), Expect = 4.014e-7
Identity = 27/80 (33.75%), Postives = 40/80 (50.00%), Query Frame = 2
Query:  293 NAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            NAE   G+  LH +   GH E +  LI   A VN   + G T +H     + +   E+L  +G N ++ T+ G T LH+A
Sbjct:  628 NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 10 Score: 47.3654 bits (111), Expect = 7.997e-6
Identity = 38/127 (29.92%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNA 613
            A A   + I+ILL N    ++A   +    LH A   G+V+    L+  GA+V++ T+  +TALH +    Q E   +L+ +G   +  T+ G T LHL  +K+        LL    D++   KN 
Sbjct:  444 ARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNG 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 73.9442 bits (180), Expect = 8.646e-15
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  185 TEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            TE   + D +   +  A AGNLE +   L+N  IDIN  + +G  ALH A  +GH+     L+ +GA V+S T+ G TALH +    Q E ++LLL    + N+ ++ G T L++A    + +  ++ LLLS+
Sbjct:    3 TENGAQGDGNTSFLRAARAGNLERVLEHLKN-NIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQ--ENHDAVVRLLLSN 132          

HSP 2 Score: 62.3882 bits (150), Expect = 8.033e-11
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA----CSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  +++A +ILL +    ++    D   ALH A + GHV  AK L+ + A  N++   G+T LH +   N+L+ +ELLL  G + +  TE G T LH+A    C    IY      LL H D + D+   + +T + L  R
Sbjct:  312 AQGEHVDAARILLYH-RAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIY------LLQH-DASPDVPTVRGETPLHLAAR 445          

HSP 3 Score: 58.9214 bits (141), Expect = 1.122e-9
Identity = 45/139 (32.37%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDINLDLKN--------AQED 622
            A+ G+++  ++LL+  E D++A+  +G   LH AC+  + + A  L+ KGA  ++  + G T LH +   NQ++    LL  G   N  ++ G T LHL  S  + + EI  LL+ H   +N   KN        AQED
Sbjct:  543 AKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL--SSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQED 678          

HSP 4 Score: 58.9214 bits (141), Expect = 1.186e-9
Identity = 33/100 (33.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+  N+   +IL +N   +I+     GY  LH A + G     ++L+  GA V++ T +G+T LH +        + LLL    N N  T  GQT LH+A
Sbjct:  675 AQEDNVNVAEILEKN-GANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 5 Score: 57.7658 bits (138), Expect = 2.677e-9
Identity = 32/98 (32.65%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            GN++ + +LL++    ++A   D Y ALH A   G  E A  LI  GA +++ T+ G+T LH +  +  ++  +LLL    + +   + G T LH+AC
Sbjct:  480 GNVDIVMLLLQH-GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC 576          

HSP 6 Score: 57.3806 bits (137), Expect = 3.532e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            D +  L   A+ G  E   +L+EN    ++A    G+  LH     GH++ A+ L+ K A V++Q + G T LH + ++N  +   LLL  G + +   + G T LH+A  K
Sbjct:  501 DMYTALHIAAKEGQDEVAAVLIEN-GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARK 611          

HSP 7 Score: 52.7582 bits (125), Expect = 1.342e-7
Identity = 37/117 (31.62%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G+ + + +LLE     I+A+  +G   LH A    HV+ A+ L+   A V+  T    TALH + +   +   +LLL+   + N     G T LH+AC K  +  +++ LLL H
Sbjct:  279 ARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRL--KVVELLLRH 392          

HSP 8 Score: 52.373 bits (124), Expect = 1.918e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            A+  +++A  +LL+N + + +     G+  LH A + G+   A  LI KGA VN   +   + LH +  W +   + LLL  G N    T  G T LH  C+    + +++ +LL
Sbjct:  180 AKKDDVKAATLLLDN-DHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH--CAARSGHEQVVDMLL 291          

HSP 9 Score: 51.2174 bits (121), Expect = 4.216e-7
Identity = 27/80 (33.75%), Postives = 40/80 (50.00%), Query Frame = 2
Query:  293 NAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            NAE   G+  LH +   GH E +  LI   A VN   + G T +H     + +   E+L  +G N ++ T+ G T LH+A
Sbjct:  628 NAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 10 Score: 47.3654 bits (111), Expect = 8.380e-6
Identity = 38/127 (29.92%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNA 613
            A A   + I+ILL N    ++A   +    LH A   G+V+    L+  GA+V++ T+  +TALH +    Q E   +L+ +G   +  T+ G T LHL  +K+        LL    D++   KN 
Sbjct:  444 ARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNG 568          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd49 (ankyrin repeat domain 49 [Source:ZFIN;Acc:ZDB-GENE-050417-46])

HSP 1 Score: 77.411 bits (189), Expect = 7.508e-17
Identity = 50/171 (29.24%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  176 HSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSC 688
            H   E  ++  P + ++  AE      ++ L+      +N  D+DGY  LHRA Y+GH + A  L+  GA ++++T   W  LHS+  W       LLL  G   N  T G  T L LA        + + LLLS   +   LKN+  +T  ++  R +     F   + C
Sbjct:   45 HQQQELHLQDTPSELMLWAAERNRCATVERLIALDPTLVNCHDSDGYTPLHRAAYSGHHDVASALLKAGANLHARTADDWMPLHSACRWGHANVASLLLQWGSEVNAMTAGRLTPLQLAAGNA-AAGKTIELLLSQRTLEAGLKNSAGETAYDIAHRTSELHRLFEIVEPC 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd49 (ankyrin repeat domain 49 [Source:ZFIN;Acc:ZDB-GENE-050417-46])

HSP 1 Score: 77.411 bits (189), Expect = 7.508e-17
Identity = 50/171 (29.24%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  176 HSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSC 688
            H   E  ++  P + ++  AE      ++ L+      +N  D+DGY  LHRA Y+GH + A  L+  GA ++++T   W  LHS+  W       LLL  G   N  T G  T L LA        + + LLLS   +   LKN+  +T  ++  R +     F   + C
Sbjct:   45 HQQQELHLQDTPSELMLWAAERNRCATVERLIALDPTLVNCHDSDGYTPLHRAAYSGHHDVASALLKAGANLHARTADDWMPLHSACRWGHANVASLLLQWGSEVNAMTAGRLTPLQLAAGNA-AAGKTIELLLSQRTLEAGLKNSAGETAYDIAHRTSELHRLFEIVEPC 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd16 (ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-041210-253])

HSP 1 Score: 75.485 bits (184), Expect = 2.099e-15
Identity = 44/121 (36.36%), Postives = 70/121 (57.85%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEIL-ALLLSHCDI 592
            A  G+++ ++ L+E L +DI   ++D  RALH A   GH E  ++LI +GAKV+S  +  WT L  +     LE I+ LL+ G +  +  + G ++ H+AC + D  P I+  LLL+  DI
Sbjct:   53 ARHGHVDILRYLVEELNMDIEVYNSDYKRALHEASSMGHYECVRFLICRGAKVDSLKKADWTPLMMACTRRNLEVIQELLDYGADPTLQNKDGWSSFHIACREGD--PAIINHLLLAKPDI 171          

HSP 2 Score: 47.7506 bits (112), Expect = 5.169e-6
Identity = 32/100 (32.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISK-GAKVNSQ-TQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            G++   K+LLE+ +   +A D  G + LH+A      E   +L+   G  +NS+ T+L  TALH +        I+ LL  G + +     G++ALH+AC
Sbjct:  224 GHIAVAKLLLEDHQASPSAVDILGAQPLHQASVTAQEEALSFLVHHLGMDINSRATKLELTALHYAAKEGHTSTIKTLLALGADLHARDAKGRSALHMAC 323          

HSP 3 Score: 47.3654 bits (111), Expect = 6.267e-6
Identity = 32/105 (30.48%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDND-GYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEI 562
            EA+  L+ +L +DIN+        ALH A   GH  T K L++ GA ++++   G +ALH +     ++ + +LL  G+ T+     G TA      ++ I P I
Sbjct:  261 EALSFLVHHLGMDINSRATKLELTALHYAAKEGHTSTIKTLLALGADLHARDAKGRSALHMACIGQHVDTVRMLLQMGL-TDTEDNTGNTA-----RQYAIKPHI 359          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd16 (ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE-041210-253])

HSP 1 Score: 75.485 bits (184), Expect = 2.161e-15
Identity = 44/121 (36.36%), Postives = 70/121 (57.85%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEIL-ALLLSHCDI 592
            A  G+++ ++ L+E L +DI   ++D  RALH A   GH E  ++LI +GAKV+S  +  WT L  +     LE I+ LL+ G +  +  + G ++ H+AC + D  P I+  LLL+  DI
Sbjct:   53 ARHGHVDILRYLVEELNMDIEVYNSDYKRALHEASSMGHYECVRFLICRGAKVDSLKKADWTPLMMACTRRNLEVIQELLDYGADPTLQNKDGWSSFHIACREGD--PAIINHLLLAKPDI 171          

HSP 2 Score: 47.7506 bits (112), Expect = 5.512e-6
Identity = 32/100 (32.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISK-GAKVNSQ-TQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            G++   K+LLE+ +   +A D  G + LH+A      E   +L+   G  +NS+ T+L  TALH +        I+ LL  G + +     G++ALH+AC
Sbjct:  224 GHIAVAKLLLEDHQASPSAVDILGAQPLHQASVTAQEEALSFLVHHLGMDINSRATKLELTALHYAAKEGHTSTIKTLLALGADLHARDAKGRSALHMAC 323          

HSP 3 Score: 47.3654 bits (111), Expect = 6.997e-6
Identity = 32/105 (30.48%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDND-GYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEI 562
            EA+  L+ +L +DIN+        ALH A   GH  T K L++ GA ++++   G +ALH +     ++ + +LL  G+ T+     G TA      ++ I P I
Sbjct:  261 EALSFLVHHLGMDINSRATKLELTALHYAAKEGHTSTIKTLLALGADLHARDAKGRSALHMACIGQHVDTVRMLLQMGL-TDTEDNTGNTA-----RQYAIKPHI 359          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 73.1738 bits (178), Expect = 1.816e-14
Identity = 38/101 (37.62%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A +G+LE +++LL     +INA D    RA+H A Y GH+E  K L+S GA+V  + +  +T LH++     +  ++ LL+ G++ N P   G T LH+AC
Sbjct:  148 AFSGHLEMVRLLLSR-GANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVAC 247          

HSP 2 Score: 61.6178 bits (148), Expect = 1.738e-10
Identity = 36/107 (33.64%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALH-SSVYWNQLECIELLLNSGINTNIPTEGGQTALHL 529
            +  L + A +G +  +K LL+ + +D+N  +  G   LH ACYNG       LI  GA VN   + G+  LH ++   +   C+ELL+ +G + NI ++ G+T LH+
Sbjct:  207 YTPLHAAASSGMISVVKYLLD-MGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHM 312          

HSP 3 Score: 58.151 bits (139), Expect = 2.074e-9
Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACS 538
            EA+  LL N    +N  D  G  ALH A ++GH+E  + L+S+GA +N+  +    A+H + Y   +E ++LL++ G       +   T LH A S
Sbjct:  124 EALVPLLSN----VNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAAS 215          

HSP 4 Score: 58.151 bits (139), Expect = 2.739e-9
Identity = 41/124 (33.06%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            H+ + S +E    EA+++LL++   D+NA D +    LH A  N  V  A+ L+   + VN   + G TALH + +   LE + LLL+ G N N   +  + A+H A   +  + E++ LL+SH
Sbjct:   79 HRAVASCSE----EAVQVLLKH-SADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWA--AYMGHMEVVKLLVSH 195          

HSP 5 Score: 51.2174 bits (121), Expect = 4.820e-7
Identity = 31/104 (29.81%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  227 SEAEAGNLEAIKILLEN--LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            + A  G+ E +++L+ N  L+  ++ +D  G   L  +   GH +    LI+KGA V+++ + G TALH        EC+E LL    +  +    G++ +HLA
Sbjct:  623 AAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLA 726          

HSP 6 Score: 51.2174 bits (121), Expect = 5.139e-7
Identity = 30/99 (30.30%), Postives = 46/99 (46.46%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHL 529
            A  G++E +K+L+ +   ++  +D   Y  LH A  +G +   KYL+  G  +N     G T LH + Y  Q   +  L+  G N N   E G   LH 
Sbjct:  181 AYMGHMEVVKLLVSH-GAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHF 278          

