F5/8 type C domain-containing protein

Overview
NameF5/8 type C domain-containing protein
Smed IDSMED30032806
Length (bp)1084
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F5/8 type C domain-containing protein (SMED30032806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F5/8 type C domain-containing protein (SMED30032806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30032806h1SMcG0001776 Contig20442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032806h1SMcG0001776 Contig20442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30032806h1SMcG0001776 dd_Smed_v4_1477_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032806h1SMcG0001776 dd_Smed_v4_1477_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032806h1SMcG0001776 Contig14092uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032806h1SMcG0001776 Contig14092newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F5/8 type C domain-containing protein vs. Ensembl Zebrafish
Match: si:cabz01040626.2 (si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113-147])

HSP 1 Score: 56.225 bits (134), Expect = 2.131e-8
Identity = 28/98 (28.57%), Postives = 52/98 (53.06%), Query Frame = 3
Query:    3 MLMKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            +++ L+F  F S+   + G  V+++   T     +  +  + P Y  DG   +  HT+   L +W +DL   +S++ + + NR DCC ER+NGA + +
Sbjct:    4 IILCLLFPGFFSVQMSVRGIEVNIAGWGTAIQSTMYYD--WFPKYALDGINSSCTHTATQTLPWWRLDLQKSYSVNRVSITNRLDCCSERINGAEIRI 99          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Zebrafish
Match: si:cabz01040626.2 (si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113-147])

HSP 1 Score: 53.5286 bits (127), Expect = 1.919e-7
Identity = 26/93 (27.96%), Postives = 48/93 (51.61%), Query Frame = 3
Query:   18 IFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            + + F S+   + G  V+++   T     +  +  + P Y  DG   +  HT+   L +W +DL   +S++ + + NR DCC ER+NGA + +
Sbjct:   12 LLLGFFSVQMSVRGIEVNIAGWGTAIQSTMYYD--WFPKYALDGINSSCTHTATQTLPWWRLDLQKSYSVNRVSITNRLDCCSERINGAEIRI 102          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Zebrafish
Match: zgc:171424 (zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26])

HSP 1 Score: 50.0618 bits (118), Expect = 1.948e-7
Identity = 26/93 (27.96%), Postives = 48/93 (51.61%), Query Frame = 3
Query:   18 IFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            + + F+S++T   G  V+++   T T   +  + +  P    +G      HT    L +W +DL   +S++ + + NR DCC ER+NGA + +
Sbjct:   12 LLLGFLSVETSAAGTEVNIAGWGTATQSTIYMDGL--PVNALNGISPPCTHTIVQTLPWWRLDLQKSYSVNRVSITNRLDCCSERINGAEIRI 102          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Zebrafish
Match: zgc:171424 (zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26])

HSP 1 Score: 50.447 bits (119), Expect = 1.527e-6
Identity = 26/93 (27.96%), Postives = 48/93 (51.61%), Query Frame = 3
Query:   18 IFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            + + F+S++T   G  V+++   T T   +  + +  P    +G      HT    L +W +DL   +S++ + + NR DCC ER+NGA + +
Sbjct:   12 LLLGFLSVETSAAGTEVNIAGWGTATQSTIYMDGL--PVNALNGISPPCTHTIVQTLPWWRLDLQKSYSVNRVSITNRLDCCSERINGAEIRI 102          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 67.3958 bits (163), Expect = 5.364e-12
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT+++N A+W +DL   + +  +++ NR DCC ERL GAV+ +    N    VCG+I   S   + L CK  K   + V    R E L   E+E Y 
Sbjct:   64 HTNSDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYG 160          

HSP 2 Score: 53.1434 bits (126), Expect = 2.466e-7
Identity = 35/111 (31.53%), Postives = 53/111 (47.75%), Query Frame = 3
Query:  144 DGDYDT------FCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            DGD  T        HT+ +N A+W +DL  +++I  +++ NR DCC ERL GA + +         VC ++   S   + L C     + I V    R+E L   E+E Y 
Sbjct:  194 DGDKGTNIFQHPCSHTNPDNPAWWQLDLTKKYNIESVVIVNRGDCCSERLRGAEIRVGIFPFINSPVCDTVTDVSKPTITLNCNGMVGQYISVVIPGRQEYLTLCEVEVYG 304          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 67.3958 bits (163), Expect = 1.061e-11
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  187 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 304          

