Ankyrin repeat and LEM domain-containing protein 2

Overview
NameAnkyrin repeat and LEM domain-containing protein 2
Smed IDSMED30032804
Length (bp)2063
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat and LEM domain-containing protein 2 (SMED30032804) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat and LEM domain-containing protein 2 (SMED30032804) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat and LEM domain-containing protein 2 (SMED30032804) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat and LEM domain-containing protein 2 (SMED30032804) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032804

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032804h1SMcG0002035 SmedASXL_017057SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30032804h1SMcG0002035 dd_Smed_v4_14491_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Human
Match: ANKLE2 (ankyrin repeat and LEM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29101])

HSP 1 Score: 180.644 bits (457), Expect = 5.431e-47
Identity = 108/325 (33.23%), Postives = 162/325 (49.85%), Query Frame = 1
Query:  343 FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-IGYRFDNSFEVASWHDASHGAAI-DRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL 1308
            + N    DL   L+  +E+G  +   +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  I +  LD L    F   +YP   E   + R+  V+D+YLN P+    +TPLH A KFGN + + +L    L     RNK    PE++IC+RS + S   + E IR+     + V                 LLR    ++  IG  +       + H + +G +  D +  +RA+ GPL   KA      W     + A     +++SD E+G E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +Q++
Sbjct:  301 YKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELK-ERIREYLKGHYYV----------------PLLRAEETSSPVIGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPERGFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEI 608          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Human
Match: ANKLE2 (ankyrin repeat and LEM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29101])

HSP 1 Score: 72.4034 bits (176), Expect = 9.241e-15
Identity = 39/101 (38.61%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  490 RYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEE 792
            RYN +HVA   NQ  I +  LD L    F   +YP   E   + R+  V+D+YLN P+    +TPLH A KFGN + + +L    L     RNK    PE+
Sbjct:    4 RYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPED 104          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Celegans
Match: lem-4 (Ankyrin repeat and LEM domain-containing protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:H2KZB2])

HSP 1 Score: 145.591 bits (366), Expect = 1.316e-36
Identity = 115/377 (30.50%), Postives = 177/377 (46.95%), Query Frame = 1
Query:  220 SRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILV-TESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGV-VRAYIGP-LEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAY--VDLGCDDGLQQLEDHLAKQQLTGCQGNDVS 1335
            +RF  F  P EA  F   A  D   +       +  + + PF   ++  +N  K  +E+G +E    LV +NPR LV T  D  + +   FRYNALH+A  + Q +I+  +L+ +  I F I +Y T  ++    ++N +LD YLN P+ GN +TPLH ASKFG +  +R+L     TD TL NKSG        + + D +      E + +      + ++G                 L RN   G        V+    A++  +     V V A  GP   + +AR  +  W     Q A K  E++R+D +KG E  GR LA +  A WRE W FL +   +DLG + GL  LE  L +++    + +++S
Sbjct:   50 ARFKKFGTPREAMDF--LAYGDAPTTPKTVPPVAPTEPNSPFSGVNRIQMNEFKKYVEKGDMENFLRLVDSNPRFLVNTGGDVASIVMEGFRYNALHIAAKAGQTEIIAKILELIQNIDFLIRLYGTGADDVTLRKIN-ILDSYLNTPDKGNSDTPLHFASKFGKIGVVRVLTENSATDRTLLNKSG--------KSALDCAGERYTGEDKDMVQRDIHLAIEG-------------FYVFLHRNPTTG---STQLTVSQKPPATYSTSPTTATVTVSAQAGPFFTEREARDFAKSW-----QTAGK--ELKRTDFDKGWERVGRVLAEQSEAMWRETWHFLGSMELLDLGSEQGLGVLEAFLREKRRGNLRNSEIS 392          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Celegans
Match: lem-4 (Ankyrin repeat and LEM domain-containing protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:H2KZB2])

HSP 1 Score: 145.591 bits (366), Expect = 1.676e-36
Identity = 115/377 (30.50%), Postives = 177/377 (46.95%), Query Frame = 1
Query:  220 SRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILV-TESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGV-VRAYIGP-LEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAY--VDLGCDDGLQQLEDHLAKQQLTGCQGNDVS 1335
            +RF  F  P EA  F   A  D   +       +  + + PF   ++  +N  K  +E+G +E    LV +NPR LV T  D  + +   FRYNALH+A  + Q +I+  +L+ +  I F I +Y T  ++    ++N +LD YLN P+ GN +TPLH ASKFG +  +R+L     TD TL NKSG        + + D +      E + +      + ++G                 L RN   G        V+    A++  +     V V A  GP   + +AR  +  W     Q A K  E++R+D +KG E  GR LA +  A WRE W FL +   +DLG + GL  LE  L +++    + +++S
Sbjct:   73 ARFKKFGTPREAMDF--LAYGDAPTTPKTVPPVAPTEPNSPFSGVNRIQMNEFKKYVEKGDMENFLRLVDSNPRFLVNTGGDVASIVMEGFRYNALHIAAKAGQTEIIAKILELIQNIDFLIRLYGTGADDVTLRKIN-ILDSYLNTPDKGNSDTPLHFASKFGKIGVVRVLTENSATDRTLLNKSG--------KSALDCAGERYTGEDKDMVQRDIHLAIEG-------------FYVFLHRNPTTG---STQLTVSQKPPATYSTSPTTATVTVSAQAGPFFTEREARDFAKSW-----QTAGK--ELKRTDFDKGWERVGRVLAEQSEAMWRETWHFLGSMELLDLGSEQGLGVLEAFLREKRRGNLRNSEIS 415          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Fly
Match: Ankle2 (gene:FBgn0028343 transcript:FBtr0340625)

HSP 1 Score: 103.219 bits (256), Expect = 2.716e-22
Identity = 78/262 (29.77%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  340 PFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIY---PTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-----IGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRW 1101
            PF   ++ +L   +  IE G +++VK ++W NPR L++  D+PT L+   RYNA+H+    N+ +I + +L  +++  F   +Y     + + C    ++ +LD YLN P+ G  ETPLH A+K G+V  + +L+       +LRN  G +P+EIIC R+   +NA+       V  +K  +LL        DP  HF  + +LR  ++     +G  F         H A     +     + A  GP+   KA     RW
Sbjct:  227 PFRAPTKQELVEFRKQIEGGHIDRVKRIIWENPRFLISSGDTPTSLKEGCRYNAMHICAQVNKARIAQLLLKTISDREF-TQLYVGKKGSGKMCAALNIS-LLDYYLNMPDKGRGETPLHFAAKNGHVAMVEVLVSYPECK-SLRNHEGKEPKEIICLRN---ANAT------HVTIKKLELLL-------YDP--HF--VPVLRSQSNTLPPKVGQPFSPKDPPNLQHKADDYEGLSVDLAISALAGPMSREKAMNFYRRW 465          

HSP 2 Score: 58.5362 bits (140), Expect = 1.901e-8
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  931 LRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHL 1293
            +R ++ +  + YR +NSF+  S  D S    I  + + R+    L D      S+R              I+ +D EKG+E+ GR LA +    WRE W FLD+++D+G  +GL +LE + 
Sbjct:  558 IRKMKPDLFMAYRNNNSFDSPSLADDSQ---ILDMSLSRSLNASLND------SFRE-----------RHIKNTDIEKGLEVVGRQLARQEQLEWREYWDFLDSFLDIGTTEGLARLEAYF 658          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Fly
Match: Ankle2 (gene:FBgn0028343 transcript:FBtr0301414)

HSP 1 Score: 103.219 bits (256), Expect = 2.893e-22
Identity = 78/262 (29.77%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  340 PFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIY---PTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-----IGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRW 1101
            PF   ++ +L   +  IE G +++VK ++W NPR L++  D+PT L+   RYNA+H+    N+ +I + +L  +++  F   +Y     + + C    ++ +LD YLN P+ G  ETPLH A+K G+V  + +L+       +LRN  G +P+EIIC R+   +NA+       V  +K  +LL        DP  HF  + +LR  ++     +G  F         H A     +     + A  GP+   KA     RW
Sbjct:  227 PFRAPTKQELVEFRKQIEGGHIDRVKRIIWENPRFLISSGDTPTSLKEGCRYNAMHICAQVNKARIAQLLLKTISDREF-TQLYVGKKGSGKMCAALNIS-LLDYYLNMPDKGRGETPLHFAAKNGHVAMVEVLVSYPECK-SLRNHEGKEPKEIICLRN---ANAT------HVTIKKLELLL-------YDP--HF--VPVLRSQSNTLPPKVGQPFSPKDPPNLQHKADDYEGLSVDLAISALAGPMSREKAMNFYRRW 465          