HSP 7 Score: 51.2174 bits (121), Expect = 5.430e-7
Identity = 34/104 (32.69%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIY-PEILALLLSHCDIN 595
            D+N +DN+    LH A Y G  E  + LI  GA+VN++     T LH +V     E +++LL    + N   +  QT LH+A +   +   E L  LLS+ +++
Sbjct:   33 DVNVQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVS 136          

HSP 8 Score: 49.6766 bits (117), Expect = 1.514e-6
Identity = 34/101 (33.66%), Postives = 52/101 (51.49%), Query Frame = 2
Query:  245 NLEAIKILLENLE-IDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSG-INTNIPTEGGQTALHLACSK 541
            N  A+++L+E L  + +NA D+     LH A +  HVE  + L+   A+VN     G T L  +    Q   +E+L++S   +  +      TALHLACSK
Sbjct:  800 NEGAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSK 900          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: ANKRD49 (ankyrin repeat domain 49 [Source:NCBI gene;Acc:100487113])

HSP 1 Score: 104.375 bits (259), Expect = 2.034e-26
Identity = 63/161 (39.13%), Postives = 85/161 (52.80%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFF 670
            E +++ +P + ++  AE   L  ++ +L N    +NA D+D Y  LHRA YNGH+  A+ LI  GA V++ T  GWT LHS+  WN       LL  G + N  T+G  T LHLA        EIL LLL +  IN  LKN   +T  E+  R   Y Y F
Sbjct:   87 EEKLQQNPKELILFAAENNRLSTVQTVLSNHPNLVNAVDDDHYTPLHRAAYNGHLGIARELIGHGADVHAITVDGWTPLHSACKWNNTSVASFLLQHGADINAQTKGLLTPLHLASGNRGSR-EILELLLMNRYINPHLKNKAGETAFEIAQRTDVYHYLF 246          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 74.3294 bits (181), Expect = 1.266e-14
Identity = 45/128 (35.16%), Postives = 71/128 (55.47%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            K+D +   +  A +GNLE     L+N  +DIN  + +G  ALH A   GHVE    LI +GA V++ T+ G TALH +    Q E + +L+ +G N N  ++ G T L++A  +  +  E++  LL +
Sbjct:   21 KSDTNASYLRAARSGNLEKALDYLKN-GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHL--EVVKFLLDN 145          

HSP 2 Score: 64.6994 bits (156), Expect = 2.542e-11
Identity = 37/117 (31.62%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            ++ G++E +  L++    D++A    G  ALH A   G  E  + L++ GA VN+Q+Q G+T L+ +   N LE ++ LL++G + ++ TE G T L +A  +   + ++++LLL +
Sbjct:   65 SKEGHVEIVSELIQR-GADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG--HDQVVSLLLEN 178          

HSP 3 Score: 60.077 bits (144), Expect = 7.119e-10
Identity = 41/137 (29.93%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +  +L  +++LL++  + ++   ND   ALH A + GH + AK L+ K A  N++   G+T LH +   N+L+ +ELLL  G +    TE G T +H+A   F  +  I++  L+H   + +  N + +T + +  R
Sbjct:  326 QGDHLNCVQLLLQH-NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAA--FMGHVNIVS-QLNHHGASPNTTNVRGETALHMAAR 458          

HSP 4 Score: 56.225 bits (134), Expect = 1.378e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEIL 565
            ++ GN   +K+LL+     I+A+  DG   LH    +GH +    L+ +GA + S+T+ G + LH +   + L C++LLL   +  +  T    TALH+A  C  + +   +L
Sbjct:  259 SKRGNANMVKLLLDRGS-KIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 5 Score: 51.6026 bits (122), Expect = 5.935e-7
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+ G +E +K+LL+      +A    G   LH A +  + + A  L+ KGA  +   + G+T LH +   NQ++    LL  G + N  T+ G   +HLA  +  +  ++++LLL+    N+++ N    T + L  +
Sbjct:  556 AKYGKIEVVKLLLQK-NASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHV--DMVSLLLTR-SANVNVSNKSGLTPLHLAAQ 689          

HSP 6 Score: 51.6026 bits (122), Expect = 5.990e-7
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  314 YRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            Y  LH A + G+++   +L+  G+KVN++T+ G+T LH +        I +LL  G + N  T  G TAL +A
Sbjct:  714 YTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIA 786          

HSP 7 Score: 49.6766 bits (117), Expect = 2.060e-6
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            EA+ K D     IS A  G  + ++ LL+      +A    GY  LH +   GH + A  L+  GA     T+ G+T LH +  + ++E ++LLL    + +   + G T LH+A
Sbjct:  476 EAKAKDDQTPLHIS-ARLGKADIVQQLLKQGAYP-DAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVA 588          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 73.9442 bits (180), Expect = 1.595e-14
Identity = 45/128 (35.16%), Postives = 71/128 (55.47%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            K+D +   +  A +GNLE     L+N  +DIN  + +G  ALH A   GHVE    LI +GA V++ T+ G TALH +    Q E + +L+ +G N N  ++ G T L++A  +  +  E++  LL +
Sbjct:   23 KSDTNASYLRAARSGNLEKALDYLKN-GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHL--EVVKFLLDN 147          

HSP 2 Score: 64.3142 bits (155), Expect = 3.137e-11
Identity = 37/117 (31.62%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            ++ G++E +  L++    D++A    G  ALH A   G  E  + L++ GA VN+Q+Q G+T L+ +   N LE ++ LL++G + ++ TE G T L +A  +   + ++++LLL +
Sbjct:   67 SKEGHVEIVSELIQR-GADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG--HDQVVSLLLEN 180          

HSP 3 Score: 60.077 bits (144), Expect = 8.614e-10
Identity = 41/137 (29.93%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +  +L  +++LL++  + ++   ND   ALH A + GH + AK L+ K A  N++   G+T LH +   N+L+ +ELLL  G +    TE G T +H+A   F  +  I++  L+H   + +  N + +T + +  R
Sbjct:  328 QGDHLNCVQLLLQH-NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAA--FMGHVNIVS-QLNHHGASPNTTNVRGETALHMAAR 460          

HSP 4 Score: 56.225 bits (134), Expect = 1.651e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEIL 565
            ++ GN   +K+LL+     I+A+  DG   LH    +GH +    L+ +GA + S+T+ G + LH +   + L C++LLL   +  +  T    TALH+A  C  + +   +L
Sbjct:  261 SKRGNANMVKLLLDRGS-KIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 372          

HSP 5 Score: 51.2174 bits (121), Expect = 6.903e-7
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  314 YRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            Y  LH A + G+++   +L+  G+KVN++T+ G+T LH +        I +LL  G + N  T  G TAL +A
Sbjct:  716 YTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIA 788          

HSP 6 Score: 51.2174 bits (121), Expect = 7.293e-7
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+ G +E +K+LL+      +A    G   LH A +  + + A  L+ KGA  +   + G+T LH +   NQ++    LL  G + N  T+ G   +HLA  +  +  ++++LLL+    N+++ N    T + L  +
Sbjct:  558 AKYGKIEVVKLLLQK-NASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHV--DMVSLLLTR-SANVNVSNKSGLTPLHLAAQ 691          

HSP 7 Score: 49.6766 bits (117), Expect = 2.438e-6
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            EA+ K D     IS A  G  + ++ LL+      +A    GY  LH +   GH + A  L+  GA     T+ G+T LH +  + ++E ++LLL    + +   + G T LH+A
Sbjct:  478 EAKAKDDQTPLHIS-ARLGKADIVQQLLKQGAYP-DAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVA 590          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 73.9442 bits (180), Expect = 1.884e-14
Identity = 45/128 (35.16%), Postives = 71/128 (55.47%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            K+D +   +  A +GNLE     L+N  +DIN  + +G  ALH A   GHVE    LI +GA V++ T+ G TALH +    Q E + +L+ +G N N  ++ G T L++A  +  +  E++  LL +
Sbjct:   21 KSDTNASYLRAARSGNLEKALDYLKN-GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHL--EVVKFLLDN 145          

HSP 2 Score: 63.929 bits (154), Expect = 3.700e-11
Identity = 37/117 (31.62%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            ++ G++E +  L++    D++A    G  ALH A   G  E  + L++ GA VN+Q+Q G+T L+ +   N LE ++ LL++G + ++ TE G T L +A  +   + ++++LLL +
Sbjct:   65 SKEGHVEIVSELIQR-GADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG--HDQVVSLLLEN 178          

HSP 3 Score: 59.6918 bits (143), Expect = 1.044e-9
Identity = 41/137 (29.93%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +  +L  +++LL++  + ++   ND   ALH A + GH + AK L+ K A  N++   G+T LH +   N+L+ +ELLL  G +    TE G T +H+A   F  +  I++  L+H   + +  N + +T + +  R
Sbjct:  326 QGDHLNCVQLLLQH-NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAA--FMGHVNIVS-QLNHHGASPNTTNVRGETALHMAAR 458          

HSP 4 Score: 55.8398 bits (133), Expect = 1.926e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEIL 565
            ++ GN   +K+LL+     I+A+  DG   LH    +GH +    L+ +GA + S+T+ G + LH +   + L C++LLL   +  +  T    TALH+A  C  + +   +L
Sbjct:  259 SKRGNANMVKLLLDRGS-KIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 5 Score: 51.2174 bits (121), Expect = 7.342e-7
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  314 YRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            Y  LH A + G+++   +L+  G+KVN++T+ G+T LH +        I +LL  G + N  T  G TAL +A
Sbjct:  714 YTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIA 786          

HSP 6 Score: 50.8322 bits (120), Expect = 8.578e-7
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+ G +E +K+LL+      +A    G   LH A +  + + A  L+ KGA  +   + G+T LH +   NQ++    LL  G + N  T+ G   +HLA  +  +  ++++LLL+    N+++ N    T + L  +
Sbjct:  556 AKYGKIEVVKLLLQK-NASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHV--DMVSLLLTR-SANVNVSNKSGLTPLHLAAQ 689          

HSP 7 Score: 49.2914 bits (116), Expect = 2.893e-6
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            EA+ K D     IS A  G  + ++ LL+      +A    GY  LH +   GH + A  L+  GA     T+ G+T LH +  + ++E ++LLL    + +   + G T LH+A
Sbjct:  476 EAKAKDDQTPLHIS-ARLGKADIVQQLLKQGAYP-DAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVA 588          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 73.1738 bits (178), Expect = 3.690e-14
Identity = 46/137 (33.58%), Postives = 75/137 (54.74%), Query Frame = 2
Query:  173 IHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            IH +  +  ++D +   +  A +GNLE     L+N  +DIN  + +G  ALH A   GHVE    LI +GA V++ T+ G TALH +    Q E + +L+ +G N N  ++ G T L++A  +  +  E++  LL +
Sbjct:   15 IHIFFFSLFQSDTNASYLRAARSGNLEKALDYLKN-GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHL--EVVKFLLDN 148          

HSP 2 Score: 63.5438 bits (153), Expect = 5.804e-11
Identity = 37/117 (31.62%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            ++ G++E +  L++    D++A    G  ALH A   G  E  + L++ GA VN+Q+Q G+T L+ +   N LE ++ LL++G + ++ TE G T L +A  +   + ++++LLL +
Sbjct:   68 SKEGHVEIVSELIQR-GADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG--HDQVVSLLLEN 181          

HSP 3 Score: 59.3066 bits (142), Expect = 1.742e-9
Identity = 41/137 (29.93%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +  +L  +++LL++  + ++   ND   ALH A + GH + AK L+ K A  N++   G+T LH +   N+L+ +ELLL  G +    TE G T +H+A   F  +  I++  L+H   + +  N + +T + +  R
Sbjct:  337 QGDHLNCVQLLLQH-NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAA--FMGHVNIVS-QLNHHGASPNTTNVRGETALHMAAR 469          

HSP 4 Score: 55.4546 bits (132), Expect = 2.866e-8
Identity = 34/113 (30.09%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEIL 565
            ++ GN   +K+LL+     I+A+  DG   LH    +GH +    L+ +GA + S+T+ G + LH +   + L C++LLL   +  +  T    TALH+A  C  + +   +L
Sbjct:  270 SKRGNANMVKLLLDRGS-KIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 381          