HSP 2 Score: 60.077 bits (144), Expect = 2.323e-9
Identity = 33/97 (34.02%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT  +N A+W +DL   + +  +++ NR DCC ERL GA V + S ++    VCG +   S   + L C       + V    R E L   E+E YA
Sbjct:  348 HTGNDNPAWWQLDLKKPYRVEKVLIVNRGDCCGERLLGAEVRVGSSSSRDNPVCGVVTDVSKPTITLSCNGMGGRYVSVVIPGRPETLQLCEVEVYA 444          

HSP 3 Score: 52.7582 bits (125), Expect = 4.816e-7
Identity = 31/97 (31.96%), Postives = 47/97 (48.45%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
             T  ++ A+W  D+   + +  +++ NR DCC  RL GA V +    +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   65 QTQKDSPAWWQADMINIYKVETVVIVNRMDCCSARLLGAEVRVGDSPDNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 161          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 67.0106 bits (162), Expect = 1.152e-11
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  204 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 321          

HSP 2 Score: 62.7734 bits (151), Expect = 2.787e-10
Identity = 42/122 (34.43%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  123 YPPSY----CNDGD------YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            Y P Y     NDGD      Y +   T ++N A+W +DL   + +  +++ NR DCC ERL GA V +    +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   57 YRPEYGAGNANDGDTTSNMRYGSCSLTGSDNPAWWRLDLTKCYKVEKVVIVNRGDCCWERLLGAEVRVGDSADNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 178          

HSP 3 Score: 60.077 bits (144), Expect = 2.269e-9
Identity = 33/97 (34.02%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT  +N A+W +DL   + +  +++ NR DCC ERL GA V + S ++    VCG +   S   + L C       + V    R E L   E+E YA
Sbjct:  365 HTGNDNPAWWQLDLKKPYRVEKVLIVNRGDCCGERLLGAEVRVGSSSSRDNPVCGVVTDVSKPTITLSCNGMGGRYVSVVIPGRPETLQLCEVEVYA 461          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 67.0106 bits (162), Expect = 1.152e-11
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  204 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 321          

HSP 2 Score: 62.7734 bits (151), Expect = 2.664e-10
Identity = 49/164 (29.88%), Postives = 75/164 (45.73%), Query Frame = 3
Query:    9 MKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLIA----NLVYPPSY----CNDGD------YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            MK I +L I +     G + S +      ++ ++     +  Y P Y     NDGD      Y +   T ++N A+W +DL   + +  +++ NR DCC ERL GA V +    +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   18 MKCIVVLLIGVSI---GWVHSCNVPPGDVNLAVLGVATQSSTYRPEYGAGNANDGDTTSNMRYGSCSLTGSDNPAWWRLDLTKCYKVEKVVIVNRGDCCWERLLGAEVRVGDSADNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 178          

HSP 3 Score: 60.077 bits (144), Expect = 2.249e-9
Identity = 33/97 (34.02%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT  +N A+W +DL   + +  +++ NR DCC ERL GA V + S ++    VCG +   S   + L C       + V    R E L   E+E YA
Sbjct:  365 HTGNDNPAWWQLDLKKPYRVEKVLIVNRGDCCGERLLGAEVRVGSSSSRDNPVCGVVTDVSKPTITLSCNGMGGRYVSVVIPGRPETLQLCEVEVYA 461          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Match: ncapg2 (non-SMC condensin II complex subunit G2 [Source:Xenbase;Acc:XB-GENE-1002744])

HSP 1 Score: 67.0106 bits (162), Expect = 1.205e-11
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  187 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 304          

HSP 2 Score: 60.077 bits (144), Expect = 2.261e-9
Identity = 33/97 (34.02%), Postives = 48/97 (49.48%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT  +N A+W +DL   + +  +++ NR DCC ERL GA V + S ++    VCG +   S   + L C       + V    R E L   E+E YA
Sbjct:  348 HTGNDNPAWWQLDLKKPYRVEKVLIVNRGDCCGERLLGAEVRVGSSSSRDNPVCGVVTDVSKPTITLSCNGMGGRYVSVVIPGRPETLQLCEVEVYA 444          