HSP 2 Score: 58.5362 bits (140), Expect = 1.903e-8
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  931 LRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQ 1302
            +R ++ +  + YR +NSF+  S  D S    I  + + R+    L D      S+R              I+ +D EKG+E+ GR LA +    WRE W FLD+++D+G  +GL +LE +  ++
Sbjct:  558 IRKMKPDLFMAYRNNNSFDSPSLADDSQ---ILDMSLSRSLNASLND------SFRE-----------RHIKNTDIEKGLEVVGRQLARQEQLEWREYWDFLDSFLDIGTTEGLARLEAYFLEK 661          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Fly
Match: Ankle2 (gene:FBgn0028343 transcript:FBtr0301413)

HSP 1 Score: 103.219 bits (256), Expect = 2.893e-22
Identity = 78/262 (29.77%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  340 PFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIY---PTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-----IGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRW 1101
            PF   ++ +L   +  IE G +++VK ++W NPR L++  D+PT L+   RYNA+H+    N+ +I + +L  +++  F   +Y     + + C    ++ +LD YLN P+ G  ETPLH A+K G+V  + +L+       +LRN  G +P+EIIC R+   +NA+       V  +K  +LL        DP  HF  + +LR  ++     +G  F         H A     +     + A  GP+   KA     RW
Sbjct:  227 PFRAPTKQELVEFRKQIEGGHIDRVKRIIWENPRFLISSGDTPTSLKEGCRYNAMHICAQVNKARIAQLLLKTISDREF-TQLYVGKKGSGKMCAALNIS-LLDYYLNMPDKGRGETPLHFAAKNGHVAMVEVLVSYPECK-SLRNHEGKEPKEIICLRN---ANAT------HVTIKKLELLL-------YDP--HF--VPVLRSQSNTLPPKVGQPFSPKDPPNLQHKADDYEGLSVDLAISALAGPMSREKAMNFYRRW 465          

HSP 2 Score: 58.5362 bits (140), Expect = 1.903e-8
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  931 LRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQ 1302
            +R ++ +  + YR +NSF+  S  D S    I  + + R+    L D      S+R              I+ +D EKG+E+ GR LA +    WRE W FLD+++D+G  +GL +LE +  ++
Sbjct:  558 IRKMKPDLFMAYRNNNSFDSPSLADDSQ---ILDMSLSRSLNASLND------SFRE-----------RHIKNTDIEKGLEVVGRQLARQEQLEWREYWDFLDSFLDIGTTEGLARLEAYFLEK 661          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Fly
Match: Ankle2 (gene:FBgn0028343 transcript:FBtr0301415)

HSP 1 Score: 102.834 bits (255), Expect = 3.390e-22
Identity = 78/262 (29.77%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  340 PFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIY---PTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-----IGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRW 1101
            PF   ++ +L   +  IE G +++VK ++W NPR L++  D+PT L+   RYNA+H+    N+ +I + +L  +++  F   +Y     + + C    ++ +LD YLN P+ G  ETPLH A+K G+V  + +L+       +LRN  G +P+EIIC R+   +NA+       V  +K  +LL        DP  HF  + +LR  ++     +G  F         H A     +     + A  GP+   KA     RW
Sbjct:  163 PFRAPTKQELVEFRKQIEGGHIDRVKRIIWENPRFLISSGDTPTSLKEGCRYNAMHICAQVNKARIAQLLLKTISDREF-TQLYVGKKGSGKMCAALNIS-LLDYYLNMPDKGRGETPLHFAAKNGHVAMVEVLVSYPECK-SLRNHEGKEPKEIICLRN---ANAT------HVTIKKLELLL-------YDP--HF--VPVLRSQSNTLPPKVGQPFSPKDPPNLQHKADDYEGLSVDLAISALAGPMSREKAMNFYRRW 401          

HSP 2 Score: 58.151 bits (139), Expect = 2.383e-8
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  931 LRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQ 1302
            +R ++ +  + YR +NSF+  S  D S    I  + + R+    L D      S+R              I+ +D EKG+E+ GR LA +    WRE W FLD+++D+G  +GL +LE +  ++
Sbjct:  494 IRKMKPDLFMAYRNNNSFDSPSLADDSQ---ILDMSLSRSLNASLND------SFRE-----------RHIKNTDIEKGLEVVGRQLARQEQLEWREYWDFLDSFLDIGTTEGLARLEAYFLEK 597          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Zebrafish
Match: ankle2 (ankyrin repeat and LEM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6090])

HSP 1 Score: 189.504 bits (480), Expect = 4.136e-50
Identity = 133/427 (31.15%), Postives = 205/427 (48.01%), Query Frame = 1
Query:  160 KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXX----------------------XXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND--IG--YRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL---TGCQGNDVSTSNSF 1350
            +  V  D  EA   +K  +G+RF +F +  +A+KF+ K + D   S +K                         T  ++ ++ F +    DL   L+  +E+G      ELVW+NPR L+   D+PT +Q   RYN +HVA   NQP IV+ +LD L    F   +YP  +E+  + R+  ++D+YLN P+    ETPLH A KFG  E + +L      D   +NK   KP E+IC+R   +    +++E++Q  +E             L+   +  LLR    ++   IG  +  +    ++ W   S     D +  VRA+ GPL   KA +    W     + A  F  I +SD ++G E  GR LA E G PW E W FLD++VDL   +GL+ LE++L+K+        +  +  TSN F
Sbjct:  144 RAHVYTDKKEALQAVKMMKGARFKAFSNREDAEKFA-KGICDYYPSPSKSTPCVSPVKPGLVFSKDHPSMIEADTINREKANSFKSPRTQDLTAKLRKAVEKGDELGFTELVWSNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQPGIVQILLDTLENPEFMRLMYPDDLESMLQKRIRYIVDLYLNTPDKAGFETPLHFACKFGCPEVVNILCSHPDIDKNCKNKYNQKPCEVICER---MKEKGKVQEVKQKINE------------YLEERLYIPLLRATDNSSQAVIGAPWSPEPMESLSPWLPRS---PKDPVMAVRAFAGPLSPSKADEFRRAWKTPPRERADHFHNILKSDPDRGAERVGRDLAHELGHPWAEYWDFLDSFVDLQSTEGLKMLEEYLSKKDFRERAHEEAGENETSNRF 551          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Zebrafish
Match: ankle2 (ankyrin repeat and LEM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6090])

HSP 1 Score: 189.504 bits (480), Expect = 4.136e-50
Identity = 133/427 (31.15%), Postives = 205/427 (48.01%), Query Frame = 1
Query:  160 KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXX----------------------XXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND--IG--YRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL---TGCQGNDVSTSNSF 1350
            +  V  D  EA   +K  +G+RF +F +  +A+KF+ K + D   S +K                         T  ++ ++ F +    DL   L+  +E+G      ELVW+NPR L+   D+PT +Q   RYN +HVA   NQP IV+ +LD L    F   +YP  +E+  + R+  ++D+YLN P+    ETPLH A KFG  E + +L      D   +NK   KP E+IC+R   +    +++E++Q  +E             L+   +  LLR    ++   IG  +  +    ++ W   S     D +  VRA+ GPL   KA +    W     + A  F  I +SD ++G E  GR LA E G PW E W FLD++VDL   +GL+ LE++L+K+        +  +  TSN F
Sbjct:  144 RAHVYTDKKEALQAVKMMKGARFKAFSNREDAEKFA-KGICDYYPSPSKSTPCVSPVKPGLVFSKDHPSMIEADTINREKANSFKSPRTQDLTAKLRKAVEKGDELGFTELVWSNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQPGIVQILLDTLENPEFMRLMYPDDLESMLQKRIRYIVDLYLNTPDKAGFETPLHFACKFGCPEVVNILCSHPDIDKNCKNKYNQKPCEVICER---MKEKGKVQEVKQKINE------------YLEERLYIPLLRATDNSSQAVIGAPWSPEPMESLSPWLPRS---PKDPVMAVRAFAGPLSPSKADEFRRAWKTPPRERADHFHNILKSDPDRGAERVGRDLAHELGHPWAEYWDFLDSFVDLQSTEGLKMLEEYLSKKDFRERAHEEAGENETSNRF 551          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Zebrafish
Match: zdhhc8a (zinc finger DHHC-type containing 8a [Source:ZFIN;Acc:ZDB-GENE-091118-26])