HSP 5 Score: 50.8322 bits (120), Expect = 1.048e-6
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 2
Query:  314 YRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            Y  LH A + G+++   +L+  G+KVN++T+ G+T LH +        I +LL  G + N  T  G TAL +A
Sbjct:  725 YTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIA 797          

HSP 6 Score: 50.447 bits (119), Expect = 1.330e-6
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+ G +E +K+LL+      +A    G   LH A +  + + A  L+ KGA  +   + G+T LH +   NQ++    LL  G + N  T+ G   +HLA  +  +  ++++LLL+    N+++ N    T + L  +
Sbjct:  567 AKYGKIEVVKLLLQK-NASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHV--DMVSLLLTR-SANVNVSNKSGLTPLHLAAQ 700          

HSP 7 Score: 48.9062 bits (115), Expect = 4.086e-6
Identity = 35/115 (30.43%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            EA+ K D     IS A  G  + ++ LL+      +A    GY  LH +   GH + A  L+  GA     T+ G+T LH +  + ++E ++LLL    + +   + G T LH+A
Sbjct:  487 EAKAKDDQTPLHIS-ARLGKADIVQQLLKQGAYP-DAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVA 599          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd49 (ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MGI:1930842])

HSP 1 Score: 107.842 bits (268), Expect = 3.868e-28
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            E +++ DP K L+  AE   L  ++ LL     ++N  D D Y  LHRA Y+GH++  + L++KGA V++ T  GWT LHS+  WN  +    LL    + N  T+G  T LHLA    D   + L LLL +  I  +LKN  ++T  ++  R + Y Y F   + C 
Sbjct:   66 EKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSR-DTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCT 232          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd49 (ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MGI:1930842])

HSP 1 Score: 107.842 bits (268), Expect = 3.868e-28
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            E +++ DP K L+  AE   L  ++ LL     ++N  D D Y  LHRA Y+GH++  + L++KGA V++ T  GWT LHS+  WN  +    LL    + N  T+G  T LHLA    D   + L LLL +  I  +LKN  ++T  ++  R + Y Y F   + C 
Sbjct:   66 EKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSR-DTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCT 232          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd49 (ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MGI:1930842])

HSP 1 Score: 107.842 bits (268), Expect = 3.868e-28
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            E +++ DP K L+  AE   L  ++ LL     ++N  D D Y  LHRA Y+GH++  + L++KGA V++ T  GWT LHS+  WN  +    LL    + N  T+G  T LHLA    D   + L LLL +  I  +LKN  ++T  ++  R + Y Y F   + C 
Sbjct:   66 EKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSR-DTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCT 232          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd39 (ankyrin repeat domain 39 [Source:MGI Symbol;Acc:MGI:1914816])

HSP 1 Score: 71.2478 bits (173), Expect = 9.293e-15
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  215 KQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            + + S A  G+L  +K  ++    D +  D+ GY ALH A  NGH    ++L+  GAK ++QT  G TALH + Y    E   LLL+ G N  +    G T+LH A  K   + +I +LLL H
Sbjct:   33 RGIWSAALNGDLGRVKYFIQK-ATDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPWLVDNDGMTSLHKAAEKG--HEDICSLLLQH 152          

HSP 2 Score: 50.8322 bits (120), Expect = 2.019e-7
Identity = 40/131 (30.53%), Postives = 56/131 (42.75%), Query Frame = 2
Query:  299 EDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH------------CDINLDLKNAQEDTCMELVTRHTP 655
            E+ D  R +  A  NG +   KY I K    +     G+TALH +         + LL SG   +  T GG TALH A   +  + EI  LLLSH              ++   +   ED C  L+ +H+P
Sbjct:   27 EEMDFDRGIWSAALNGDLGRVKYFIQKATDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRA--SYCGHTEIARLLLSHGSNPWLVDNDGMTSLHKAAEKGHEDIC-SLLLQHSP 154          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 71.633 bits (174), Expect = 4.941e-14
Identity = 47/145 (32.41%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  104 KVFKAKADNPEMFVSNWEEDNTNI-HSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            KV +A+ D  E  +    +    I     E + K+D +   +  A AGNL+ +   L+   IDIN  + +G  ALH A   GHV   + L+ +G+ V+S T+ G TALH +    Q E +++L+  G N N  ++ G T L++A 
Sbjct:   10 KVREAELDEKEKNLDRERKKQRKIPRDRMERKRKSDSNASFLRAARAGNLDKVVEYLKG-GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAA 153          

HSP 2 Score: 49.2914 bits (116), Expect = 1.651e-6
Identity = 35/124 (28.23%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  239 AGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKN 610
            AG  E +K+L++    +INA+  +G+  L+ A    H++  KYL+  GA  ++ T+ G+T L  ++     + + +LL +     +       ALH+A  K D      A LL   D N D+++
Sbjct:  122 AGQAEVVKVLVKE-GANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLP----ALHIAARKDDTKS---AALLLQNDHNADVQS 237          

HSP 3 Score: 48.9062 bits (115), Expect = 2.276e-6
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  290 INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            +N     G+  LH A + G+V  A  L+++GA V+   + G T LH +        ++LLL+ G   +  T  G T LH  C+    + +++ LLL
Sbjct:  241 VNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLH--CAARSGHDQVVELLL 334          

HSP 4 Score: 48.1358 bits (113), Expect = 4.652e-6
Identity = 32/113 (28.32%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEIL 565
            ++ GN   +K+LL+     I+A+  DG   LH A  +GH +  + L+ + A + ++T+ G + LH +   + +EC++ LL      +  T    TALH+A  C  + +   +L
Sbjct:  289 SKRGNTNMVKLLLDR-GGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLL 400          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5EA33|ANR49_BOVIN (Ankyrin repeat domain-containing protein 49 OS=Bos taurus OX=9913 GN=ANKRD49 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.261e-27
Identity = 65/182 (35.71%), Postives = 89/182 (48.90%), Query Frame = 2
Query:  155 EEDNTNIHSW---TEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            EE +     W    E +++ DP K L+  AE   L  ++ LL      +N  D D Y  LHRA YNGH++  + LI+ GA V++ T  GWT LHS+  WN       LL    + N  T+G  T LHLA    D   + L LLL +  I   LKN+ E+T  ++  R   Y Y F   + C 
Sbjct:   52 EEQDEKTEEWYQLQEKKMEKDPSKLLLWAAEKNRLTTVQRLLSERATHVNTRDEDKYTPLHRAAYNGHLDVVRELIAHGADVHAVTVDGWTPLHSACKWNNARVASFLLQHDADVNAQTKGLLTPLHLAAGNRD-SKDTLELLLMNRYIKPGLKNSLEETAFDIARRTGIYHYLFEIVEGCT 232          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VE42|ANR49_MOUSE (Ankyrin repeat domain-containing protein 49 OS=Mus musculus OX=10090 GN=Ankrd49 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.705e-27
Identity = 60/168 (35.71%), Postives = 89/168 (52.98%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            E +++ DP K L+  AE   L  ++ LL     ++N  D D Y  LHRA Y+GH++  + L++KGA V++ T  GWT LHS+  WN  +    LL    + N  T+G  T LHLA    D   + L LLL +  I  +LKN  ++T  ++  R + Y Y F   + C 
Sbjct:   66 EKKMEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADVHAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSR-DTLELLLMNRYIKPELKNNSQETASDIARRTSIYHYLFEIAEGCT 232          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WVL7|ANR49_HUMAN (Ankyrin repeat domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ANKRD49 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.004e-26
Identity = 64/191 (33.51%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  137 MFVSNWEED------NTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            ++V N +ED      N   +   E +++ DP + L+  AE   L  ++ LL      +N  D D Y  LHRA Y+GH++  + LI++GA V++ T  GWT LHS+  WN       LL    + N  T+G  T LHLA    D   + L LLL +  +   LKN  E+T  ++  R + Y Y F   + C 
Sbjct:   44 LWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRD-SKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCT 233          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P17221|FEM1_CAEEL (Sex-determining protein fem-1 OS=Caenorhabditis elegans OX=6239 GN=fem-1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.082e-16
Identity = 50/148 (33.78%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  194 EIKADPHKQLISE---------------AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDI 592
            EI ADP  + + E               + AG++E +K+L+E    D+N   N     L  ACY+GH++  KYL+ KGA  +   + G T L  + Y N++  +E LL +GI+ N  TE G TALH A    ++  E++ +LL H  +
Sbjct:   69 EIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIEIVKLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASYRNKVGIVEELLKTGIDVNKKTERGNTALHDAAESGNV--EVVKILLKHGSV 214          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q53RE8|ANR39_HUMAN (Ankyrin repeat domain-containing protein 39 OS=Homo sapiens OX=9606 GN=ANKRD39 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.818e-16
Identity = 46/119 (38.66%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  227 SEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            S A  G+L  +K L++  E D +  D+ GY ALH A  NGH    ++L+  GAK ++QT  G TALH + Y    E   LLL+ G N  +  + G T+LH A  +   + +I +LLL H
Sbjct:   37 SAALNGDLGRVKHLIQKAE-DPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPRVVDDDGMTSLHKAAERG--HGDICSLLLQH 152          

HSP 2 Score: 50.0618 bits (118), Expect = 2.432e-6
Identity = 35/102 (34.31%), Postives = 47/102 (46.08%), Query Frame = 2
Query:  278 LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            L +    E+ D  R +  A  NG +   K+LI K    +     G+TALH +         + LL SG   +  T GG TALH A   +  + EI  LLLSH
Sbjct:   20 LGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRA--SYCGHTEIARLLLSH 119          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A0X3PCM2 (Ankyrin repeat domain-containing protein 49 OS=Schistocephalus solidus OX=70667 GN=ANR49 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.032e-50
Identity = 84/205 (40.98%), Postives = 129/205 (62.93%), Query Frame = 2
Query:  101 DKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAE-----DNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQL 700
            +++ +AK  NP MFVS W+ D  +I  WT+ +++ D  KQL+  AE G+++A++  L NL      E     D+DGY ALHRA Y GH +  +YL+S+GA+V++++  GWT LHS+ +WNQ  C++LL+ +G + N  T   Q+ LHLA S  +   E L  LL H +IN+D+KN+  DT  +L+ R+T  +Y  YP  +  T+L
Sbjct:   20 EEIMRAKERNPGMFVSAWQADEEDIDQWTKKQLRRDRRKQLVVAAERGDMDALRSNLANLTPAEKEEFLLFTDDDGYTALHRAVYGGHYDVVEYLLSEGARVDTRSVDGWTPLHSAAFWNQTACVQLLIEAGADMNALTNSNQSLLHLAVSN-NTTVETLCYLLGHPNINVDVKNSGGDTPADLLKRNTSLSYLLYPLTAEATRL 223          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A0X3PK70 (ANK_REP_REGION domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR160548 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.775e-50
Identity = 84/205 (40.98%), Postives = 129/205 (62.93%), Query Frame = 2
Query:  101 DKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAE-----DNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQL 700
            +++ +AK  NP MFVS W+ D  +I  WT+ +++ D  KQL+  AE G+++A++  L NL      E     D+DGY ALHRA Y GH +  +YL+S+GA+V++++  GWT LHS+ +WNQ  C++LL+ +G + N  T   Q+ LHLA S  +   E L  LL H +IN+D+KN+  DT  +L+ R+T  +Y  YP  +  T+L
Sbjct:   23 EEIMRAKERNPGMFVSAWQADEEDIDQWTKKQLRRDRRKQLVVAAERGDMDALRSNLANLTPAEKEEFLLFTDDDGYTALHRAVYGGHYDVVEYLLSEGARVDTRSVDGWTPLHSAAFWNQTACVQLLIEAGADMNALTNSNQSLLHLAVSN-NTTVETLCYLLGHPNINVDVKNSGGDTPADLLKRNTSLSYLLYPLTAEATRL 226          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A4S2LB05 (ANK_REP_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008651 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.201e-49
Identity = 92/216 (42.59%), Postives = 127/216 (58.80%), Query Frame = 2
Query:  101 DKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDIN-------------AEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINL-DLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE 706
            D+V  AK +NP MFVS WE D  +I  W++A+I+ADP KQ I  AE G L+ I  ++   E +++             A+D DGY ALHRA Y GH    + L+  G  VNS+T  GWT LHS+ +WNQL C++LLL++G + N  T   QTALHLA S  +  PE L  LLS  + ++  ++N   DT  +L+ R+TPY+   Y F    TQL +
Sbjct:   17 DEVMTAKRNNPGMFVSAWEADENDIEQWSKAQIRADPIKQFIVAAENGRLDTINEIVCRAEKNVSDPIPYPTLSELLAAKDQDGYTALHRAAYGGHAHVVERLLQLGGDVNSRTMDGWTPLHSAAFWNQLACVQLLLSAGADLNAVTNSNQTALHLAVSN-NQSPETLYFLLSQPNASVYGIRNQLGDTVADLIERNTPYSDLCYVFSEHVTQLGQ 231          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: G4VK61 (Putative fetal globin-inducing factor OS=Schistosoma mansoni OX=6183 GN=Smp_069840 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.488e-49
Identity = 90/212 (42.45%), Postives = 129/212 (60.85%), Query Frame = 2
Query:  101 DKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENL-------EIDI----NAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINL-DLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQL 700
            D+V  AK +NP MFVS W+ D  +I+ WT  +IK DP KQ I  AE  +L  I+ L+E+        E+++    +A+D DGY ALHRA Y GHVE  +YL+  GA +N++T+ GWT LHS+ +WN+L C++LL+++G + N  T  GQTALHLA S  +  PE L LL++     +  ++N   D   ++V R+TPY    Y F    T L
Sbjct:   18 DEVMAAKRNNPGMFVSAWQADENDINLWTNDQIKDDPKKQFIVAAENNDLSTIRSLIESAKQKGADGEVELRELLSAKDQDGYTALHRAAYGGHVEVLQYLMKYGANINNRTEDGWTPLHSAAFWNKLSCVQLLISAGADLNALTNSGQTALHLAVSN-NQGPETLYLLIAQPGAPVYGVRNKLGDEVADIVKRNTPYGDICYAFSEPATNL 228          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: G7YKG2 (Ankyrin repeat domain-containing protein 49 OS=Clonorchis sinensis OX=79923 GN=ANKRD49 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 6.787e-49
Identity = 91/216 (42.13%), Postives = 125/216 (57.87%), Query Frame = 2
Query:  101 DKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDIN-------------AEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINL-DLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE 706
            D++  AK +NP MFVS WE D  +I  W++A+I+ADP KQ I  AE G L+ I  ++   E  ++             A+D DGY ALHRA Y GH    + L+  G  VNS+T  GWT LHS+ +WNQL C++LLL++G + N  T   QTALHLA S  +  PE L  LLS  + ++  ++N   DT  +L+ R+TPY+   Y F    TQL  
Sbjct:   17 DEIMTAKRNNPGMFVSAWEADENDIEQWSKAQIRADPIKQFIVAAENGKLDTINEIVCRAEKTVSDPTPYPTLSELLAAKDQDGYTALHRAAYGGHAHVVERLLQLGGDVNSRTMDGWTPLHSAAFWNQLACVQLLLSAGADLNAVTNSNQTALHLAVSN-NQSPETLYFLLSQPNASVYGIRNQLGDTVADLIERNTPYSDLCYVFSEHVTQLGR 231          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd49 (ankyrin repeat domain 49 [Source:NCBI gene;Acc:103026728])