HSP 3 Score: 58.151 bits (139), Expect = 8.578e-9
Identity = 38/118 (32.20%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  123 YPPSYCNDG--DYDTFCHTSA----NNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            YP     DG  D +TF    A    +   +W +DL   + +  +++ NR DCC +RL GA + + S  +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   44 YPAEKAVDGIKDTNTFARPCAITGYDKGPWWQLDLKKNYRVGSMVIVNRGDCCADRLKGAEIRVGSSPDNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 161          
BLAST of F5/8 type C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9I931|FUCL1_ANGJA (Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 8.149e-9
Identity = 48/174 (27.59%), Postives = 80/174 (45.98%), Query Frame = 3
Query:    3 MLMKLIFILF--ISIDTFLNGNL--------VSVSKKSTQTDIPLIANLVYP-PSYCNDGDYDT------FCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSK------NNEVIHVCGSINSTSYIHVLQCKSKKAEK-IRVRHTRKEALHFGELEAYA 452
            M +K I +LF  ++I T  + ++        V+V  K+TQ+ +P  A  V   P +  DG+ D+        HT+ +   +W VDL   ++I+ + + NR DCC ER++GA + + +       NN    V GS+  T       C      + + V   + E L   E+E  A
Sbjct:    1 MKVKTIMLLFQILAISTIKSADVPNRYIQENVAVRGKATQSTLPSGAGAVLSLPGFAIDGNRDSDFSHGSCSHTTNSPNPWWRVDLLQLYTITSVTITNRGDCCGERISGARILIGNSLENNGINNPACSVIGSM-ETGETRTFHCPQPMIGRYVTVYLPKTEVLQLCEVEVNA 173          
BLAST of F5/8 type C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9I926|FUCL6_ANGJA (Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.035e-7
Identity = 40/119 (33.61%), Postives = 60/119 (50.42%), Query Frame = 3
Query:    3 MLMKLIFILFISI---------DTFLNGNLVSVSKKSTQTD-IPLIANLVYPPSYCNDGDYDTF------CHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNN 311
            M+M L  IL IS          D ++  N V+V  K+TQ+D +    +     S   DG+ D++       HTS     +W VDL  E+ I+ + + NR DCC ER+ GA + ++ KNN
Sbjct:   14 MIMLLFQILAISTLQSVSAYIPDRYIQEN-VAVRGKATQSDQLQGQWDAFSHASNAIDGNQDSYFYHGSCTHTSGGANPWWRVDLLQEYKITSVTITNRGDCCGERITGARI-IIGKNN 130          
BLAST of F5/8 type C domain-containing protein vs. UniProt/SwissProt
Match: sp|P49263|PXN1_XENLA (Pentraxin fusion protein OS=Xenopus laevis OX=8355 GN=pxn1 PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.364e-6
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 3
Query:  165 CHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEV---IHVCGSINSTSYIHVLQCKSKKAEKIRVRHT---RKEALHFGELEAYAD 455
            CHT      +W +D+  +  +  + + NR DCCRER+NGA + + +   E       CG +   +Y   L    K+ E   V  T   R E L   E++ +AD
Sbjct:   76 CHTEKQMHPWWQLDMKSKMRVHSVAITNRGDCCRERINGAEIRIGNSKKEGGLNSTRCGVVFKMNYEETLSFNCKELEGRYVTVTIPDRIEYLTLCEVQVFAD 178          
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Match: A0A5G3LDN6 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100127564 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.423e-9
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  168 HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            HT+++N A+W +DL   + +  +++ NR DCC ERL GAV+ +    N    VCG+I   S   + L CK  K   + V    R E L   E+E Y 
Sbjct:   64 HTNSDNPAWWQLDLKKRYKVETVVIVNRGDCCWERLRGAVIRVGDSANNNNPVCGAITDASQATITLPCKGMKGRYVSVVIPGRNEYLTLCEVEVYG 160          
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Match: B5DFT4 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=LOC100135371 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.579e-8
Identity = 40/118 (33.90%), Postives = 60/118 (50.85%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E+L   E+E Y 
Sbjct:  187 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAESLQLCEVEVYG 304          

HSP 2 Score: 65.0846 bits (157), Expect = 8.690e-8
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  171 TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            T+ +N A+W VDL   +S+  +++ NR DCCRERL GA + + +  +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   66 TAYDNPAWWQVDLKKTYSVDTVVIVNRGDCCRERLRGAEIRVGNSPDNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 161          
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Match: A0A5G3JGD5 (Non-SMC condensin II complex subunit G2 OS=Xenopus tropicalis OX=8364 GN=ncapg2 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.667e-8
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  187 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 304          
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Match: A0A5G3JHS6 (Non-SMC condensin II complex subunit G2 OS=Xenopus tropicalis OX=8364 GN=ncapg2 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.808e-8
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  204 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 321          