HSP 1 Score: 112.079 bits (279), Expect = 1.131e-27
Identity = 72/225 (32.00%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  433 NPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASR--IEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRW 1101
            NPR L+   D+PT LQ   RYN LHVA   NQ  + + +L+ L +  F   +YP   EN    R+  ++D+YLN P+  + ETPLH A KFG  E + +L      D   RNK   +P  +IC+R     N S+   ++I Q   ++F V L       L P+         + +       D S E     D    +  + +  +RA++GPL   KA +   RW
Sbjct:    2 NPRFLIGSGDNPTVLQEGCRYNVLHVAAKENQAGMARLLLETLEDPEFMKLMYPQDQENMLSQRIRYIVDLYLNTPDRASNETPLHFACKFGCPEVVNVLCSHPFIDKHCRNKYDQQPSSVICER----KNRSKDVKQKILQYLEDRFYVPLLRAEDNTLPPVIGAPWCPGAQES------CDQSLE----QDRVMDSPKNPIMTIRAFVGPLSSAKAEEFQRRW 212          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Xenopus
Match: golga2 (golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130])

HSP 1 Score: 171.014 bits (432), Expect = 7.268e-44
Identity = 127/437 (29.06%), Postives = 201/437 (46.00%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSE----------------------KALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEV--ASWHDAS--------HGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            +P  +YAV    ++      K  +  D  EA   +K  +GSRF +F    +A++F+                        ALV D  ++++ +  ++++ ++ F +    DL   L+  +E+G      +L+W NPR L+   D+PT +Q   RYN +HVA   NQ  I + +LD L    F   +YP   +     R+  ++D+YLN P+    +TPLH A KFGN + + +L          RNK    PEE +C+RS + S A    +I++     F V                    LLR  ++      +SF V  A W             G+  D L  VRA+ GP+   KA      W     + A  + +IR++D E+G E  GR LA E   PW E W FL  +VDL   +GL++LE++L+K++ +
Sbjct:  144 DPSMFYAVCPVYEETLNKNEKVHIYADKKEALQVVKMLKGSRFKAFVSREDAERFARGICDYCPSPSKSSVILSPVKLSPALVRDGINSSEMENINKERANN-FKSPRTQDLTAKLRKAVEKGDQTTFSDLIWTNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQAGICQLLLDTLENPEFMRLMYPDDDDLMLHKRIRYIVDLYLNTPDKMVFDTPLHFACKFGNADVVSVLCSHPDILKNPRNKYEQTPEEAVCERSKNKS-AELKNKIKEYLKGHFYV-------------------PLLRAEDN------SSFPVIGAPWSPEQPDLIQTRFSGSPKDPLLAVRAFAGPMSPSKAEDFRRVWKTPPREKAEFYHKIRKTDPERGAERVGRVLAHELDVPWVEYWDFLGCFVDLSSQEGLRKLEEYLSKRETS 553          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Xenopus
Match: golga2 (golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130])

HSP 1 Score: 171.4 bits (433), Expect = 7.906e-44
Identity = 127/437 (29.06%), Postives = 201/437 (46.00%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSE----------------------KALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEV--ASWHDAS--------HGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            +P  +YAV    ++      K  +  D  EA   +K  +GSRF +F    +A++F+                        ALV D  ++++ +  ++++ ++ F +    DL   L+  +E+G      +L+W NPR L+   D+PT +Q   RYN +HVA   NQ  I + +LD L    F   +YP   +     R+  ++D+YLN P+    +TPLH A KFGN + + +L          RNK    PEE +C+RS + S A    +I++     F V                    LLR  ++      +SF V  A W             G+  D L  VRA+ GP+   KA      W     + A  + +IR++D E+G E  GR LA E   PW E W FL  +VDL   +GL++LE++L+K++ +
Sbjct:  230 DPSMFYAVCPVYEETLNKNEKVHIYADKKEALQVVKMLKGSRFKAFVSREDAERFARGICDYCPSPSKSSVILSPVKLSPALVRDGINSSEMENINKERANN-FKSPRTQDLTAKLRKAVEKGDQTTFSDLIWTNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQAGICQLLLDTLENPEFMRLMYPDDDDLMLHKRIRYIVDLYLNTPDKMVFDTPLHFACKFGNADVVSVLCSHPDILKNPRNKYEQTPEEAVCERSKNKS-AELKNKIKEYLKGHFYV-------------------PLLRAEDN------SSFPVIGAPWSPEQPDLIQTRFSGSPKDPLLAVRAFAGPMSPSKAEDFRRVWKTPPREKAEFYHKIRKTDPERGAERVGRVLAHELDVPWVEYWDFLGCFVDLSSQEGLRKLEEYLSKRETS 639          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Xenopus
Match: golga2 (golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130])

HSP 1 Score: 170.629 bits (431), Expect = 8.612e-44
Identity = 127/432 (29.40%), Postives = 193/432 (44.68%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP-----------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEV--ASWHDAS--------HGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            +P  +YAV    ++      K  +  D  EA   +K  +GSRF +F    +A++F+ + + D   S +K           P                 F +    DL   L+  +E+G      +L+W NPR L+   D+PT +Q   RYN +HVA   NQ  I + +LD L    F   +YP   +     R+  ++D+YLN P+    +TPLH A KFGN + + +L          RNK    PEE +C+RS + S A    +I++     F V                    LLR  ++      +SF V  A W             G+  D L  VRA+ GP+   KA      W     + A  + +IR++D E+G E  GR LA E   PW E W FL  +VDL   +GL++LE++L+K++ +
Sbjct:  133 DPSMFYAVCPVYEETLNKNEKVHIYADKKEALQVVKMLKGSRFKAFVSREDAERFA-RGICDYCPSPSKSSVILSPVKLSPKIGNLGMENINKERANNFKSPRTQDLTAKLRKAVEKGDQTTFSDLIWTNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQAGICQLLLDTLENPEFMRLMYPDDDDLMLHKRIRYIVDLYLNTPDKMVFDTPLHFACKFGNADVVSVLCSHPDILKNPRNKYEQTPEEAVCERSKNKS-AELKNKIKEYLKGHFYV-------------------PLLRAEDN------SSFPVIGAPWSPEQPDLIQTRFSGSPKDPLLAVRAFAGPMSPSKAEDFRRVWKTPPREKAEFYHKIRKTDPERGAERVGRVLAHELDVPWVEYWDFLGCFVDLSSQEGLRKLEEYLSKRETS 537          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Mouse
Match: Ankle2 (ankyrin repeat and LEM domain containing 2 [Source:MGI Symbol;Acc:MGI:1261856])

HSP 1 Score: 189.119 bits (479), Expect = 5.725e-50
Identity = 136/433 (31.41%), Postives = 203/433 (46.88%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP--------------------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASH--GAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            EP+ YY V    + G     +  V  D  EA    K  +GSRF +F    +A+KF+ + + D L S  K         + P                          + N    DL   L+  +E G      +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  + +  L+ L    F   +YP    +  + R+  V+D+YLN P+    +TPLH A KFGNV+ + +L    L     +NK G  PEE+IC+RS + S A + E IR+     + V                 LLR    +  IG  + +S + A   + +H   +  D +  +RA++GPL   KA      W     + A  F  IR+SD E+G+E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +++L+
Sbjct:  202 EPLVYYGVCPVYEDGPVRHERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFA-RGICDYLPSPNKTTPLLSPVKAVPLGGSDGLKDGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKVGFDTPLHFACKFGNVDVVNVLSSHPLIVKNRKNKYGKTPEEVICERSQNKSPALK-ERIREYLMGHYYV----------------PLLRAEDTSPVIGELW-SSDQKAEASNTAHCRSSPRDPVMTLRAFVGPLSPSKAEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQKELS 615          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Mouse
Match: Ankle2 (ankyrin repeat and LEM domain containing 2 [Source:MGI Symbol;Acc:MGI:1261856])