HSP 1 Score: 83.5741 bits (205), Expect = 3.021e-19
Identity = 55/168 (32.74%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCC 691
            E ++K  P + ++  AE   L  +K LLE+    +N  D+D Y  LHRA Y+GH+     L+  GA+++++T  GWT LHS+  W        LL  G   N  T G  T L LA          L LLLS   + + LKN+  +T  ++  R + + Y  +  K  C
Sbjct:   53 EVKLKDSPAELMLWAAEKNRLATVKRLLESDPSLVNCRDDDSYTPLHRAAYSGHLSVVSALLDAGAELHARTVDGWTPLHSASRWGHTAIASCLLRRGAEVNAVTTGRLTPLQLAAGN-PAAALTLELLLSQRSLQVGLKNSAGETACDIALRTSAH-YSLFEMKEPC 218          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankrd16 (ankyrin repeat domain 16 [Source:NCBI gene;Acc:103023190])

HSP 1 Score: 73.1738 bits (178), Expect = 1.160e-14
Identity = 42/129 (32.56%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  200 KADPHKQLISE-------------AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFD 547
            K DP KQ +               A  G+LE ++ L+E++ +DI   ++D  RALH A    H +  +YLI +GAK+++  +  WT L  +     LE I+LLL+ G +  I  + G  + H+AC + D
Sbjct:   28 KKDPMKQTLQAHFGRSGDTLLHYAARHGHLEVLRYLVEDVGMDIELYNSDYKRALHEAASMSHEQCVQYLIHRGAKIDTLKKADWTPLMMACTRRNLEVIKLLLDHGADPTIRNKDGWNSFHIACREGD 156          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.773e-14
Identity = 39/97 (40.21%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            G+LE +K+L+     D + +D  GY  LH A  +GHV+  KYL+  GA+++     G TALH + Y  Q      L+N G N N P   G T LHLA
Sbjct:  170 GHLEVVKLLVSQGS-DKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHLA 265          

HSP 2 Score: 64.3142 bits (155), Expect = 8.478e-12
Identity = 34/101 (33.66%), Postives = 59/101 (58.42%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A++G  E +K+LL N    ++A D    + +H A Y GH+E  K L+S+G+  + + + G+T LH++     ++ ++ LL +G   + P   G TALH+AC
Sbjct:  134 AQSGCQEMVKLLL-NKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVAC 233          

HSP 3 Score: 46.9802 bits (110), Expect = 6.675e-6
Identity = 26/87 (29.89%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  290 INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDI 550
            +N  D  G  ALH A  +G  E  K L++KGA +++  +     +H + Y   LE ++LL++ G + +   + G T LH A +   +
Sbjct:  119 LNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHV 205          

HSP 4 Score: 46.595 bits (109), Expect = 8.886e-6
Identity = 35/123 (28.46%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  290 INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKF------DIYPEILALLLSHCDINLDLKNAQEDTCMELV 640
             N  D +    LH A + G V     LIS GA VN++  +  T LH +        + LLL  G +     +  QTALH+A +         + P I +L ++       L +A +  C E+V
Sbjct:   20 FNRNDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMV 142          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankk1 (ankyrin repeat and kinase domain containing 1 [Source:NCBI gene;Acc:103036669])

HSP 1 Score: 72.4034 bits (176), Expect = 3.325e-14
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  266 LLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            LL N   + N   N  +  +H A   GH ET   L      ++++ Q GWT LH + +  Q E + +LL +G N N+  +G  T LHLAC+K   +P  L L+  H D+N   +N  +DT + L  +
Sbjct:  575 LLMNHGANPNFTTNQKWTPMHLAALKGHPETVLILEENKGSMDARGQGGWTPLHLACHHMQEEVVAVLLTAGANPNLKEDGSWTPLHLACNK-GAFPSTLQLIAKHADVN--AQNNSKDTPLHLAVQ 698          

HSP 2 Score: 59.3066 bits (142), Expect = 8.400e-10
Identity = 35/100 (35.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQL-GWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +AGN  A+++LL++ +   +A+D DG+  LH A  NGH    + L+ +   V+ Q +  G T+LH +  +  L   +LLL  G + N+      TALHLA
Sbjct:  433 QAGNDRAVRMLLDH-KATADAKDKDGWTPLHLAAQNGHEGVVRLLLPRLVSVDEQEETSGRTSLHMACMYGYLNIAKLLLAKGADPNMTDSDQATALHLA 531          

HSP 3 Score: 58.151 bits (139), Expect = 2.047e-9
Identity = 40/111 (36.04%), Postives = 53/111 (47.75%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALL 574
            G L   K+LL     D N  D+D   ALH A   GH   A+ L++KGA VN      ++ALH +          LL+N G N N  T    T +HLA  K   +PE + +L
Sbjct:  502 GYLNIAKLLLAK-GADPNMTDSDQATALHLAAEEGHFRVARLLVTKGADVNRVNGSNYSALHFAALRGCTGICRLLMNHGANPNFTTNQKWTPMHLAALKG--HPETVLIL 609          

HSP 4 Score: 49.6766 bits (117), Expect = 1.419e-6
Identity = 31/100 (31.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+ G+   +++LL  L      E+  G  +LH AC  G++  AK L++KGA  N       TALH +          LL+  G + N       +ALH A
Sbjct:  465 AQNGHEGVVRLLLPRLVSVDEQEETSGRTSLHMACMYGYLNIAKLLLAKGADPNMTDSDQATALHLAAEEGHFRVARLLVTKGADVNRVNGSNYSALHFA 564          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 70.8626 bits (172), Expect = 1.080e-13
Identity = 45/132 (34.09%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            E + K+D +   +  A AGNLE     L+   +DIN  + +G  ALH A   GHVE    L+  GA V++ T+ G TALH +    Q + +  L+ +G N N  ++ G T L++A  +  +  E++  LL H
Sbjct:   36 EQKKKSDSNASYLRAARAGNLEKALDYLKT-GVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHL--EVVRFLLEH 164          

HSP 2 Score: 62.003 bits (149), Expect = 1.144e-10
Identity = 38/117 (32.48%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            ++ G++E +  LL+ L   ++A    G  ALH A   G  +  + L++ GA VN+Q+Q G+T L+ +   N LE +  LL  G + +I TE G T L +A  +   + ++++LLL +
Sbjct:   84 SKEGHVEVVAELLK-LGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQG--HDQVVSLLLEN 197          

HSP 3 Score: 59.3066 bits (142), Expect = 7.974e-10
Identity = 38/137 (27.74%), Postives = 73/137 (53.28%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +  +L  +++LL++ ++ ++   ND   ALH A + GH + AK ++ K A  N++   G+T LH +   N+++ +ELLL  G +    TE G T +H+A     +  E +   L+H   + +  N + +T + +  R
Sbjct:  345 QGDHLNCVQLLLQH-DVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAF---MGHENIVKQLTHHGASPNTTNVRGETALHMAAR 477          

HSP 4 Score: 58.151 bits (139), Expect = 1.906e-9
Identity = 43/138 (31.16%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  173 IHSWTEAEIKA-DPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            + +  + +IKA D    L   +  G  E +++LL+      +A    GY  LH A   GH ETA  L+  GA +++ T+ G+T LH +  + Q+E  +LLL      +   + G T LH+A + +D    +  LLL H
Sbjct:  488 LQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAW-ASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVA-AHYD-NQRVALLLLDH 622          

HSP 5 Score: 57.3806 bits (137), Expect = 3.543e-9
Identity = 34/108 (31.48%), Postives = 58/108 (53.70%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDI 550
            A+ GN   +K+LL+     I+A+  DG   LH    +GH +  + L+ +GA + S+T+ G + LH +   + L C++LLL   +  +  T    TALH+A  C  + +
Sbjct:  278 AKRGNGNMVKLLLDR-GAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKV 384          

HSP 6 Score: 57.3806 bits (137), Expect = 3.745e-9
Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  266 LLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +L N   +++A    GY  LH AC+ G+++   +L+   AK+NS+T+ G+T LH +        I +LL    + N  T  G TAL +A
Sbjct:  717 VLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIA 805          

HSP 7 Score: 54.299 bits (129), Expect = 3.868e-8
Identity = 34/97 (35.05%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  293 NAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            N  +  G  ALH A   G  +  +YL+  GAKV+ + +   TALH +    + E ++LLL  G   +  T  G T LHLA    + + E  +LLL H
Sbjct:  462 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVR--EGHQETASLLLEH 556          

HSP 8 Score: 53.9138 bits (128), Expect = 5.487e-8
Identity = 45/139 (32.37%), Postives = 69/139 (49.64%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLS-HCDINLDLKN--------AQED 622
            A+ G +EA K+LL+       A    G   LH A +  +   A  L+  GA  ++  + G+T LH +   NQLE    LL  G  TN  T  G + LHLA  +  +  ++++LLL+ + ++N+  KN        AQED
Sbjct:  575 AKYGQIEAAKLLLQKRAAPDTA-GKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSV--DLVSLLLTKNANVNMGNKNGLTPLHLAAQED 710          