HSP 2 Score: 62.7734 bits (151), Expect = 4.184e-7
Identity = 49/164 (29.88%), Postives = 75/164 (45.73%), Query Frame = 3
Query:    9 MKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLIA----NLVYPPSY----CNDGD------YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            MK I +L I +     G + S +      ++ ++     +  Y P Y     NDGD      Y +   T ++N A+W +DL   + +  +++ NR DCC ERL GA V +    +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   18 MKCIVVLLIGVSI---GWVHSCNVPPGDVNLAVLGVATQSSTYRPEYGAGNANDGDTTSNMRYGSCSLTGSDNPAWWRLDLTKCYKVEKVVIVNRGDCCWERLLGAEVRVGDSADNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 178          
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Match: A0A5G3HS84 (Non-SMC condensin II complex subunit G2 OS=Xenopus tropicalis OX=8364 GN=ncapg2 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.808e-8
Identity = 40/118 (33.90%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  123 YPPSYCNDGDYDT-----FCH-TSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHV-LQCKSKKAEKIRVRHTRK-EALHFGELEAYA 452
            Y  S  NDG+ +       C  T ++N A+W +DL   +S+  +++ NR DCC ERL GA V + S  N    VCG++  TS   + L C   +   + V   R+ E L   E+E Y 
Sbjct:  204 YGASNANDGNKNANMMKGSCSLTGSDNPAWWQLDLKKPYSVEKVVIVNRGDCCWERLQGAEVRVGSSTNNKNPVCGTVTDTSQGTITLSCNGMEGRYVSVVIPRRAETLQLCEVEVYG 321          

HSP 2 Score: 62.7734 bits (151), Expect = 4.376e-7
Identity = 42/122 (34.43%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  123 YPPSY----CNDGD------YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINS-TSYIHVLQCKSKKAEKIRVR-HTRKEALHFGELEAYA 452
            Y P Y     NDGD      Y +   T ++N A+W +DL   + +  +++ NR DCC ERL GA V +    +    VCG IN  ++ I  L C  K+   + V    R E L+  ELE Y 
Sbjct:   57 YRPEYGAGNANDGDTTSNMRYGSCSLTGSDNPAWWRLDLTKCYKVEKVVIVNRGDCCWERLLGAEVRVGDSADNNNPVCGIINDFSNLITTLCCDGKEGRYVSVVIPGRNEYLNLCELEVYG 178          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000008082.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:63101:75869:-1 gene:ENSAMXG00000007863.2 transcript:ENSAMXT00000008082.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.075e-7
Identity = 20/55 (36.36%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  132 SYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            +Y ++ +Y +  HT+     +W +DL GE+ I+ I + NR DCC ER++GA + +
Sbjct:  198 NYFSNANYGSCTHTATEENPWWRLDLEGEYEITSITITNRGDCCSERIDGAEIRI 252          

HSP 2 Score: 49.2914 bits (116), Expect = 3.094e-6
Identity = 19/48 (39.58%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  153 YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            Y +  HT+     +W +DL  E+ I+ I + NR DCC ER+NGA + +
Sbjct:   57 YGSCTHTATEQNPWWRLDLQDEYKITSITITNRGDCCSERINGAEIRI 104          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037268.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:63101:73310:-1 gene:ENSAMXG00000007863.2 transcript:ENSAMXT00000037268.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.237e-7
Identity = 20/55 (36.36%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  132 SYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            +Y ++ +Y +  HT+     +W +DL GE+ I+ I + NR DCC ER++GA + +
Sbjct:  208 NYFSNANYGSCTHTATEENPWWRLDLEGEYEITSITITNRGDCCSERIDGAEIRI 262          