HSP 1 Score: 188.734 bits (478), Expect = 8.029e-50
Identity = 136/434 (31.34%), Postives = 203/434 (46.77%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP---------------------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASH--GAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            EP+ YY V    + G     +  V  D  EA    K  +GSRF +F    +A+KF+ + + D L S  K         + P                           + N    DL   L+  +E G      +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  + +  L+ L    F   +YP    +  + R+  V+D+YLN P+    +TPLH A KFGNV+ + +L    L     +NK G  PEE+IC+RS + S A + E IR+     + V                 LLR    +  IG  + +S + A   + +H   +  D +  +RA++GPL   KA      W     + A  F  IR+SD E+G+E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +++L+
Sbjct:  202 EPLVYYGVCPVYEDGPVRHERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFA-RGICDYLPSPNKTTPLLSPVKAVPLGGSDGLKADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKVGFDTPLHFACKFGNVDVVNVLSSHPLIVKNRKNKYGKTPEEVICERSQNKSPALK-ERIREYLMGHYYV----------------PLLRAEDTSPVIGELW-SSDQKAEASNTAHCRSSPRDPVMTLRAFVGPLSPSKAEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQKELS 616          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Mouse
Match: Ankle2 (ankyrin repeat and LEM domain containing 2 [Source:MGI Symbol;Acc:MGI:1261856])

HSP 1 Score: 187.963 bits (476), Expect = 1.065e-49
Identity = 136/434 (31.34%), Postives = 203/434 (46.77%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP---------------------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASH--GAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            EP+ YY V    + G     +  V  D  EA    K  +GSRF +F    +A+KF+ + + D L S  K         + P                           + N    DL   L+  +E G      +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  + +  L+ L    F   +YP    +  + R+  V+D+YLN P+    +TPLH A KFGNV+ + +L    L     +NK G  PEE+IC+RS + S A + E IR+     + V                 LLR    +  IG  + +S + A   + +H   +  D +  +RA++GPL   KA      W     + A  F  IR+SD E+G+E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +++L+
Sbjct:  202 EPLVYYGVCPVYEDGPVRHERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFA-RGICDYLPSPNKTTPLLSPVKAVPLGGSDGLKADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKVGFDTPLHFACKFGNVDVVNVLSSHPLIVKNRKNKYGKTPEEVICERSQNKSPALK-ERIREYLMGHYYV----------------PLLRAEDTSPVIGELW-SSDQKAEASNTAHCRSSPRDPVMTLRAFVGPLSPSKAEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQKELS 616          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q7TP65|ANKL2_RAT (Ankyrin repeat and LEM domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Ankle2 PE=2 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 3.535e-50
Identity = 138/433 (31.87%), Postives = 203/433 (46.88%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP---------------------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIG--YRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL 1308
            EP+ YY V    + G     +  V  D  EA   +K  +GSRF +F    +A+KF+ + + D L S +K  +      + P                           + N    DL   L+  +ERG      +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  + +  L+ L    F   +YP    +  + R+  ++D+YLN P+    +TPLH A KFGNV+ + +L    L     RNK G  PE++IC+RS + S   R E IR+     + V                 LLR    +  IG  +  D   E AS  D    +  D +  +RA++GPL   KA      W     + A  F  IR+SD E+G+E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +++L
Sbjct:  203 EPLLYYGVCPVYEDGLVRHERIHVYEDKKEALQAVKLIKGSRFKAFPTREDAEKFA-RGICDYLPSPSKNMSLLSPVKAMPLCSNDGPKADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVERGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASVCQLTLETLENPEFMRLMYPDDNMDMLQKRILYIVDLYLNTPDKVGFDTPLHFACKFGNVDVVNVLSSHPLIVKNPRNKYGKTPEDVICERSKNKSVELR-ERIREYLMGHYYV----------------PLLRAEDTSPVIGELWSSDQKAE-ASSADHCRSSPRDPVMTLRAFVGPLSPSKAEDFRKLWKTPPRKKAGLFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQKEL 616          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q6P1H6|ANKL2_MOUSE (Ankyrin repeat and LEM domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ankle2 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 5.616e-49
Identity = 136/434 (31.34%), Postives = 203/434 (46.77%), Query Frame = 1
Query:  115 EPVKYYAVACQKDKG-----KGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDP---------------------------FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASH--GAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            EP+ YY V    + G     +  V  D  EA    K  +GSRF +F    +A+KF+ + + D L S  K         + P                           + N    DL   L+  +E G      +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  + +  L+ L    F   +YP    +  + R+  V+D+YLN P+    +TPLH A KFGNV+ + +L    L     +NK G  PEE+IC+RS + S A + E IR+     + V                 LLR    +  IG  + +S + A   + +H   +  D +  +RA++GPL   KA      W     + A  F  IR+SD E+G+E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +++L+
Sbjct:  202 EPLVYYGVCPVYEDGPVRHERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFA-RGICDYLPSPNKTTPLLSPVKAVPLGGSDGLKADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKVGFDTPLHFACKFGNVDVVNVLSSHPLIVKNRKNKYGKTPEEVICERSQNKSPALK-ERIREYLMGHYYV----------------PLLRAEDTSPVIGELW-SSDQKAEASNTAHCRSSPRDPVMTLRAFVGPLSPSKAEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQKELS 616          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q86XL3|ANKL2_HUMAN (Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4)