HSP 9 Score: 53.5286 bits (127), Expect = 7.711e-8
Identity = 35/101 (34.65%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            A+   LE    LLE    + NA    G   LH A   G V+    L++K A VN   + G T LH +   +++   E+LLN G   +  T+ G T LH+AC
Sbjct:  641 AKKNQLEIGTTLLE-FGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVAC 740          

HSP 10 Score: 51.9878 bits (123), Expect = 2.763e-7
Identity = 31/100 (31.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            G+ E   +LLE+    ++A    G+  LH A   G +E AK L+ K A  ++  + G T LH + +++      LLL+ G + +   + G T LH+A  K
Sbjct:  545 GHQETASLLLEH-GASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKK 643          

HSP 11 Score: 48.9062 bits (115), Expect = 2.844e-6
Identity = 33/96 (34.38%), Postives = 46/96 (47.92%), Query Frame = 2
Query:  290 INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            + A    G   +H A + GH    K L   GA  N+    G TALH +    Q + +  LL +G   +I  +  QTALH+A S+     EI+ LLL
Sbjct:  428 LQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIA-SRLG-KAEIVQLLL 521          

HSP 12 Score: 48.521 bits (114), Expect = 3.807e-6
Identity = 31/111 (27.93%), Postives = 54/111 (48.65%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            + + +LL +     +A   +GY  LH A     +E    L+  GA+ N+ T+ G + LH +     ++ + LLL    N N+  + G T LHLA  +  +   +  +LL+H
Sbjct:  613 QRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRV--GVAEVLLNH 721          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008505.1 (pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 gene:ENSPMAG00000007672.1 transcript:ENSPMAT00000008505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.021e-15
Identity = 48/128 (37.50%), Postives = 68/128 (53.12%), Query Frame = 2
Query:  215 KQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDIN 595
            KQLISEA  GN+  ++ L++     INA+  +G  ALH A + GH++ A+ L+  GA        G TALH + + N+     LL++     N     G+TALHLA  K   Y E+   L  H CD+N
Sbjct:  421 KQLISEAAQGNVGNVQKLVQLFPGQINAQ-QEGRTALHVAAHQGHIDVARALLKAGASTEIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKG--YGEVARTLCEHACDVN 545          

HSP 2 Score: 55.8398 bits (133), Expect = 2.245e-9
Identity = 34/112 (30.36%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKG-AKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALL 574
            G+  A++ +L      ++ + +DG+  LH A YNG ++    LI +G + VN++T  G TAL  +     ++ + LL+      ++  EGG TALHL   + D++     LL
Sbjct:  596 GSKLAVQRILAKSPKLVDEQKSDGFAPLHLAAYNGRLDVVHILIKQGRSAVNARTCGGQTALMLAAGRGHVDVVFLLVREACKLDVEDEGGNTALHLVLKEADLFSTDCHLL 707          

HSP 3 Score: 45.0542 bits (105), Expect = 7.266e-6
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 2
Query:  194 EIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLN-SGINTNIPTEGGQTALHLACSK 541
            EI  D     +  A  GN  A+  LL +    +N+ ++ G  ALH A   G+ E A+ L      VN+Q     + +H ++  N  E IE L +   ++     E G T L LA  K
Sbjct:  479 EIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKGYGEVARTLCEHACDVNTQDSTKNSPIHDAIAENYEEVIEALTSVKTLDLERQNESGFTPLQLAAFK 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.102e-13
Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            +INA D    RA+H A Y GH E  K L++ GA V  + + G++ LH++    Q+  ++LLL+ G++ + P   G TALH+AC
Sbjct:  163 NINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVAC 245          

HSP 2 Score: 66.2402 bits (160), Expect = 7.953e-13
Identity = 37/107 (34.58%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALH-SSVYWNQLECIELLLNSGINTNIPTEGGQTALHL 529
            +  L + + +G +  +K+LL+ L +DI+  ++ G  ALH ACYNG       LI  GA VN   + G+T LH ++   +   C+ELL+N+G + N+ ++ G++ LH+
Sbjct:  205 YSPLHAASSSGQIGVVKLLLD-LGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHM 310          

HSP 3 Score: 65.4698 bits (158), Expect = 1.544e-12
Identity = 36/113 (31.86%), Postives = 62/113 (54.87%), Query Frame = 2
Query:  206 DPHKQLISEAEAGNLEAIKILLENLEID--INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACS 538
            D    L S A  G++E +++L+EN + +  ++A D +    +  A  NGH + A  L+SKGA +N++   G TALH        EC++LLL   ++ ++    G+  LH+A +
Sbjct:  649 DRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAA 761          

HSP 4 Score: 56.6102 bits (135), Expect = 1.447e-9
Identity = 33/106 (31.13%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  293 NAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKN 610
            N  D  G  ALH A +NGH E   +L++KGA +N+  +    A+H + Y    E +++L+  G +     + G + LH A S   I   ++ LLL   D+ +D+ +
Sbjct:  132 NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQI--GVVKLLL---DLGVDIDD 232          

HSP 5 Score: 47.7506 bits (112), Expect = 1.155e-6
Identity = 33/123 (26.83%), Postives = 63/123 (51.22%), Query Frame = 2
Query:  278 LEIDI-NAEDNDGYRALHRACYNGHVETAKYLISK-GAKV-NSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMEL 637
            LE+D+   ++ + +  LH A  N +   A+ LI   GAK+ N     G   LH++ + + +EC++LLL+     N+    G++ L +AC         + +L++    +L L++A  +T + L
Sbjct:  809 LELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQ--ATAVEVLVNSTKTDLKLQDANRNTALHL 929          

HSP 6 Score: 46.9802 bits (110), Expect = 2.031e-6
Identity = 35/124 (28.23%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  212 HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            H+   S +EA    A++ LL++   D+NA D +    LH A  N  V+ A+ +I   +  N   + G TALH + +    E +  L+  G N N   +  + A+H A   +  + E++ +L++H
Sbjct:   77 HRACASRSEA----AVQTLLKH-SADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAA--YMGHTEVVKVLVAH 193          

HSP 7 Score: 46.595 bits (109), Expect = 2.597e-6
Identity = 38/128 (29.69%), Postives = 58/128 (45.31%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACS--------KFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            +I+  D  G   LH A   G+VE    L+S GA +N + +   TALH +     ++C+  L+ SG   N   E   T LH A +         F +Y  I   + S+ D++     AQ   C+E + R
Sbjct:  413 EIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTI--SVQSYIDVHSTCSEAQ--ICLEHLLR 536          

HSP 8 Score: 46.595 bits (109), Expect = 2.644e-6
Identity = 30/85 (35.29%), Postives = 41/85 (48.24%), Query Frame = 2
Query:  290 INAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNS-GINTNIPTEGGQTALHLACSK 541
            IN  D  G   LH A +  HVE  + L+S  A VN     G + L  +    Q   +E+L+NS   +  +      TALHLACS+
Sbjct:  849 INCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSR 933          

HSP 9 Score: 46.595 bits (109), Expect = 2.844e-6
Identity = 31/106 (29.25%), Postives = 51/106 (48.11%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACS 538
            LI     G+ + ++ L+   E ++NA D++    LH A Y G  E  + L+  GA+VNS+     T LH +        ++ LL    + N   +  QT LH+A +
Sbjct:   10 LIQAIFNGDPDEVRSLIYKKE-EVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAA 114          

HSP 10 Score: 45.8246 bits (107), Expect = 4.994e-6
Identity = 33/120 (27.50%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLS 580
            L + A  G  E I++L+ +    +N++DN     LHRAC +      + L+   A VN++ +   T LH +     ++C E ++    ++N+    G+TALH A   F+ + E++  L++
Sbjct:   43 LHAAAYLGEAEIIELLVLS-GARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAA--FNGHSEMVNFLVA 159          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 7.045e-13
Identity = 38/98 (38.78%), Postives = 54/98 (55.10%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
            GNLE + +L+     ++NA D    RA+H A Y GH E  K L+S GA VN + + G+T LH++     +  + LLL+     N     G TALH+AC
Sbjct:   58 GNLEMVNLLISK-GANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVAC 154          

HSP 2 Score: 63.929 bits (154), Expect = 4.399e-12
Identity = 41/118 (34.75%), Postives = 61/118 (51.69%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            G+ E +K+LL N   D+N +D  GY  LH A  +GHV   + L+S  A++N     G TALH + +  Q   +  LL++G +     E G TALH A +       +  L+  H D+N
Sbjct:   91 GHTEVVKMLLSN-GADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVN 207          

HSP 3 Score: 62.003 bits (149), Expect = 1.832e-11
Identity = 35/98 (35.71%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLS 580
            ++N  D  G  ALH A +NG++E    LISKGA VN+  +    A+H + Y    E +++LL++G + N   + G T LH A +   +   ++ LLLS
Sbjct:   39 NVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHV--TVVRLLLS 134          

HSP 4 Score: 54.299 bits (129), Expect = 8.457e-9
Identity = 32/104 (30.77%), Postives = 59/104 (56.73%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALH-SSVYWNQLECIELLLNSGINTNIPTEGGQTALHL 529
            L + A +G++  +++LL +L+ ++N  +  G  ALH AC+NG       L+  GA    + + G+TALH ++   +   C+ELL+N   + N  +  G++ LH+
Sbjct:  117 LHAAAASGHVTVVRLLL-SLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHM 219          

HSP 5 Score: 50.447 bits (119), Expect = 1.433e-7
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH-CDIN 595
            D+NA D +    LH A  N  ++ A  LI   + VN   + G TALH + +   LE + LL++ G N N   +  + A+H A   +  + E++ +LLS+  D+N
Sbjct:    6 DVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWA--GYMGHTEVVKMLLSNGADVN 107          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ankrd39 (ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE-081104-153])

HSP 1 Score: 63.5438 bits (153), Expect = 7.739e-13
Identity = 43/132 (32.58%), Postives = 60/132 (45.45%), Query Frame = 2
Query:  131 PEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALH 526
            P     + E   T +H   +   + D  + + S A  G+L+ +   L+    D N  D  GY ALH A  NGH    + L+S GA VN+QT  G TAL  + Y      + LL   G +  +    G TALH
Sbjct:    8 PHASCCHLEPAPTGVHQTLD---EMDFERGIWSAAGEGDLDRVVSQLKK-GTDPNKTDASGYTALHYASRNGHEAVCRALLSHGALVNAQTPGGATALSRAAYCGHGTIVSLLFKHGADCRLRDSDGMTALH 135          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.860e-12
Identity = 41/130 (31.54%), Postives = 72/130 (55.38%), Query Frame = 2
Query:  200 KADPHKQLISEAEAGNLEAIKILLENLE--IDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            K+D     +  A  GNLE    L+++L+  +DIN  + +G  ALH A   GHV+    L+ + A++++ T++G TALH +    Q + + +L+  G N N  ++ G T L++A  +  +  EI+  LL +
Sbjct:    7 KSDAATSFLRAARNGNLER---LMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHL--EIVKFLLDN 131          

HSP 2 Score: 63.1586 bits (152), Expect = 8.939e-12
Identity = 51/150 (34.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLS-HCDINLDLKN--------AQED--TCMELVTRH 649
            ++ G LE   +LLE      + +  +G   LH A +  H + A  L+ KGA  +S  + G+T LH +   NQLE  ++LL  G  TN+ T+ G   LHLA    + + +++ALLL  H  I+L  K         AQED     E++T+H
Sbjct:  550 SKYGRLEVATLLLEKYA-SADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQ--EGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKH 696          

HSP 3 Score: 59.3066 bits (142), Expect = 1.431e-10
Identity = 36/115 (31.30%), Postives = 66/115 (57.39%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            ++ G+++ +  LL+  E +I+     G  ALH A   G  +  + L+  GA +N+Q+Q G+T L+ +   N LE ++ LL++G N ++ TE G T L +A  +   + +++ LLL
Sbjct:   51 SKEGHVDVVTELLKR-EAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQG--HEQVVGLLL 162          

HSP 4 Score: 55.4546 bits (132), Expect = 3.241e-9
Identity = 30/100 (30.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A  G+    K+LL+    + NA   +G+  LH AC    ++  + L+  GA +++ T+ G T +H + +   L  ++LLL +G ++N     G+T LH+A
Sbjct:  352 AHCGHYRVAKLLLDRGG-EPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMA 450          