HSP 2 Score: 49.2914 bits (116), Expect = 3.347e-6
Identity = 19/48 (39.58%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  153 YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            Y +  HT+     +W +DL  E+ I+ I + NR DCC ER+NGA + +
Sbjct:   67 YGSCTHTATEQNPWWRLDLQDEYKITSITITNRGDCCSERINGAEIRI 114          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:20514542:20521975:-1 gene:ENSAMXG00000040584.1 transcript:ENSAMXT00000031153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 5.234e-7
Identity = 36/106 (33.96%), Postives = 48/106 (45.28%), Query Frame = 3
Query:   42 DTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTS-ANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL---LSKNNEVIHVCGSINST 347
            D  L GN    + +S+ +D P     +      N   Y   C T+   N  +W VDL   F+I  +I+ NR DCC ERLNG  + +   L  N      C  INST
Sbjct:   24 DLALRGN----ATQSSSSDFPQFHAALANDGITNTNIYALSCSTTDRENQPWWRVDLLDVFNIGKVIVTNRGDCCPERLNGTEIRIGNSLQNNGNNNPRCAVINST 125          
BLAST of F5/8 type C domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000056118.1 (fucolectin-4-like [Source:NCBI gene;Acc:103037148])

HSP 1 Score: 46.595 bits (109), Expect = 6.304e-6
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 3
Query:  141 NDGDYDTFC-HTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVEL 296
            N   +D  C HTS  N  +W VDL  ++ I+ I + NR DCC  R+NGA + +
Sbjct:   55 NSNYHDGSCSHTSTQNNPWWRVDLLYKYKITSITITNRGDCCANRINGAEIRV 107          
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Match: SMESG000059878.1 (SMESG000059878.1)

HSP 1 Score: 321.242 bits (822), Expect = 3.248e-111
Identity = 153/154 (99.35%), Postives = 154/154 (100.00%), Query Frame = 3
Query:    3 MLMKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQM 464
            MLMKLIFILFISIDTFLNGNLVSVSKKSTQTDIPL+ANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQM
Sbjct:    1 MLMKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLVANLVYPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQM 154          
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Match: SMESG000059574.1 (SMESG000059574.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.755e-32
Identity = 64/152 (42.11%), Postives = 93/152 (61.18%), Query Frame = 3
Query:    6 LMKLIFI---LFISIDTFLNGNLVSVSKKSTQTDIPLIANLV--YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEA 446
            +++LI +   + I  +   + +++S  K +TQT      N    YP S C DG+ + FCHTS +   +W VDL G ++I  ++LYNR DCC+ R+ G +VELLSK NE+IH CG I  +   +V+ C +K   KIRVRHT+ E LHF +LE 
Sbjct:    1 MIRLILVSWSMLILCEFVYSQDVISKGKPATQT-----GNYQNKYPASLCVDGNLNNFCHTSLDGNPFWMVDLEGLYTIDSVVLYNRVDCCQSRIVGVIVELLSKTNELIHQCGKIIESKPSYVISCGNKIGNKIRVRHTKNEFLHFRDLEV 147          

HSP 2 Score: 119.398 bits (298), Expect = 7.242e-31
Identity = 51/113 (45.13%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  123 YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQ 461
            +P + CNDG +D FCHT+    + W VDLAG F+I  ++L+NRKDCC ER+ G V+ELL+KN+E+   CG +          C  K A KIRV+ T+ + L+F ELE Y + +
Sbjct:  178 FPAALCNDGKFDNFCHTTQAVNSSWTVDLAGTFNIQSLVLHNRKDCCSERIVGTVIELLNKNDEISDQCGIVKENKPTFTFSCDGKLAAKIRVKQTQNQILNFAELEVYGEVE 290          
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Match: SMESG000059574.1 (SMESG000059574.1)

HSP 1 Score: 123.635 bits (309), Expect = 2.033e-32
Identity = 64/152 (42.11%), Postives = 93/152 (61.18%), Query Frame = 3
Query:    6 LMKLIFI---LFISIDTFLNGNLVSVSKKSTQTDIPLIANLV--YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEA 446
            +++LI +   + I  +   + +++S  K +TQT      N    YP S C DG+ + FCHTS +   +W VDL G ++I  ++LYNR DCC+ R+ G +VELLSK NE+IH CG I  +   +V+ C +K   KIRVRHT+ E LHF +LE 
Sbjct:   10 MIRLILVSWSMLILCEFVYSQDVISKGKPATQT-----GNYQNKYPASLCVDGNLNNFCHTSLDGNPFWMVDLEGLYTIDSVVLYNRVDCCQSRIVGVIVELLSKTNELIHQCGKIIESKPSYVISCGNKIGNKIRVRHTKNEFLHFRDLEV 156          