HSP 1 Score: 180.644 bits (457), Expect = 2.608e-46
Identity = 108/325 (33.23%), Postives = 162/325 (49.85%), Query Frame = 1
Query:  343 FPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND-IGYRFDNSFEVASWHDASHGAAI-DRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL 1308
            + N    DL   L+  +E+G  +   +L+W+NPR L+   D+PT +Q   RYN +HVA   NQ  I +  LD L    F   +YP   E   + R+  V+D+YLN P+    +TPLH A KFGN + + +L    L     RNK    PE++IC+RS + S   + E IR+     + V                 LLR    ++  IG  +       + H + +G +  D +  +RA+ GPL   KA      W     + A     +++SD E+G E  GR LA E G PW E W+FL  +VDL   +GLQ+LE++L +Q++
Sbjct:  301 YKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPEDVICERSKNKSVELK-ERIREYLKGHYYV----------------PLLRAEETSSPVIGELWSPDQTAEASHVSRYGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWKTPPREKAGFLHHVKKSDPERGFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLTQQEI 608          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|H2KZB2|ANKL2_CAEEL (Ankyrin repeat and LEM domain-containing protein 2 homolog OS=Caenorhabditis elegans OX=6239 GN=lem-4 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.132e-35
Identity = 115/377 (30.50%), Postives = 177/377 (46.95%), Query Frame = 1
Query:  220 SRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILV-TESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGV-VRAYIGP-LEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAY--VDLGCDDGLQQLEDHLAKQQLTGCQGNDVS 1335
            +RF  F  P EA  F   A  D   +       +  + + PF   ++  +N  K  +E+G +E    LV +NPR LV T  D  + +   FRYNALH+A  + Q +I+  +L+ +  I F I +Y T  ++    ++N +LD YLN P+ GN +TPLH ASKFG +  +R+L     TD TL NKSG        + + D +      E + +      + ++G                 L RN   G        V+    A++  +     V V A  GP   + +AR  +  W     Q A K  E++R+D +KG E  GR LA +  A WRE W FL +   +DLG + GL  LE  L +++    + +++S
Sbjct:   73 ARFKKFGTPREAMDF--LAYGDAPTTPKTVPPVAPTEPNSPFSGVNRIQMNEFKKYVEKGDMENFLRLVDSNPRFLVNTGGDVASIVMEGFRYNALHIAAKAGQTEIIAKILELIQNIDFLIRLYGTGADDVTLRKIN-ILDSYLNTPDKGNSDTPLHFASKFGKIGVVRVLTENSATDRTLLNKSG--------KSALDCAGERYTGEDKDMVQRDIHLAIEG-------------FYVFLHRNPTTG---STQLTVSQKPPATYSTSPTTATVTVSAQAGPFFTEREARDFAKSW-----QTAGK--ELKRTDFDKGWERVGRVLAEQSEAMWRETWHFLGSMELLDLGSEQGLGVLEAFLREKRRGNLRNSEIS 415          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Match: A0A4Z2DXA2 (Ankyrin repeat and LEM domain-containing protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000961 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.337e-72
Identity = 154/445 (34.61%), Postives = 236/445 (53.03%), Query Frame = 1
Query:   82 NSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQR------SPDLSNASRI-EEIRQVFSEKFVVLLDGDGGQ-------VLDPMT--HFQLLRLLRRNND--------------IGYRFDNSF---EVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVL---NAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQL 1308
            +SDDEF+DC+ E   +YA+A  + KG G V +D  +A   L+  +G+R   F + ++A KF+   + DD   +    +      S P+P ASQ  L   +S++  G ++ V+++V +NP +LVT SD+PT LQ RFRYNALHV  ++   +++ F+L+ L    FW  +YP A    + +R   VLD+YLN PE+GNLETPLH ASK+G++EC+ +L    LT +   N SG  P ++   R      +P     S I + I+Q+F E ++VL D +  +       +L P+    FQ++  L   N               + Y    SF    + + + ++      +L  +R + GP+    A Q   +W      NA D   F  +R  D+EKG E  GRYL+  FG  W E W+FL+ Y+DL  +DGL  LED+L+   L
Sbjct:    8 DSDDEFYDCQSEAC-FYAIASPRAKGHGEVFLDPKKAYLTLRGIKGARLKLFTNHVDANKFASTPVDDDKLDSPYPPSPKPDIESSPYPTASQQTLIRFRSSLNSGDVDTVRKMVGDNPMVLVTSSDTPTILQIRFRYNALHVIASNGNVKLLHFLLNCLDSDEFWERLYPNASREASYWRQQYVLDLYLNSPELGNLETPLHFASKYGHIECVSILARHHLTKLNPLNSSGQTPADLAASRLINQNKTPHTDCPSNIVDRIQQIFDESYIVLADVEISESNMMQTKILGPLNTREFQMMLGLYAPNSCKTFTNTTHVRLYPVQYNSQCSFFKSPLVNRNGSTLFEVNSQLHRIRGFSGPMPSDVAVQFRKKWLQFNMPNAVDYKSFSHLRLIDSEKGYERQGRYLSRVFGTNWYEYWEFLNDYIDLNSEDGLLVLEDYLSNCSL 451          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Match: Q5D8I2 (SJCHGC00539 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.516e-69
Identity = 146/427 (34.19%), Postives = 225/427 (52.69%), Query Frame = 1
Query:   82 NSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQR------SPDLSNASRI-EEIRQVFSEKFVVLLDGDGGQ-------VLDPMT--HFQLLRLLRRNND--------------IGYRFDNSF---EVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVL---NAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDL 1254
            +SDDEF+DC+ E   +YA+A  + KG G V +D  +A   L+  +G+R   F + ++A KF+   + DD   +    +      S P+P ASQ  L   +S++  G ++ V+++V +NP +LVT SD+PT LQ RFRYNALHV  ++   +++ F+L+ L    FW  +YP A    + +R   VLD+YLN PE+GNLETPLH ASK+G++EC+ +L    LT +   N SG  P ++   R      +P     S I + I+Q+F E ++VL D +  +       +L P+    FQ++  L   N               + Y    SF    + + + ++      +L  +R + GP+    A Q   +W      NA D   F  +R  D+EKG E  GRYL+  FG  W E W+FL+ Y+DL
Sbjct:    8 DSDDEFYDCQSEAC-FYAIASPRAKGHGEVFLDPKKAYLTLRGIKGARLKLFTNHVDANKFASTPVDDDKLDSPYPPSPKPDIESSPYPTASQQTLIRFRSSLNSGDVDTVRKMVGDNPMVLVTSSDTPTILQIRFRYNALHVIASNGNVELLHFLLNCLDSDEFWERLYPNASREASYWRQQYVLDLYLNSPELGNLETPLHFASKYGHIECVSILARHHLTKLNPLNSSGQTPADLAASRLINQNKTPHTDCPSNIVDRIQQIFDESYIVLADVEISESNMMQTKILGPLNTREFQMMLGLYAPNSCKTFTNTTHVRLYPVQYNSQCSFFKSPLVNRNGSTLFEVNSQLHRIRGFSGPMPSDVAVQFRKKWLQFNMPNAVDYKSFSHLRLIDSEKGYERQGRYLSRVFGTNWYEYWEFLNDYIDL 433          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Match: A0A5K4FE46 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.348e-68
Identity = 156/443 (35.21%), Postives = 229/443 (51.69%), Query Frame = 1
Query:   85 SDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQR--------SPDLSNASRI-EEIRQVFSEKFVVLLDGD-------GGQVLDPMT--HFQ-LLRLLRRN-----------------NDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDA---SKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLA 1296
            SDDEFFDC+ E   +YAVA    KG+G V +D   A  KL++  G+R   F + ++A +F+   + ++        +      S P+P+ASQ  L   +S ++ G ++ VK++V  NP ILVT SD+PT LQ RFRYNALHV  +     +++F+L+ +    FW  +YP   +  + +R   VLD+YLN PE+GN ETPLH ASK+G++EC+ +L    LT +  RN +G  P +I   R          DL+  + I   I Q+F E ++VL D +         ++L P+    FQ +L L  RN                 N+  Y   +S              + RL   R + GP+    A +   +W   NA +A     F  +R  D+EKG E  GRYL+  FG  W E W+FLD Y+DL  +DGL  LED+L+
Sbjct:    9 SDDEFFDCQSEAC-FYAVASPLSKGQGGVFLDPKRAYLKLRSITGARLKLFANHVDANEFANTPVDEENLCNPYPPSPKADVESSPYPSASQQTLVRFRSMLDSGNVDAVKKMVDENPMILVTTSDTPTILQIRFRYNALHVIASKGNVNLLQFLLNCIDSDKFWERLYPGVSKEASYWRQQYVLDLYLNSPELGNFETPLHFASKYGHIECVSMLARHPLTKLDPRNFAGHTPTDIAATRLISQEKIPRSDLNCPTNIVNRILQIFDESYIVLADVEISEPAIIQTKILAPLNTREFQTMLGLYARNSCKTFKNATHVKPFPIENNQYYYLKSSVGNGDCLKLKTNGHVHRL---RGFSGPMLSNIAVEFRSKWLQYNAPNAVDYKSFSHLRLIDSEKGYERQGRYLSRVFGTSWYEYWEFLDDYIDLSSEDGLLALEDYLS 447          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Match: A0A504YIS0 (Ankyrin repeat and LEM domain-containing protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_10871 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 8.993e-65
Identity = 149/453 (32.89%), Postives = 224/453 (49.45%), Query Frame = 1
Query:   76 ESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSN-------------ASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLR---LLRRNNDIGYRFDNSF----------------------EVASWHDASHGAAIDRLGV--------VRAYIGPLEDIKARQLSYRWAVLNAQ-DASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHL 1293
            +++SD+EF+DC  + VKY A+A  + KG G V +D+ +AR K K  +GSR   F D   A++F+   + + +E      +      S P+ + +Q  L   ++ IE+  ++ ++++V  NP  LVT SD+PT +Q R RYNALHVA A+     V F+L RL   + W  IYP   +     R   V D+YLN PE+GNLETPLH A KFG++ C+RLL+   LT +   N+SG     + C R P+ ++             A  ++ IR++F E FVVL D     + D  T   +LR   L R    + + +D  +                      + +  +D  H      LG+        +RA  GP++   A     +W   N+      F  IR +D EKG E  GRY +  FGA W E W FLD + +L    GL+ L+ +L
Sbjct:    4 KADSDEEFYDCLSD-VKYCAIASPQGKGCGEVFLDLKKAREKWKQLKGSRMKVFDDYACAQEFANTPVKNKIEQIIYPASPKADVESTPYSSVTQASLLKFRTLIEKCDIDGMRQMVDENPMTLVTSSDTPTLIQVRLRYNALHVASAAGIADAVDFLLSRLNSTALWKQIYPDTDDQTAIERQRHVTDLYLNSPELGNLETPLHFACKFGHLSCVRLLVSHPLTQLNALNRSGQNALALACSRMPNRAHTQSHDNSDPSSRTAIVVQSIRRLFDEYFVVLADVQSNALTD--TKITILRPCSLQRLQTLLTHLWDRPYPGLISSLPYLPAAFTFNRTAGLKRSPTNDQCHATEFSDLGLHGASSLSRIRAIAGPMQCNDAESFRSKWLKANSTVKHGAFASIRLTDPEKGYERQGRYFSKLFGAHWLEYWDFLDDFANLSSVQGLEMLDQYL 453          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Match: A0A1S8WRB3 (Ankyrin repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07129 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.299e-64
Identity = 167/535 (31.21%), Postives = 257/535 (48.04%), Query Frame = 1
Query:   76 ESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQR--------------SPDLSNASRI--EEIRQVFSEKFVVLLDGDGGQV--------LDPMT--HFQLLRLLRRNNDIGYRFD---------NSFEVASWHDASHGAAID----------RLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASK-FEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQ----QLTGCQGNDVSTSNSFINQSKSTNTV---NTSNQLSTSGVWTKLTYLFSKMSLQSRSEEDNERMCNGTNSLNRSSI 1521
            +S   +EFFDC  + VKY A+A  K +G G V +D ++AR+K K  +GSR   F +  EA+ F+   +       A   +      + PF + +Q  L   +S IERG L+ ++  + +NP  LVT SD+PT LQ R RYNALHVA A+     +K +L  L    FW  IYP       R R   V D+YLN PE+GNLETPLH ASKFG++ C+RLL    LT + + N++G  P ++   R              +P  S  S +    IR++ SE F++L+D    +V        L P++   FQ L  L  +                 +  + ++    +H   +D           L  +R + GP+   +A     RW   N+  + K F  +R +D EKG E  GR+L+   G  W E W  ++ Y+DL  + GL  LE+++ +     +L  CQ   V+ SN  +   KS   V   +  +  +T G   ++++  S M     S ED +++   T+++  S I
Sbjct:    6 DSEQQEEFFDCVTD-VKYCAIASPKGQGAGEVFVDFSKARAKWKQIKGSRMKIFDNYGEAQTFANTPIEQATHENAYPPSPKADVEATPFSSVTQGLLVKFRSFIERGDLDSIRTAIQDNPMCLVTASDTPTLLQIRLRYNALHVAAATGNADTIKLLLSYLNSPDFWRRIYPGTDGATARDRQRHVTDLYLNSPELGNLETPLHFASKFGHITCVRLLAVHPLTQINVLNRAGQTPSDLAASRMSEVSRSNGPVNVDTPGCSARSVLVSHPIRRLLSEHFILLVDVRNTRVPGEQKTTILPPISSHQFQSLLALMPSAPTARLLSLFPFLPVERSHLQTSTNESNTHTVQLDLDLINLGLDVHLLALRGFAGPMTREEAEVFRSRWLKTNSSTSFKTFASVRLTDPEKGYERQGRHLSRISGVQWHEYWPLMNDYLDLASEQGLTILENYMKQCPSPFKLPSCQ--PVTLSNGTMLHKKSGAIVFRADGDDVEATDGRRWRISFESSSM-FCPYSSEDGQQVDRVTSTIQLSPI 536          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Cavefish
Match: ankle2 (ankyrin repeat and LEM domain containing 2 [Source:NCBI gene;Acc:111193770])