HSP 5 Score: 54.299 bits (129), Expect = 7.034e-9
Identity = 33/97 (34.02%), Postives = 50/97 (51.55%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            G+L  +++LL+N     NA +  G   LH A   G +E  K L+  GA+V  + +   T LH +    + E ++LLL  G + N PT  G T L+ A
Sbjct:  421 GHLNVVQLLLQN-GASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFA 516          

HSP 6 Score: 51.9878 bits (123), Expect = 4.041e-8
Identity = 33/108 (30.56%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  323 LHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            LH A + GH   AK L+ +G + N++   G+T LH +   N+++ +ELLL  G + +  TE G T +H+A   F  +  ++ LLL +   + +  N + +T + + +R
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVA--SFMGHLNVVQLLLQN-GASSNATNVRGETPLHMASR 452          

HSP 7 Score: 49.6766 bits (117), Expect = 2.265e-7
Identity = 37/117 (31.62%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G+ + I++LLE  +  I A+  +G   LH A    H+   + L+ + A V+  T    T LH + +       +LLL+ G   N     G T LH+AC K  I  +++ LLL H
Sbjct:  286 ARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRI--KVMELLLKH 399          

HSP 8 Score: 49.2914 bits (116), Expect = 3.387e-7
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A AG  + +++L+E    +INA+  +G+  L+ A    H+E  K+L+  GA  +  T+ G+T L  ++     + + LLL S     +       ALH+A  K D      ALLL H
Sbjct:   84 ALAGQTDIVRVLVE-FGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRL----PALHIAARKDDT--NAAALLLQH 193          

HSP 9 Score: 48.1358 bits (113), Expect = 7.229e-7
Identity = 31/103 (30.10%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            +  G+ +   +LLEN   DI+     G+  LH A   G +E A  L+ K A  + + + G T LH + +++  +   LLL+ G + +   + G T LH+A  K
Sbjct:  517 SREGHGDVASLLLEN-GADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKK 618          

HSP 10 Score: 46.9802 bits (110), Expect = 2.043e-6
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            G  E +++LL+    D NA    G   L+ A   GH + A  L+  GA ++  T+ G+T LH +  + +LE   LLL    + +   + G T LH+A
Sbjct:  487 GKAEIVQLLLQRGS-DPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVA 582          

HSP 11 Score: 45.4394 bits (106), Expect = 5.919e-6
Identity = 30/100 (30.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            A+ GN   +K+LL+     I+ +  DG   LH A  +GH +  + L+ + A + ++T+ G + LH +     L C++LLL      +  T    T LH+A
Sbjct:  253 AKRGNNNMVKLLLDR-GAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVA 351          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 58.151 bits (139), Expect = 2.582e-10
Identity = 33/106 (31.13%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGW-TALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
             I  A+ G+L+ +K ++E+  +DIN +  D    LH AC N     AK+L+ +GA  N     G  TALH +  +  +  ++LLL  G +  +  E G   +H + 
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSV 159          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 54.6842 bits (130), Expect = 3.593e-9
Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 2
Query:  236 EAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQT--QLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTAL 523
            + G  + +K ++E    DIN +DN G  ALH A   GH+E  + LI  GA VN ++    G T L  +     L+ ++ LL +G +  I    G TA 
Sbjct:  339 DKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAF 436          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: MGA2 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; MGA2 has a paralog, SPT23, that arose from the whole genome duplication [Source:SGD;Acc:S000001472])

HSP 1 Score: 45.8246 bits (107), Expect = 3.232e-6
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  257 IKILLENLEIDINAE--DNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTA 520
            I+ ++++L I+ N    D+ G   LH AC   +      LI KGA+VN     G T LH +      + I++LLN  +N ++ +  G TA
Sbjct:  700 IQKVIKSLNINSNISICDSLGRTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKMLLNCKVNYSLRSHNGLTA 789          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 44.2838 bits (103), Expect = 5.691e-6
Identity = 28/82 (34.15%), Postives = 39/82 (47.56%), Query Frame = 2
Query:  239 AGNLEAIKILLEN-LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSG 481
             GNLE +K L +  L+ D+N   N G   LH A      E +++LI  GA V  + +     LH +     L+ IELL   G
Sbjct:   82 VGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG 163          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 44.2838 bits (103), Expect = 9.794e-6
Identity = 31/137 (22.63%), Postives = 67/137 (48.91%), Query Frame = 2
Query:  236 EAGNLEAIKILLEN--LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQT-QLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALL--LSHCDINLDLKNAQEDTCM 631
            + G+L  +K ++    LE++ + +  +    LH A  N  +    +L+S+GA VN++   L  T LH +  +  +  ++ LL  G +  +  + G   LHL+ +  +I   +  L   +S   +++D ++ +  T +
Sbjct:   82 QRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSL 218          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH2])

HSP 1 Score: 87.8113 bits (216), Expect = 7.878e-22
Identity = 56/151 (37.09%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQ-LECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFF 670
            ++  AE G +  +K LL          D DGY ALHRA Y GHV+ AK L++ GA V + T  GW  LHS+  W + +E   LLL +G N N  T G QT LHLA          L LLL +  ++  + N Q +T  ++  R   +   F
Sbjct:    1 MLDAAEHGRVNEVKELLAKYPRLHEGCDADGYSALHRASYEGHVDVAKVLLTYGANVMATTHDGWHPLHSACRWGKGVEAASLLLQNGANINALTNGKQTPLHLAALGIG-GTATLKLLLFNRRLDATILNTQGETARDIANRSGKWVDLF 150          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK81])

HSP 1 Score: 62.3882 bits (150), Expect = 6.527e-13
Identity = 30/93 (32.26%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  257 IKILLENLEIDINAEDN-DGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            +++L+E+    +NA +  +G  ALH AC+ G+V  A+YL+  GA V ++   GW+ LH++    + +C++LLL +  +    +  G TA  +A
Sbjct:    1 VEMLIESGMASVNARNPAEGATALHAACFEGNVSCARYLLEHGASVEARDNDGWSPLHAATCGGKRKCVQLLLAADADPFAESFDGYTAFQMA 93          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO47171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV9])

HSP 1 Score: 62.7734 bits (151), Expect = 4.705e-12
Identity = 36/114 (31.58%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  215 KQLISEAEAGNLEAIKILLENLE--------IDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA 532
            K L   A  G++++I+ L E+ E         ++N  + DG  A+  A   G  E  + L+ +GA+VNS+T+ G+T LH +  W Q+ C++ L+ SG +  I    G+ A   A
Sbjct:    3 KSLFDFATEGDIDSIRQLFEDPESPYVTDASTELNKRNPDGKSAIDLAAMLGRNEVVRELLERGAEVNSKTKKGYTCLHIAACWGQVGCLKALVASGADLQIRNAHGERAREAA 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45752 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS61])

HSP 1 Score: 57.3806 bits (137), Expect = 3.432e-11
Identity = 30/79 (37.97%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  245 NLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSG 481
            ++E+  ++L+ ++ DIN    DGY  LHRA   G     KYLI KGA VN     G T L  +V   + +C   L+ SG
Sbjct:    9 DVESFSLMLKTVDFDINEPCMDGYYMLHRAASAGSATCLKYLIKKGADVNVTDINGLTPLDLAVLEGEFDCATYLIRSG 87          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 57.7658 bits (138), Expect = 3.915e-11
Identity = 32/85 (37.65%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  287 DINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            D  A+DN G+  LH AC  G +E  K L+  GA VN+ +  G   LH +     +E + LLL  G +  + T  G TA   AC+K
Sbjct:   12 DPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNTA--YACAK 94          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd49 (ankyrin repeat domain 49 [Source:NCBI gene;Acc:101168596])

HSP 1 Score: 104.375 bits (259), Expect = 5.047e-27
Identity = 61/170 (35.88%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  188 EAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDI-YPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCT 694
            E E+   P + ++  AE   L  +  LL    + ++  D D Y  LHRA YNGHVE A  L+S G+ +N +T  GWT LHS+  W +      LL SG + N  T GG T LHLA S F   + + L LLLS   +   L ++  +T  E+  R  P+ + F   + C +
Sbjct:   52 EDELGDRPAELVLWAAENNRLPTLLRLLAADPLLVHCRDEDNYTPLHRAAYNGHVEAACALLSHGSDINPRTIDGWTPLHSACRWGRAAVASCLLQSGADINAQTNGGLTPLHLAASSFKPSFAQTLELLLSKRHLKPRLLSSSGETAAEVARRSGPHYFLFEMVEDCIS 221          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ehmt2 (euchromatic histone lysine methyltransferase 2 [Source:NCBI gene;Acc:101167716])

HSP 1 Score: 77.7962 bits (190), Expect = 5.015e-16
Identity = 50/153 (32.68%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  197 IKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTP 655
            ++ D +  L   A+ GNLE + +LLE  ++DINA+DN G+  +  A  + HVE  K L+++GA V+   +     LH + Y   ++  E++LN+G + +     G T LH+A    + Y E + L LS    ++D+ N + DT + L    TP
Sbjct:  679 VEDDGYTGLHHAAKLGNLEIVNMLLETGQVDINAQDNGGWTPIIWAAEHKHVEVIKALLNRGADVSITDKEMNVCLHWAAYAGSVDIAEMVLNAGCSLSSVNVHGDTPLHIAAR--EGYLECVTLFLSR-GADIDIVNKEGDTPLTLARTDTP 828          

HSP 2 Score: 49.2914 bits (116), Expect = 1.776e-6
Identity = 32/102 (31.37%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSG-INTNIPTEGGQTAL 523
            L + A+ G LE   +L++     ++A+D +    L  A  N H+E A+YL+  GA V      G+T LH +     LE + +LL +G ++ N    GG T +
Sbjct:  621 LHTAAQRGLLEICYMLIQ-AGAHVDAKDKEMRTPLLEAVINNHIEVARYLVQNGACVYHVEDDGYTGLHHAAKLGNLEIVNMLLETGQVDINAQDNGGWTPI 721          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ehmt2 (euchromatic histone lysine methyltransferase 2 [Source:NCBI gene;Acc:101167716])

HSP 1 Score: 77.411 bits (189), Expect = 6.637e-16
Identity = 50/153 (32.68%), Postives = 83/153 (54.25%), Query Frame = 2
Query:  197 IKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTP 655
            ++ D +  L   A+ GNLE + +LLE  ++DINA+DN G+  +  A  + HVE  K L+++GA V+   +     LH + Y   ++  E++LN+G + +     G T LH+A    + Y E + L LS    ++D+ N + DT + L    TP
Sbjct:  725 VEDDGYTGLHHAAKLGNLEIVNMLLETGQVDINAQDNGGWTPIIWAAEHKHVEVIKALLNRGADVSITDKEMNVCLHWAAYAGSVDIAEMVLNAGCSLSSVNVHGDTPLHIAAR--EGYLECVTLFLSR-GADIDIVNKEGDTPLTLARTDTP 874          

HSP 2 Score: 49.2914 bits (116), Expect = 1.974e-6
Identity = 32/102 (31.37%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSG-INTNIPTEGGQTAL 523
            L + A+ G LE   +L++     ++A+D +    L  A  N H+E A+YL+  GA V      G+T LH +     LE + +LL +G ++ N    GG T +
Sbjct:  667 LHTAAQRGLLEICYMLIQ-AGAHVDAKDKEMRTPLLEAVINNHIEVARYLVQNGACVYHVEDDGYTGLHHAAKLGNLEIVNMLLETGQVDINAQDNGGWTPI 767          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd39 (ankyrin repeat domain 39 [Source:NCBI gene;Acc:101162533])

HSP 1 Score: 72.0182 bits (175), Expect = 2.886e-15
Identity = 41/120 (34.17%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  227 SEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHC 586
            S A  G+L+ +K  ++    D N  D+ GY ALH +  NGH+   K L+  GA  + QT+ G T LH + Y   L+ + L+L+ G +  +    G +ALH A  +   + E+  LL+ HC
Sbjct:   35 SAAVDGDLDRVKSFIDK-GTDPNLRDSSGYTALHYSSRNGHLAVCKILLENGACASPQTRGGATPLHRAAYCGHLDVVRLILHHGADPGLCDNDGASALHKAAEQG--HKEVCQLLVEHC 151          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd6b (ankyrin repeat domain 6 [Source:NCBI gene;Acc:101160867])