HSP 2 Score: 119.398 bits (298), Expect = 7.220e-31
Identity = 51/113 (45.13%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  123 YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQ 461
            +P + CNDG +D FCHT+    + W VDLAG F+I  ++L+NRKDCC ER+ G V+ELL+KN+E+   CG +          C  K A KIRV+ T+ + L+F ELE Y + +
Sbjct:  187 FPAALCNDGKFDNFCHTTQAVNSSWTVDLAGTFNIQSLVLHNRKDCCSERIVGTVIELLNKNDEISDQCGIVKENKPTFTFSCDGKLAAKIRVKQTQNQILNFAELEVYGEVE 299          
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Match: SMESG000059574.1 (SMESG000059574.1)

HSP 1 Score: 122.865 bits (307), Expect = 2.689e-32
Identity = 61/130 (46.92%), Postives = 83/130 (63.85%), Query Frame = 3
Query:   60 NLVSVSKKSTQTDIPLIANLV--YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELE 443
            +++S  K +TQT      N    YP S C DG+ + FCHTS +   +W VDL G ++I  ++LYNR DCC+ R+ G +VELLSK NE+IH CG I  +   +V+ C +K   KIRVRHT+ E LHF +LE
Sbjct:   12 DVISKGKPATQT-----GNYQNKYPASLCVDGNLNNFCHTSLDGNPFWMVDLEGLYTIDSVVLYNRVDCCQSRIVGVIVELLSKTNELIHQCGKIIESKPSYVISCGNKIGNKIRVRHTKNEFLHFRDLE 136          