HSP 1 Score: 186.422 bits (472), Expect = 3.925e-49
Identity = 127/430 (29.53%), Postives = 205/430 (47.67%), Query Frame = 1
Query:  169 VTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVD-----------------DLXXXXXXXXXXXXXI----SDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEV---ASWHDAS--------HGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGC---QGNDVSTSNSF 1350
            V +D  EA   +K  +G+RF +F +  +A+KF+ K + D                  L  +  + +     I    ++ F +    DL   L+  +E+G      ELVW+NPR L+   D+PT +Q   RYN +HVA   NQ  + + +LD L    F   +YP  +E+    R+  + D+YLN P+  + ETPLH A KFG+   + +L      D   +NK   +P +++C+R   + + S++++++Q  +E             L+   +  LLR            DNS +    A W              + +D +  VRA+ GPL   KA +    W     + A  F  I +SD ++G E  GR LA E G PW E W FLD++VDL   +GL++LE++L+K++ + C   +  +  TSN F
Sbjct:  149 VYMDKKEALQAVKLMKGARFKAFSNREDAEKFA-KGICDYYPSPSKGAPCVSPVKAGLGFSKAEGSVETDGINREKANSFKSPRTQDLTAKLRRAVEKGDEVAFGELVWSNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQGGVAQLLLDTLENPEFMRLMYPDDLESMLTKRIQYITDLYLNTPDKASFETPLHFACKFGSAAVVNVLCSHPDIDKNCKNKYDQRPADVVCER---MKDKSKVQDVKQKINE------------YLEDRFYVPLLRAA----------DNSSQPVIGAPWSPEPLENRSPRLPRSPMDPVMAVRAFAGPLSPSKADEFRKVWKTPPRERAGHFHNILKSDPDRGAERVGRDLARELGHPWAEYWDFLDSFVDLASAEGLRRLEEYLSKKEFSVCGHKETGENETSNKF 552          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019799.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:3053440:3061473:1 gene:ENSAMXG00000019231.2 transcript:ENSAMXT00000019799.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 1.677e-46
Identity = 111/332 (33.43%), Postives = 161/332 (48.49%), Query Frame = 1
Query:  376 LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKST 1371
            L+ ++E+G  E  KELV +NPR L+   D+PT +Q   RYN LHVA   NQP +   +L+ L +  F   +YP   E+    R+  ++D+YLN P+    +TPLH A KFG  E + +L      D   RNK G KP  +IC+R     +    E+I++   ++F V L       L+P+          + +      D S       D  +      L  +RA+ GPL  +KA +L   W       A  F +I +SD ++G E  GR LA E G PW E W FL  + DL  D+GL  LE++     L  C      T NS+I+ +  T
Sbjct:  230 LRKSVEKGDEEAFKELVRSNPRYLIGSGDNPTIVQEGCRYNVLHVAAKENQPAMACLILETLEDPEFMRCMYPHDQEDMLLKRIEYIVDLYLNTPDKAVSDTPLHFACKFGCSEVVNVLCSHPSIDKNCRNKYGQKPSSVICERK--NKSKEIKEKIKEYLEDRFFVPLLRATDNTLNPVVGAPWAPGSSKCD------DPSLSPRLVEDPKNP-----LMTIRAFAGPLNQLKAEELHKLWRTPARHRAKYFHDILKSDPDRGAERVGRELAHEMGYPWAEYWDFLSCFTDLSSDNGLSLLEEY-----LKNCVQQKSRTENSWIHANSPT 543          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO43561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY12])

HSP 1 Score: 138.658 bits (348), Expect = 1.067e-36
Identity = 85/294 (28.91%), Postives = 137/294 (46.60%), Query Frame = 1
Query:  343 FPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVEN-----CNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGV------VRAYIGPLEDIKARQLSYRWAV--LNAQDASKFEEIRRSDAEKGMEMHGR 1185
            F + +   L L +  IE+G  ++  ELV+NNPR L++  D+P  LQ  FRYNA+HVA   N+P + + ++  L  I FW     T  ++      N  R   ++D+YLN P+ GNLETPLH A KFG+++ ++ L+   LT +T  N+ G  PEE+   ++        I +   + +  + V + G       P+                    + +            +   +GV      VRAY GP+   KA +    W     + +D  ++  IRR D+ +G+E  GR
Sbjct:   11 FKSPTPQQLVLFRKLIEQGKQQEFIELVYNNPRYLISSGDTPVILQEGFRYNAMHVASKENRPHMCELIIRTLESIHFWQVFLQTDNKDSLNSSVNNNRRQFLVDLYLNTPDKGNLETPLHFACKFGHLDVVKYLVSHPLTSITPHNRYGDTPEEVTITQTCSEYKRKAIIKNHYIVTYNYFVPVFGSQDNSTPPI------------------LGDPWSPTMAQGQRRPPSCSSVGVYSPRESVRAYAGPMSPSKASEFHRMWKTPPTSPEDRKQYTNIRRGDSSRGIERIGR 286          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Medaka
Match: ankle2 (ankyrin repeat and LEM domain containing 2 [Source:NCBI gene;Acc:101163336])