HSP 1 Score: 74.3294 bits (181), Expect = 5.975e-15
Identity = 53/161 (32.92%), Postives = 80/161 (49.69%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE*NF 715
            A  G+LE + ILL+    D++ ED+    ALHRA   G+ +    LI +G  ++ Q + G TALH   +    + ++LL+ +G N +   + G TALHLAC         + LLL  C    D KN   DTC+ +  R+   A       + C+ +SE N 
Sbjct:   52 AHKGHLEVVHILLK-AGCDLDIEDDGEQTALHRAAVVGNTDVIGALIQEGCALDRQDKDGNTALHEVAWHGFSQSVKLLVKAGANVHAKNKAGNTALHLACQNGHAQSSKV-LLLGGC--RPDSKNTAGDTCLHVAARYNHVAMIRILLGAFCS-VSEKNL 207          

HSP 2 Score: 54.299 bits (129), Expect = 3.463e-8
Identity = 30/99 (30.30%), Postives = 57/99 (57.58%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACS 538
            G  +++K+L++    +++A++  G  ALH AC NGH +++K L+  G + +S+   G T LH +  +N +  I +LL +  + +     G T LH+A +
Sbjct:  121 GFSQSVKLLVK-AGANVHAKNKAGNTALHLACQNGHAQSSKVLLLGGCRPDSKNTAGDTCLHVAARYNHVAMIRILLGAFCSVSEKNLVGDTPLHVAAA 218          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000053465.1 (SMESG000053465.1)

HSP 1 Score: 447.973 bits (1151), Expect = 2.115e-162
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 2
Query:   62 MSDGEFNESSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE 706
            MSDGEFNESSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE
Sbjct:    1 MSDGEFNESSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADPHKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYAYFFYPFKSCCTQLSE 215          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000057519.1 (SMESG000057519.1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.497e-16
Identity = 43/119 (36.13%), Postives = 74/119 (62.18%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINL 598
            G+L+ +++LL   + +IN + NDG R +H AC NGH E AK LI+K   ++ QT+ GWT++H +     +E ++LL+    NT+I  + G   + +AC+   I  EI+ LL+++ +I+ 
Sbjct:   62 GHLDIVQLLLSK-DCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHI--EIVKLLINNQNISF 177          

HSP 2 Score: 52.373 bits (124), Expect = 1.348e-7
Identity = 26/86 (30.23%), Postives = 42/86 (48.84%), Query Frame = 2
Query:  317 RALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK--FDIYPEILA 568
            R +H AC  G  E A+++++K        + GW  LH       L+ ++LLL+     N  T  G   +H AC+   F+I  E++A
Sbjct:   20 RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIA 105          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.175e-14
Identity = 44/137 (32.12%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  239 AGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRH 649
            AGN E +++LL+    D+N +  +G  ALH A      +  + L+   A ++++TQ+G+TALH++V++ Q++ +++LL    + N  T  G T+LHLA  +  I   I+ LLL + +I+++ +N Q  T +E+  + 
Sbjct:  708 AGNKEIMELLLD-ANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHI--AIVRLLLDN-EIDVNHQNKQGLTALEVAQKQ 840          

HSP 2 Score: 67.3958 bits (163), Expect = 1.201e-12
Identity = 42/107 (39.25%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK--FDIYPEIL 565
            E I++LL+  E ++N    +GY  LH       +E  K LI +GA VN+Q+Q G+T LH +      E +ELLL++  + N   E G TALHLA  K   DI  ++L
Sbjct:  646 EMIELLLDT-EANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLL 751          

HSP 3 Score: 59.3066 bits (142), Expect = 5.638e-10
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
             +  A +GN+E +K  L+  +I  +  + +G  A+H A   G+ E  + LI  G  V+  T+ G T+LH +    +LE + LLL S  N N+ ++ G T L++A 
Sbjct:   76 FLRAARSGNVEKVKEFLQ-ADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAA 179          

HSP 4 Score: 57.7658 bits (138), Expect = 2.025e-9
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  233 AEAGNLEAIKILLEN-LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            A+ GN E +++L+EN L +DI      G  +LH A   G +E    L+   A +N ++Q G+T L+ +   N L+ +++LL  G N  I T+ G T L +A  +
Sbjct:  113 AKEGNREVVQLLIENGLSVDIATRK--GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQ 214          

HSP 5 Score: 55.8398 bits (133), Expect = 9.134e-9
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            G ++  + LL + +++ N+  + G   LH A Y  H E  + L+   A VN   + G+T LH     N +E  +LL++ G N N  ++ G T LHL     +   EI+ LLL ++ D+N   +N 
Sbjct:  609 GRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN--KEIMELLLDANADVNHQAENG 731          

HSP 6 Score: 54.299 bits (129), Expect = 3.027e-8
Identity = 40/117 (34.19%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G    I ILLEN   DI  +  +G  AL  A      E  + LI+KG  V++ T    TALH + +   +   E+LL +  N N     G T LH+AC K  I  +++ LL+ +
Sbjct:  341 ARSGFENIILILLEN-GADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKK--IQSKMVELLIKY 454          

HSP 7 Score: 53.5286 bits (127), Expect = 5.764e-8
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A+   +E  K+L++    ++NA+   G+  LH     G+ E  + L+   A VN Q + G TALH +   N+ + +E LL +  + +  T+ G TALH A   F     +  LL  + D+N
Sbjct:  673 AKKNMIEVTKLLIDR-GANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAV-HFGQIQTVKMLLEKNFDVN 791          

HSP 8 Score: 52.7582 bits (125), Expect = 1.107e-7
Identity = 41/139 (29.50%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC-SKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  ++ A  +L+ + + +++ +   G+  LH A +  +V  AK LI K A VN   +   T LH +  W + E ++LL++   N N  T  G + +H A  S F+    IL LL +  DI    KN    T +++ T+
Sbjct:  241 AKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENI--ILILLENGADIQHKSKNGL--TALQMATQ 375          

HSP 9 Score: 50.447 bits (119), Expect = 6.368e-7
Identity = 36/103 (34.95%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  269 LENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            L N  ID++A   D   ALH A + G++  A+ L+     VN++   G+T LH +    Q + +ELL+    + N  TE G T LH+A   F    EI+ +LL
Sbjct:  385 LINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAA--FMGSKEIVNILL 485          

HSP 10 Score: 47.7506 bits (112), Expect = 4.365e-6
Identity = 35/123 (28.46%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEILALLLSHCDIN 595
            A+ G  E +K+L+   + ++N+   DG   +H A  +G       L+  GA +  +++ G TAL  +   +Q E  + L+N GI+ +  T    TALH+A  C   +       LL ++C++N
Sbjct:  308 AKWGKEEMLKLLISQ-KANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAE---VLLKNNCNVN 426          

HSP 11 Score: 46.9802 bits (110), Expect = 7.263e-6
Identity = 30/99 (30.30%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  320 ALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            A  RA  +G+VE  K  +    K +     G  A+H +      E ++LL+ +G++ +I T  G T+LH+A     +  E+++LLL S  +IN+  +N 
Sbjct:   75 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKL--EVVSLLLESKANINVKSQNG 171          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.233e-14
Identity = 44/137 (32.12%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  239 AGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRH 649
            AGN E +++LL+    D+N +  +G  ALH A      +  + L+   A ++++TQ+G+TALH++V++ Q++ +++LL    + N  T  G T+LHLA  +  I   I+ LLL + +I+++ +N Q  T +E+  + 
Sbjct:  728 AGNKEIMELLLD-ANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHI--AIVRLLLDN-EIDVNHQNKQGLTALEVAQKQ 860          

HSP 2 Score: 67.3958 bits (163), Expect = 1.203e-12
Identity = 42/107 (39.25%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK--FDIYPEIL 565
            E I++LL+  E ++N    +GY  LH       +E  K LI +GA VN+Q+Q G+T LH +      E +ELLL++  + N   E G TALHLA  K   DI  ++L
Sbjct:  666 EMIELLLDT-EANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLL 771          

HSP 3 Score: 59.3066 bits (142), Expect = 5.804e-10
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
             +  A +GN+E +K  L+  +I  +  + +G  A+H A   G+ E  + LI  G  V+  T+ G T+LH +    +LE + LLL S  N N+ ++ G T L++A 
Sbjct:   96 FLRAARSGNVEKVKEFLQ-ADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAA 199          

HSP 4 Score: 57.7658 bits (138), Expect = 2.163e-9
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  233 AEAGNLEAIKILLEN-LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            A+ GN E +++L+EN L +DI      G  +LH A   G +E    L+   A +N ++Q G+T L+ +   N L+ +++LL  G N  I T+ G T L +A  +
Sbjct:  133 AKEGNREVVQLLIENGLSVDIATRK--GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQ 234          

HSP 5 Score: 55.8398 bits (133), Expect = 9.935e-9
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            G ++  + LL + +++ N+  + G   LH A Y  H E  + L+   A VN   + G+T LH     N +E  +LL++ G N N  ++ G T LHL     +   EI+ LLL ++ D+N   +N 
Sbjct:  629 GRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN--KEIMELLLDANADVNHQAENG 751          

HSP 6 Score: 54.299 bits (129), Expect = 2.921e-8
Identity = 40/117 (34.19%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G    I ILLEN   DI  +  +G  AL  A      E  + LI+KG  V++ T    TALH + +   +   E+LL +  N N     G T LH+AC K  I  +++ LL+ +
Sbjct:  361 ARSGFENIILILLEN-GADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKK--IQSKMVELLIKY 474          

HSP 7 Score: 53.5286 bits (127), Expect = 6.097e-8
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A+   +E  K+L++    ++NA+   G+  LH     G+ E  + L+   A VN Q + G TALH +   N+ + +E LL +  + +  T+ G TALH A   F     +  LL  + D+N
Sbjct:  693 AKKNMIEVTKLLIDR-GANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAV-HFGQIQTVKMLLEKNFDVN 811          

HSP 8 Score: 52.373 bits (124), Expect = 1.170e-7
Identity = 41/139 (29.50%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC-SKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  ++ A  +L+ + + +++ +   G+  LH A +  +V  AK LI K A VN   +   T LH +  W + E ++LL++   N N  T  G + +H A  S F+    IL LL +  DI    KN    T +++ T+
Sbjct:  261 AKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENI--ILILLENGADIQHKSKNGL--TALQMATQ 395          

HSP 9 Score: 50.447 bits (119), Expect = 6.316e-7
Identity = 42/131 (32.06%), Postives = 66/131 (50.38%), Query Frame = 2
Query:  269 LENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH----------CD--INLDLKNAQEDT 625
            L N  ID++A   D   ALH A + G++  A+ L+     VN++   G+T LH +    Q + +ELL+    + N  TE G T LH+A   F    EI+ +LL +          C+  ++L  +N QE+T
Sbjct:  405 LINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAA--FMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEET 533          

HSP 10 Score: 47.7506 bits (112), Expect = 4.409e-6
Identity = 35/123 (28.46%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEILALLLSHCDIN 595
            A+ G  E +K+L+   + ++N+   DG   +H A  +G       L+  GA +  +++ G TAL  +   +Q E  + L+N GI+ +  T    TALH+A  C   +       LL ++C++N
Sbjct:  328 AKWGKEEMLKLLISQ-KANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAE---VLLKNNCNVN 446          

HSP 11 Score: 46.9802 bits (110), Expect = 7.139e-6
Identity = 30/99 (30.30%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  320 ALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            A  RA  +G+VE  K  +    K +     G  A+H +      E ++LL+ +G++ +I T  G T+LH+A     +  E+++LLL S  +IN+  +N 
Sbjct:   95 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKL--EVVSLLLESKANINVKSQNG 191          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.374e-14
Identity = 44/137 (32.12%), Postives = 82/137 (59.85%), Query Frame = 2
Query:  239 AGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRH 649
            AGN E +++LL+    D+N +  +G  ALH A      +  + L+   A ++++TQ+G+TALH++V++ Q++ +++LL    + N  T  G T+LHLA  +  I   I+ LLL + +I+++ +N Q  T +E+  + 
Sbjct:  648 AGNKEIMELLLD-ANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHI--AIVRLLLDN-EIDVNHQNKQGLTALEVAQKQ 780          