HSP 2 Score: 119.013 bits (297), Expect = 6.937e-31
Identity = 51/113 (45.13%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  123 YPPSYCNDGDYDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYADCQ 461
            +P + CNDG +D FCHT+    + W VDLAG F+I  ++L+NRKDCC ER+ G V+ELL+KN+E+   CG +          C  K A KIRV+ T+ + L+F ELE Y + +
Sbjct:  168 FPAALCNDGKFDNFCHTTQAVNSSWTVDLAGTFNIQSLVLHNRKDCCSERIVGTVIELLNKNDEISDQCGIVKENKPTFTFSCDGKLAAKIRVKQTQNQILNFAELEVYGEVE 280          
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Match: SMESG000014428.1 (SMESG000014428.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.431e-22
Identity = 48/153 (31.37%), Postives = 85/153 (55.56%), Query Frame = 3
Query:   15 LIFILFISIDTFLNGN-LVSVSKKSTQTDIPLIANLVYPPSYCNDGDY------DTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLSKNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYA 452
            L  IL++S+ +++N + ++S  K ++Q+       L +  SY  DG+       D   HT+ ++  +W VDL G ++I+ +I++NR      RL GA+VE+L  N  V+  CG + +   +H+L C+  +  K+R+R TR E L   E++ Y 
Sbjct:    2 LFLILYLSLTSYVNCDVMLSQGKPASQSS----DYLSFVASYAVDGNVGQSLNKDKCSHTNKDSQPWWMVDLQGSYAITSVIIFNRNSFVSNRLVGAIVEVLDSNGLVVSRCGEVKTDDSVHLLHCQKSRGSKVRIRMTRPEYLTLCEVQVYG 150          
The following BLAST results are available for this feature:
BLAST of F5/8 type C domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:cabz01040626.22.131e-828.57si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
si:cabz01040626.21.919e-727.96si:cabz01040626.2 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
zgc:1714241.948e-727.96zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26][more]
zgc:1714241.527e-627.96zgc:171424 [Source:ZFIN;Acc:ZDB-GENE-080204-26][more]
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fucolectin5.364e-1236.08x-epilectin [Source:NCBI gene;Acc:100144955][more]
ncapg21.061e-1133.90non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg21.152e-1133.90non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg21.152e-1133.90non-SMC condensin II complex subunit G2 [Source:Xe... [more]
ncapg21.205e-1133.90non-SMC condensin II complex subunit G2 [Source:Xe... [more]
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9I931|FUCL1_ANGJA8.149e-927.59Fucolectin-1 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I926|FUCL6_ANGJA1.035e-733.61Fucolectin-6 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|P49263|PXN1_XENLA4.364e-630.10Pentraxin fusion protein OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of F5/8 type C domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3LDN68.423e-936.08Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
B5DFT41.579e-833.90Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3JGD51.667e-833.90Non-SMC condensin II complex subunit G2 OS=Xenopus... [more]
A0A5G3JHS61.808e-833.90Non-SMC condensin II complex subunit G2 OS=Xenopus... [more]
A0A5G3HS841.808e-833.90Non-SMC condensin II complex subunit G2 OS=Xenopus... [more]
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000008082.22.075e-736.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037268.12.237e-736.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031153.15.234e-733.96pep primary_assembly:Astyanax_mexicanus-2.0:21:205... [more]
ENSAMXT00000056118.16.304e-641.51fucolectin-4-like [Source:NCBI gene;Acc:103037148][more]
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F5/8 type C domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059878.13.248e-11199.35SMESG000059878.1[more]
SMESG000059574.11.755e-3242.11SMESG000059574.1[more]
SMESG000059574.12.033e-3242.11SMESG000059574.1[more]
SMESG000059574.12.689e-3246.92SMESG000059574.1[more]
SMESG000014428.11.431e-2231.37SMESG000014428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032806 ID=SMED30032806|Name=F5/8 type C domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1084bp
CTATGCTGATGAAATTAATATTTATTTTATTTATTTCTATAGATACATTC
CTGAATGGAAATCTAGTTTCTGTATCTAAAAAGAGTACTCAAACTGACAT
TCCGCTTATTGCGAATTTAGTCTATCCACCGAGTTATTGCAATGATGGTG
ACTACGACACCTTTTGTCATACGTCGGCGAACAATTTGGCATATTGGGCG
GTGGATTTAGCTGGGGAATTCTCCATTTCTCACATCATTTTGTACAACAG
AAAGGATTGCTGCCGTGAGAGACTAAATGGGGCTGTCGTAGAACTGCTTT
CGAAAAATAATGAAGTCATTCATGTATGTGGCTCGATTAATTCAACCAGC
TATATTCATGTTTTACAATGCAAAAGCAAAAAAGCTGAAAAAATTCGAGT
ACGTCACACGAGAAAAGAAGCGTTACATTTTGGAGAACTTGAAGCTTATG
CCGATTGTCAAATGTGAAGTTTTCCTAAGACAACATTTAATTTTAGAATC
AAATAATTTTTGATTAAATATTATTAACATAAAATTGTGTGTCAATGTCA
GTAGTGAAATATTTGAAAATATGTTAATATCAAAAATTTGTTTTGTATAG
AATATATTTATTAACAGTAATATATTTATTAAATTTACCCAATTCTTTTA
TGACACAGAAATCCGTGTTAAGAAAAACTTTTTAAAAAAGAAGGAAAACT
GTAAAAGTTCTAATATACATACGTATGCACATAATATACATTTTTATTGG
TTCAAAAACTCAAAATAATCCTAAGTCATAGATAAAGTCAGAAGTGCAAA
CAAACAAAAAGAAATATTTAGACTTTGAATAGAAATCCCTGGCATAATCA
AAATTAAGAATAGACAACTTCAAATTATAAATAGAGACAATGAAATAATA
TTTAGTACACAAGTATTCGTCCCTATTCCGTTTCGTATCTAGGGTATGGT
ATGTATGGTACGTGTCCTAAGCGCAAGTTTAATAATGCACTAAAAAATAT
ATATTATAAAGAAAAAAAATATAACATAGCGCAGCGGTTCCTAAACTATG
GTACGCAAACCACTGGGGTTATACTTTACTTTTA
back to top

protein sequence of SMED30032806-orf-1

>SMED30032806-orf-1 ID=SMED30032806-orf-1|Name=SMED30032806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MLMKLIFILFISIDTFLNGNLVSVSKKSTQTDIPLIANLVYPPSYCNDGD
YDTFCHTSANNLAYWAVDLAGEFSISHIILYNRKDCCRERLNGAVVELLS
KNNEVIHVCGSINSTSYIHVLQCKSKKAEKIRVRHTRKEALHFGELEAYA
DCQM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006585FTP1
IPR000421FA58C
IPR008979Galactose-bd-like_sf
Vocabulary: biological process
TermDefinition
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006585Fucolectin tachylectin-4 pentraxin-1SMARTSM00607ftpcoord: 19..153
e-value: 0.0074
score: -10.0
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 41..137
e-value: 1.3E-7
score: 31.8
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 18..150
e-value: 7.9E-20
score: 73.2
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 37..150
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 21..151
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.685