HSP 1 Score: 181.03 bits (458), Expect = 2.580e-47
Identity = 128/430 (29.77%), Postives = 205/430 (47.67%), Query Frame = 1
Query:  109 EYEPVKYYAVAC------QKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDD-------------------LXXXXXXXXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND--IGYRFD-NSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            E  P  YY V         ++ G G V +DM +    +K+ +G+RF +F +  +A+K++ K + D                    L     +  T  ++ ++ F +    DL   L+  +E+G  ++  ELVW+NPR L+   D+PT +Q   RYN +HVA   NQ +I + +LD L    F   +YP   E+  + R++ ++D+YLN P+    ETPLH A KFG  + + +L          +NK G KP ++IC R       ++ +E++Q   E             L+   +  LLR     +   IG  +   S E  + +     + +D L  V A+ GPL   KA      W     ++ ++F  I +SD ++G E  GR LA E G PW E W FLD +VDL   +GL  LE++L+K+  +
Sbjct:  143 EVSPNFYYGVCSPWEDVLARNDG-GRVYLDMKDVVQAVKSIKGARFKAFNNREDAEKYA-KGVCDYFPSPNKSTPCVSPIKSNLLLCKENMEVDTVNRERANSFKSPRSQDLTAKLRKAVEKGDEKEFSELVWSNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQAKIAQLLLDTLENPDFMRLMYPDDQEDMLQKRIHYIVDLYLNTPDKAGFETPLHFACKFGCPDVVNVLCSHPGIAKNCKNKDGLKPCDLICSRK------NKTQEVKQRIEE------------YLEDRCYVPLLRATDNTSQPIIGDPWSPESSEGLTQNQQHTRSPMDPLMTVTAFAGPLSPFKAADFRRSWKT-PPRERAEFYHILKSDLDRGAEKVGRDLAHEMGHPWAEYWGFLDCFVDLSSPEGLHMLEEYLSKKDFS 551          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Medaka
Match: ankle2 (ankyrin repeat and LEM domain containing 2 [Source:NCBI gene;Acc:101163336])

HSP 1 Score: 181.03 bits (458), Expect = 2.580e-47
Identity = 128/430 (29.77%), Postives = 205/430 (47.67%), Query Frame = 1
Query:  109 EYEPVKYYAVAC------QKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDD-------------------LXXXXXXXXXXXXXISDPFPNASQNDLNL-LKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNND--IGYRFD-NSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLT 1311
            E  P  YY V         ++ G G V +DM +    +K+ +G+RF +F +  +A+K++ K + D                    L     +  T  ++ ++ F +    DL   L+  +E+G  ++  ELVW+NPR L+   D+PT +Q   RYN +HVA   NQ +I + +LD L    F   +YP   E+  + R++ ++D+YLN P+    ETPLH A KFG  + + +L          +NK G KP ++IC R       ++ +E++Q   E             L+   +  LLR     +   IG  +   S E  + +     + +D L  V A+ GPL   KA      W     ++ ++F  I +SD ++G E  GR LA E G PW E W FLD +VDL   +GL  LE++L+K+  +
Sbjct:  143 EVSPNFYYGVCSPWEDVLARNDG-GRVYLDMKDVVQAVKSIKGARFKAFNNREDAEKYA-KGVCDYFPSPNKSTPCVSPIKSNLLLCKENMEVDTVNRERANSFKSPRSQDLTAKLRKAVEKGDEKEFSELVWSNPRYLIGSGDNPTVVQEGCRYNVMHVAAKENQAKIAQLLLDTLENPDFMRLMYPDDQEDMLQKRIHYIVDLYLNTPDKAGFETPLHFACKFGCPDVVNVLCSHPGIAKNCKNKDGLKPCDLICSRK------NKTQEVKQRIEE------------YLEDRCYVPLLRATDNTSQPIIGDPWSPESSEGLTQNQQHTRSPMDPLMTVTAFAGPLSPFKAADFRRSWKT-PPRERAEFYHILKSDLDRGAEKVGRDLAHEMGHPWAEYWGFLDCFVDLSSPEGLHMLEEYLSKKDFS 551          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000027557.1 (SMESG000027557.1)

HSP 1 Score: 1248.42 bits (3229), Expect = 0.000e+0
Identity = 621/651 (95.39%), Postives = 627/651 (96.31%), Query Frame = 1
Query:   73 MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTSGVWTKLTYLFSKMSLQSRSEEDNERMCNGTNSLNRSSIPANHLNDIIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRMTKTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD 2025
            MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLESAAKKKTTSEKKISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETP  L      +E  +         VTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHG AIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTS +WTKL YLFSKMSLQSRSEEDNER+CNGTNSLNRSSIP +HLN+IIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRM KTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD
Sbjct:    1 MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLESAAKKKTTSEKKISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPPPLG-----IEIRK--------HVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGVAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTSSMWTKLAYLFSKMSLQSRSEEDNERICNGTNSLNRSSIPTSHLNNIIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRMIKTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD 638          
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000027557.1 (SMESG000027557.1)