HSP 2 Score: 67.3958 bits (163), Expect = 1.186e-12
Identity = 42/107 (39.25%), Postives = 60/107 (56.07%), Query Frame = 2
Query:  251 EAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK--FDIYPEIL 565
            E I++LL+  E ++N    +GY  LH       +E  K LI +GA VN+Q+Q G+T LH +      E +ELLL++  + N   E G TALHLA  K   DI  ++L
Sbjct:  586 EMIELLLDT-EANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLL 691          

HSP 3 Score: 59.3066 bits (142), Expect = 6.640e-10
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  221 LISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC 535
             +  A +GN+E +K  L+  +I  +  + +G  A+H A   G+ E  + LI  G  V+  T+ G T+LH +    +LE + LLL S  N N+ ++ G T L++A 
Sbjct:   16 FLRAARSGNVEKVKEFLQ-ADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAA 119          

HSP 4 Score: 57.7658 bits (138), Expect = 2.153e-9
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  233 AEAGNLEAIKILLEN-LEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSK 541
            A+ GN E +++L+EN L +DI      G  +LH A   G +E    L+   A +N ++Q G+T L+ +   N L+ +++LL  G N  I T+ G T L +A  +
Sbjct:   53 AKEGNREVVQLLIENGLSVDIATRK--GNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQ 154          

HSP 5 Score: 55.8398 bits (133), Expect = 9.621e-9
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  242 GNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            G ++  + LL + +++ N+  + G   LH A Y  H E  + L+   A VN   + G+T LH     N +E  +LL++ G N N  ++ G T LHL     +   EI+ LLL ++ D+N   +N 
Sbjct:  549 GRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN--KEIMELLLDANADVNHQAENG 671          

HSP 6 Score: 54.299 bits (129), Expect = 3.130e-8
Identity = 40/117 (34.19%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSH 583
            A +G    I ILLEN   DI  +  +G  AL  A      E  + LI+KG  V++ T    TALH + +   +   E+LL +  N N     G T LH+AC K  I  +++ LL+ +
Sbjct:  281 ARSGFENIILILLEN-GADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKK--IQSKMVELLIKY 394          

HSP 7 Score: 53.1434 bits (126), Expect = 6.474e-8
Identity = 37/121 (30.58%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLLSHCDIN 595
            A+   +E  K+L++    ++NA+   G+  LH     G+ E  + L+   A VN Q + G TALH +   N+ + +E LL +  + +  T+ G TALH A   F     +  LL  + D+N
Sbjct:  613 AKKNMIEVTKLLIDR-GANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAV-HFGQIQTVKMLLEKNFDVN 731          

HSP 8 Score: 52.373 bits (124), Expect = 1.289e-7
Identity = 41/139 (29.50%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLAC-SKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTR 646
            A+  ++ A  +L+ + + +++ +   G+  LH A +  +V  AK LI K A VN   +   T LH +  W + E ++LL++   N N  T  G + +H A  S F+    IL LL +  DI    KN    T +++ T+
Sbjct:  181 AKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENI--ILILLENGADIQHKSKNGL--TALQMATQ 315          

HSP 9 Score: 50.447 bits (119), Expect = 6.465e-7
Identity = 36/103 (34.95%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  269 LENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL 577
            L N  ID++A   D   ALH A + G++  A+ L+     VN++   G+T LH +    Q + +ELL+    + N  TE G T LH+A   F    EI+ +LL
Sbjct:  325 LINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAA--FMGSKEIVNILL 425          

HSP 10 Score: 47.7506 bits (112), Expect = 4.431e-6
Identity = 35/123 (28.46%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  233 AEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLA--CSKFDIYPEILALLLSHCDIN 595
            A+ G  E +K+L+   + ++N+   DG   +H A  +G       L+  GA +  +++ G TAL  +   +Q E  + L+N GI+ +  T    TALH+A  C   +       LL ++C++N
Sbjct:  248 AKWGKEEMLKLLISQ-KANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAE---VLLKNNCNVN 366          

HSP 11 Score: 46.9802 bits (110), Expect = 7.308e-6
Identity = 30/99 (30.30%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  320 ALHRACYNGHVETAKYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGGQTALHLACSKFDIYPEILALLL-SHCDINLDLKNA 613
            A  RA  +G+VE  K  +    K +     G  A+H +      E ++LL+ +G++ +I T  G T+LH+A     +  E+++LLL S  +IN+  +N 
Sbjct:   15 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKL--EVVSLLLESKANINVKSQNG 111          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD496.255e-2733.51ankyrin repeat domain 49 [Source:HGNC Symbol;Acc:H... [more]
ANKRD496.255e-2733.51ankyrin repeat domain 49 [Source:HGNC Symbol;Acc:H... [more]
ANKRD391.420e-1638.66ankyrin repeat domain 39 [Source:HGNC Symbol;Acc:H... [more]
ANKRD391.420e-1638.66ankyrin repeat domain 39 [Source:HGNC Symbol;Acc:H... [more]
CTTNBP21.924e-1537.50cortactin binding protein 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F26F4.121.362e-2834.01pep chromosome:WBcel235:III:4908960:4910038:-1 gen... [more]
fem-11.637e-1733.78Sex-determining protein fem-1 [Source:UniProtKB/S... [more]
unc-443.138e-1231.75AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.138e-1231.75AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.164e-1231.75AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)35Be9.961e-2435.96gene:FBgn0261881 transcript:FBtr0080728[more]
Ank25.866e-1535.34gene:FBgn0261788 transcript:FBtr0344224[more]
Ank26.015e-1535.34gene:FBgn0261788 transcript:FBtr0303119[more]
Ank28.166e-1535.34gene:FBgn0261788 transcript:FBtr0303118[more]
Ank28.646e-1535.34gene:FBgn0261788 transcript:FBtr0303125[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd497.508e-1729.24ankyrin repeat domain 49 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd497.508e-1729.24ankyrin repeat domain 49 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd162.099e-1536.36ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd162.161e-1536.36ankyrin repeat domain 16 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd28b1.816e-1437.62ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD492.034e-2639.13ankyrin repeat domain 49 [Source:NCBI gene;Acc:100... [more]
tpm41.266e-1435.16tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.595e-1435.16tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.884e-1435.16tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.690e-1433.58tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd493.868e-2835.71ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MG... [more]
Ankrd493.868e-2835.71ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MG... [more]
Ankrd493.868e-2835.71ankyrin repeat domain 49 [Source:MGI Symbol;Acc:MG... [more]
Ankrd399.293e-1536.59ankyrin repeat domain 39 [Source:MGI Symbol;Acc:MG... [more]
Ank24.941e-1432.41ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5EA33|ANR49_BOVIN2.261e-2735.71Ankyrin repeat domain-containing protein 49 OS=Bos... [more]
sp|Q8VE42|ANR49_MOUSE2.705e-2735.71Ankyrin repeat domain-containing protein 49 OS=Mus... [more]
sp|Q8WVL7|ANR49_HUMAN3.004e-2633.51Ankyrin repeat domain-containing protein 49 OS=Hom... [more]
sp|P17221|FEM1_CAEEL2.082e-1633.78Sex-determining protein fem-1 OS=Caenorhabditis el... [more]
sp|Q53RE8|ANR39_HUMAN6.818e-1638.66Ankyrin repeat domain-containing protein 39 OS=Hom... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PCM23.032e-5040.98Ankyrin repeat domain-containing protein 49 OS=Sch... [more]
A0A0X3PK703.775e-5040.98ANK_REP_REGION domain-containing protein OS=Schist... [more]
A0A4S2LB051.201e-4942.59ANK_REP_REGION domain-containing protein OS=Opisth... [more]
G4VK616.488e-4942.45Putative fetal globin-inducing factor OS=Schistoso... [more]
G7YKG26.787e-4942.13Ankyrin repeat domain-containing protein 49 OS=Clo... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd493.021e-1932.74ankyrin repeat domain 49 [Source:NCBI gene;Acc:103... [more]
ankrd161.160e-1432.56ankyrin repeat domain 16 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000048191.11.773e-1440.21pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
ankk13.325e-1433.86ankyrin repeat and kinase domain containing 1 [Sou... [more]
ank3a1.080e-1334.09ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008505.11.021e-1537.50pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 ... [more]
ENSPMAT00000003991.11.102e-1339.76pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.17.045e-1338.78pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ankrd397.739e-1332.58ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000000093.13.860e-1231.54pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR22.582e-1031.13Ankyrin repeat-containing protein; member of a fam... [more]
HOS43.593e-933.67Subunit of the Set3 complex; complex is a meiotic-... [more]
MGA23.232e-632.22ER membrane protein involved in regulation of OLE1... [more]
NAS65.691e-634.15Evolutionarily conserved 19S regulatory particle a... [more]
AKR19.794e-622.63Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340347.878e-2237.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358966.527e-1332.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471714.705e-1231.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457523.432e-1137.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341613.915e-1137.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd495.047e-2735.88ankyrin repeat domain 49 [Source:NCBI gene;Acc:101... [more]
ehmt25.015e-1632.68euchromatic histone lysine methyltransferase 2 [So... [more]
ehmt26.637e-1632.68euchromatic histone lysine methyltransferase 2 [So... [more]
ankrd392.886e-1534.17ankyrin repeat domain 39 [Source:NCBI gene;Acc:101... [more]
ankrd6b5.975e-1532.92ankyrin repeat domain 6 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053465.12.115e-162100.00SMESG000053465.1[more]
SMESG000057519.13.497e-1636.13SMESG000057519.1[more]
SMESG000026655.11.175e-1432.12SMESG000026655.1[more]
SMESG000026655.11.233e-1432.12SMESG000026655.1[more]
SMESG000026655.11.374e-1432.12SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032811 ID=SMED30032811|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=723bp
TTATTGAAAATAATGAATTAATAAGTTGTTTTAACTAAGCATTATTTTAA
AAATTTTTAAAATGTCAGATGGTGAATTTAATGAATCAAGTGATTTTTAC
GACAAAGTTTTTAAAGCAAAAGCTGATAATCCAGAAATGTTTGTTAGTAA
CTGGGAAGAAGATAATACTAACATTCACTCTTGGACAGAAGCTGAGATAA
AAGCTGACCCACACAAACAGTTAATATCAGAAGCAGAAGCTGGAAATTTG
GAGGCGATTAAAATTTTATTAGAAAATTTAGAAATTGATATAAATGCAGA
AGATAATGATGGTTACAGAGCTTTACACAGAGCTTGCTATAACGGTCACG
TAGAAACGGCTAAATACTTGATTTCAAAAGGAGCCAAAGTTAATTCTCAA
ACGCAGCTAGGCTGGACAGCGTTGCATAGTTCTGTATATTGGAACCAATT
GGAATGTATAGAATTATTATTAAATAGTGGTATAAATACCAACATTCCAA
CAGAAGGCGGCCAAACTGCATTGCATTTGGCCTGCAGCAAATTTGACATT
TATCCAGAAATTCTAGCATTGCTCTTGTCACATTGCGATATCAATTTAGA
TCTGAAAAATGCCCAGGAAGATACATGTATGGAATTAGTTACTCGTCATA
CTCCGTATGCTTATTTTTTTTATCCATTTAAAAGTTGCTGTACTCAATTA
TCGGAATAAAATTTTTCATATTT
back to top

protein sequence of SMED30032811-orf-1

>SMED30032811-orf-1 ID=SMED30032811-orf-1|Name=SMED30032811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MSDGEFNESSDFYDKVFKAKADNPEMFVSNWEEDNTNIHSWTEAEIKADP
HKQLISEAEAGNLEAIKILLENLEIDINAEDNDGYRALHRACYNGHVETA
KYLISKGAKVNSQTQLGWTALHSSVYWNQLECIELLLNSGINTNIPTEGG
QTALHLACSKFDIYPEILALLLSHCDINLDLKNAQEDTCMELVTRHTPYA
YFFYPFKSCCTQLSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000808origin recognition complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0015031protein transport
GO:0007283spermatogenesis
GO:0030154cell differentiation
GO:0045893positive regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 63..83
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 47..187
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 47..187
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 149..179
e-value: 0.037
score: 23.2
coord: 83..112
e-value: 1.9E-5
score: 34.1
coord: 116..145
e-value: 2.8E-4
score: 30.2
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 150..181
e-value: 7.0E-4
score: 19.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 83..115
score: 12.689
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 116..148
score: 9.938
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 58..145
e-value: 8.9E-17
score: 61.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 49..174
score: 29.388
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 25..203
e-value: 4.0E-40
score: 139.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 53..195