HSP 1 Score: 1220.68 bits (3157), Expect = 0.000e+0
Identity = 610/651 (93.70%), Postives = 617/651 (94.78%), Query Frame = 1
Query:   73 MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLXXXXXXXXXXXXXISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTSGVWTKLTYLFSKMSLQSRSEEDNERMCNGTNSLNRSSIPANHLNDIIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRMTKTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD 2025
            MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLESAAKKKTTSEKKISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETP  L              G E+           + +EIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHG AIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTS +WTKL YLFSKMSLQSRSEEDNER+CNGTNSLNRSSIP +HLN+IIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRM KTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD
Sbjct:    1 MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGSRFCSFYDPLEAKKFSEKALVDDLESAAKKKTTSEKKISDPFPNASQNDLNLLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVASNQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGNLETPPPL--------------GIEI-----------RKQEIICQRSPDLSNASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRFDNSFEVASWHDASHGVAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQDASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGLQQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTSSMWTKLAYLFSKMSLQSRSEEDNERICNGTNSLNRSSIPTSHLNNIIPDGCYQSPIINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRMIKTPFNSSLLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMCTPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELSD 626          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ANKLE25.431e-4733.23ankyrin repeat and LEM domain containing 2 [Source... [more]
ANKLE29.241e-1538.61ankyrin repeat and LEM domain containing 2 [Source... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lem-41.316e-3630.50Ankyrin repeat and LEM domain-containing protein 2... [more]
lem-41.676e-3630.50Ankyrin repeat and LEM domain-containing protein 2... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ankle22.716e-2229.77gene:FBgn0028343 transcript:FBtr0340625[more]
Ankle22.893e-2229.77gene:FBgn0028343 transcript:FBtr0301414[more]
Ankle22.893e-2229.77gene:FBgn0028343 transcript:FBtr0301413[more]
Ankle23.390e-2229.77gene:FBgn0028343 transcript:FBtr0301415[more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ankle24.136e-5031.15ankyrin repeat and LEM domain containing 2 [Source... [more]
ankle24.136e-5031.15ankyrin repeat and LEM domain containing 2 [Source... [more]
zdhhc8a1.131e-2732.00zinc finger DHHC-type containing 8a [Source:ZFIN;A... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
golga27.268e-4429.06golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130][more]
golga27.906e-4429.06golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130][more]
golga28.612e-4429.40golgin A2 [Source:Xenbase;Acc:XB-GENE-1003130][more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ankle25.725e-5031.41ankyrin repeat and LEM domain containing 2 [Source... [more]
Ankle28.029e-5031.34ankyrin repeat and LEM domain containing 2 [Source... [more]
Ankle21.065e-4931.34ankyrin repeat and LEM domain containing 2 [Source... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q7TP65|ANKL2_RAT3.535e-5031.87Ankyrin repeat and LEM domain-containing protein 2... [more]
sp|Q6P1H6|ANKL2_MOUSE5.616e-4931.34Ankyrin repeat and LEM domain-containing protein 2... [more]
sp|Q86XL3|ANKL2_HUMAN2.608e-4633.23Ankyrin repeat and LEM domain-containing protein 2... [more]
sp|H2KZB2|ANKL2_CAEEL2.132e-3530.50Ankyrin repeat and LEM domain-containing protein 2... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DXA22.337e-7234.61Ankyrin repeat and LEM domain-containing protein i... [more]
Q5D8I22.516e-6934.19SJCHGC00539 protein OS=Schistosoma japonicum OX=61... [more]
A0A5K4FE461.348e-6835.21Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A504YIS08.993e-6532.89Ankyrin repeat and LEM domain-containing protein 2... [more]
A0A1S8WRB35.299e-6431.21Ankyrin repeat protein (Fragment) OS=Opisthorchis ... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ankle23.925e-4929.53ankyrin repeat and LEM domain containing 2 [Source... [more]
ENSAMXT00000019799.21.677e-4633.43pep primary_assembly:Astyanax_mexicanus-2.0:20:305... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435611.067e-3628.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ankle22.580e-4729.77ankyrin repeat and LEM domain containing 2 [Source... [more]
ankle22.580e-4729.77ankyrin repeat and LEM domain containing 2 [Source... [more]
back to top
BLAST of Ankyrin repeat and LEM domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000027557.10.000e+095.39SMESG000027557.1[more]
SMESG000027557.10.000e+093.70SMESG000027557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032804 ID=SMED30032804|Name=Ankyrin repeat and LEM domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2063bp
GAAATTTTAAAAATAAATCAGAAATTTAAATAATAATATCAAATTTTTAT
AATAATTTTTATTCATTTAATCATGGAATCTAATTCTGATGATGAATTTT
TTGATTGTGAATATGAACCAGTCAAATATTACGCCGTTGCTTGCCAAAAA
GATAAAGGCAAGGGATTAGTGACTATTGACATGAACGAAGCTAGATCTAA
ATTGAAAAATTGTCGTGGTAGTCGATTTTGTAGTTTTTATGACCCTCTAG
AAGCAAAAAAATTTTCAGAAAAAGCTTTAGTAGATGATTTAGAATCAGCA
GCTAAAAAAAAAACAACATCAGAAAAGAAAATATCCGATCCATTTCCAAA
CGCATCTCAAAATGATTTGAATCTCCTAAAATCAACAATTGAGCGAGGTG
CGCTTGAAAAAGTTAAGGAATTAGTCTGGAATAATCCTAGAATCCTCGTG
ACAGAGAGCGATTCTCCTACACGTTTACAATCCAGGTTCCGCTACAACGC
TCTCCACGTTGCCGTCGCCTCTAATCAGCCGCAAATCGTAAAGTTCGTTT
TGGATAGATTGACAGAAATTTCCTTCTGGATATCTATCTATCCTACGGCG
GTGGAGAACTGCAATCGATACCGAATGAACCGAGTGCTGGACATGTATTT
GAACGGGCCGGAAGTCGGAAATCTCGAGACCCCCCTCCACTTGGCATCGA
AATTCGGAAACGTGGAGTGCCTGCGGCTGCTGCTCGGACAGGAACTGACA
GATGTCACCCTGAGGAACAAATCCGGATGGAAACCTGAGGAAATAATTTG
CCAGCGCTCGCCAGATCTCAGCAATGCAAGCAGGATAGAAGAGATTCGGC
AGGTCTTCTCTGAGAAGTTCGTGGTGCTCCTGGATGGGGACGGAGGCCAA
GTGCTAGATCCAATGACGCACTTCCAACTGTTGCGGCTGCTGCGCAGGAA
CAATGACATCGGATATCGATTCGATAACTCATTCGAGGTGGCCAGTTGGC
ACGATGCCAGTCACGGTGCTGCTATCGACCGTCTGGGGGTCGTCCGGGCC
TATATTGGGCCGTTGGAGGACATCAAGGCACGCCAGCTCTCCTATCGATG
GGCGGTTCTCAATGCGCAGGACGCCAGCAAGTTCGAGGAGATCCGCCGGT
CTGATGCCGAGAAGGGAATGGAAATGCACGGCAGATATCTGGCAGGCGAG
TTTGGGGCTCCTTGGCGGGAATTGTGGCAATTCCTCGATGCCTATGTTGA
CCTTGGCTGCGATGATGGCCTCCAGCAGCTGGAGGATCACCTGGCTAAGC
AGCAACTCACCGGCTGTCAAGGCAACGATGTGTCAACATCAAATTCGTTC
ATCAACCAATCAAAATCCACAAACACCGTCAACACATCCAATCAACTATC
GACAAGCGGCGTGTGGACCAAGTTGACCTATTTATTCTCAAAGATGAGCC
TGCAGTCTCGCAGCGAGGAAGATAACGAGCGGATGTGCAACGGCACTAAC
AGTCTCAACCGATCATCGATACCAGCGAATCACCTCAACGACATAATACC
GGACGGTTGTTATCAATCGCCAATAATCAATCGGTCCCAGCTGTTGCCTC
CCTCGGGCTTCCAGACCCCAATCAGCGCTAAGCAGTTCGATTCCATGTCC
AGCATCATCGCTAGCACTCCTATTCACAAGGTGAAAAGTTTGCGCATGAC
AAAGACTCCATTCAATTCCAGTTTGCTTGGTGAGGGCTTCCTGACCCCAA
CAGACCGGCACGTCCGCCGTGCAGTTCTTTTAGGTAGCGGTAAACCGACA
CGGTTTCCCCTAGTGTCAACATGGCTGAGTAATTTGTCTGAGCTGGACCC
TGATCTCTCTTTGTCCATGTGTACGCCCAGCTCGGCGCTGCCTTTCAAGG
GGCAGGATTTCCTAATGTCAACCCCAATCAGATCCAATAATCGCCCAAAT
AGTCAGTTCAGGAAACCTTTTCATGCTGATTCATTTAAATGTCTTTCGCC
TCTGTCGAGAATAGAACTCTCAGATTAATTGAGTTTTTAATTGTATCATC
AATCTTGATTTAC
back to top

protein sequence of SMED30032804-orf-1

>SMED30032804-orf-1 ID=SMED30032804-orf-1|Name=SMED30032804-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=652bp
MESNSDDEFFDCEYEPVKYYAVACQKDKGKGLVTIDMNEARSKLKNCRGS
RFCSFYDPLEAKKFSEKALVDDLESAAKKKTTSEKKISDPFPNASQNDLN
LLKSTIERGALEKVKELVWNNPRILVTESDSPTRLQSRFRYNALHVAVAS
NQPQIVKFVLDRLTEISFWISIYPTAVENCNRYRMNRVLDMYLNGPEVGN
LETPLHLASKFGNVECLRLLLGQELTDVTLRNKSGWKPEEIICQRSPDLS
NASRIEEIRQVFSEKFVVLLDGDGGQVLDPMTHFQLLRLLRRNNDIGYRF
DNSFEVASWHDASHGAAIDRLGVVRAYIGPLEDIKARQLSYRWAVLNAQD
ASKFEEIRRSDAEKGMEMHGRYLAGEFGAPWRELWQFLDAYVDLGCDDGL
QQLEDHLAKQQLTGCQGNDVSTSNSFINQSKSTNTVNTSNQLSTSGVWTK
LTYLFSKMSLQSRSEEDNERMCNGTNSLNRSSIPANHLNDIIPDGCYQSP
IINRSQLLPPSGFQTPISAKQFDSMSSIIASTPIHKVKSLRMTKTPFNSS
LLGEGFLTPTDRHVRRAVLLGSGKPTRFPLVSTWLSNLSELDPDLSLSMC
TPSSALPFKGQDFLMSTPIRSNNRPNSQFRKPFHADSFKCLSPLSRIELS
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035007ANKLE2
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0051721protein phosphatase 2A binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030176integral component of endoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007084mitotic nuclear envelope reassembly
GO:0007417central nervous system development
GO:0035307positive regulation of protein dephosphorylation
GO:0042326negative regulation of phosphorylation
GO:0043066negative regulation of apoptotic process
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12349FAMILY NOT NAMEDcoord: 34..165
IPR035007Ankyrin repeat and LEM domain-containing protein 2PANTHERPTHR12349:SF4ANKYRIN REPEAT AND LEM DOMAIN-CONTAINING PROTEIN 2coord: 34..165