Ras guanine nucleotide exchange factor domain-containing protein

Overview
NameRas guanine nucleotide exchange factor domain-containing protein
Smed IDSMED30032801
Length (bp)3762
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras guanine nucleotide exchange factor domain-containing protein (SMED30032801) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras guanine nucleotide exchange factor domain-containing protein (SMED30032801) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras guanine nucleotide exchange factor domain-containing protein (SMED30032801) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras guanine nucleotide exchange factor domain-containing protein (SMED30032801) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032801

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032801h1SMcG0002812 dd_Smed_v4_8782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032801h1SMcG0002812 dd_Smed_v4_8782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032801h1SMcG0002812 dd_Smed_v4_8782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032801h1SMcG0002812 dd_Smed_v4_8782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 78.1814 bits (191), Expect = 1.081e-15
Identity = 48/166 (28.92%), Postives = 93/166 (56.02%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKM 2890
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KM
Sbjct:   31 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKM 182          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 83.1889 bits (204), Expect = 1.897e-15
Identity = 51/175 (29.14%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R 
Sbjct:  580 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTART 740          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 83.1889 bits (204), Expect = 2.003e-15
Identity = 51/174 (29.31%), Postives = 98/174 (56.32%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R
Sbjct:  629 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTAR 788          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 83.1889 bits (204), Expect = 2.122e-15
Identity = 51/175 (29.14%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R 
Sbjct:  647 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTART 807          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:HGNC Symbol;Acc:HGNC:16626])

HSP 1 Score: 83.1889 bits (204), Expect = 2.156e-15
Identity = 51/175 (29.14%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R 
Sbjct:  656 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTART 816          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 83.1889 bits (204), Expect = 9.212e-16
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  839 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 1085          

HSP 2 Score: 70.0922 bits (170), Expect = 1.101e-11
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  319 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 598          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 83.1889 bits (204), Expect = 9.212e-16
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  839 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 1085          

HSP 2 Score: 70.0922 bits (170), Expect = 1.101e-11
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  319 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 598          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 83.1889 bits (204), Expect = 1.124e-15
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  716 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 962          

HSP 2 Score: 69.707 bits (169), Expect = 1.500e-11
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  196 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 475          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 82.8037 bits (203), Expect = 1.321e-15
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  839 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 1085          

HSP 2 Score: 70.0922 bits (170), Expect = 1.043e-11
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  319 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 598          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Match: pxf-1 (Rap guanine nucleotide exchange factor [Source:UniProtKB/Swiss-Prot;Acc:G5EDB9])

HSP 1 Score: 82.8037 bits (203), Expect = 1.321e-15
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  839 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 1085          

HSP 2 Score: 70.0922 bits (170), Expect = 1.043e-11
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  319 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 598          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Match: Epac (gene:FBgn0085421 transcript:FBtr0112636)

HSP 1 Score: 81.6481 bits (200), Expect = 3.220e-15
Identity = 51/173 (29.48%), Postives = 94/173 (54.34%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + W+++E+ S      KR  L+  FI+LA+  +   +++ FF+++ GL +M +SRL QTW+++ +  +K+F+  + +++ + N R  R+   K+  P IP   L++KD+T   E N T ++G          L+NF+KM  MA+  R 
Sbjct:  650 TFGRHHFGKITAN-LDVFLRRFNEVQYWIVTELVSTPSL-SKRVGLVRKFIKLAAYCKEYQNLNAFFAVVMGLSNMAVSRLQQTWEKIPSKFRKIFQEFEALIDPSRNHRAYRVFVGKLQPPLIPFMPLLLKDMTFAHEGNKTSLDG----------LVNFEKMHMMAQTMRT 810          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Match: Epac (gene:FBgn0085421 transcript:FBtr0329851)

HSP 1 Score: 81.6481 bits (200), Expect = 3.220e-15
Identity = 51/173 (29.48%), Postives = 94/173 (54.34%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + W+++E+ S      KR  L+  FI+LA+  +   +++ FF+++ GL +M +SRL QTW+++ +  +K+F+  + +++ + N R  R+   K+  P IP   L++KD+T   E N T ++G          L+NF+KM  MA+  R 
Sbjct:  650 TFGRHHFGKITAN-LDVFLRRFNEVQYWIVTELVSTPSL-SKRVGLVRKFIKLAAYCKEYQNLNAFFAVVMGLSNMAVSRLQQTWEKIPSKFRKIFQEFEALIDPSRNHRAYRVFVGKLQPPLIPFMPLLLKDMTFAHEGNKTSLDG----------LVNFEKMHMMAQTMRT 810          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Match: PDZ-GEF (gene:FBgn0265778 transcript:FBtr0300039)

HSP 1 Score: 81.6481 bits (200), Expect = 3.676e-15
Identity = 84/407 (20.64%), Postives = 169/407 (41.52%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTI--LIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLI----PSQELVTKTNDEDRTIIAVYE-----------------PCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSI---------MESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNI-------------VSVPRDSDQFVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE 1390
             ++ CL+ D  +RS+ +V  L +  + +K F     +    +C       +D+    ++      D W  ++NG++ +E    +   L  GD +G IL T D L     + +  D C  + I++ D        +E   +  DE+  ++ V E                     ++ L+    +V+ +GT + L+++L  + ++    +VEDF +T++IF  +P  +         +E + ++ T +L +   +  ++L W++ ++ +FE +   M FL     +L  +K    L  L+  C   A  RS     S +D               V++   +     YI +++   K     L  GD I  +   S   +T     ++      LS+ V+++ LG+ E
Sbjct:   99 AVRDCLEKDPAERSEEDVEVLLEFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHANGSREELQMGDSFG-ILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHEDENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENSMTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTR--VVLLWVNNHFTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFRIVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRALEILTGTTHLSISVKSNLLGFKE 502          

HSP 2 Score: 73.559 bits (179), Expect = 1.168e-12
Identity = 53/173 (30.64%), Postives = 94/173 (54.34%), Query Frame = 2
Query: 2441 FDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQK---ITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKD 2950
              K+ +L +    WV+SEIC+E    ++R K++  FI++A   +   + +  F+++SGL    +SRL QTW+++ +  ++LF +L+++++ + N+   R L         P IP   +V KDLT I   N T V+G          LINF+K+R +A+  R  +  +C+   D
Sbjct:  908 LSKFAELVNREMFWVVSEICAEHNI-VRRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPIVKKDLTFIHLGNDTRVDG----------LINFEKLRMLAKEVR-LLTHMCSSPYD 1068          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Match: PDZ-GEF (gene:FBgn0265778 transcript:FBtr0333242)

HSP 1 Score: 81.6481 bits (200), Expect = 3.818e-15
Identity = 84/407 (20.64%), Postives = 169/407 (41.52%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTI--LIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLI----PSQELVTKTNDEDRTIIAVYE-----------------PCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSI---------MESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNI-------------VSVPRDSDQFVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE 1390
             ++ CL+ D  +RS+ +V  L +  + +K F     +    +C       +D+    ++      D W  ++NG++ +E    +   L  GD +G IL T D L     + +  D C  + I++ D        +E   +  DE+  ++ V E                     ++ L+    +V+ +GT + L+++L  + ++    +VEDF +T++IF  +P  +         +E + ++ T +L +   +  ++L W++ ++ +FE +   M FL     +L  +K    L  L+  C   A  RS     S +D               V++   +     YI +++   K     L  GD I  +   S   +T     ++      LS+ V+++ LG+ E
Sbjct:   99 AVRDCLEKDPAERSEEDVEVLLEFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHANGSREELQMGDSFG-ILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHEDENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENSMTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTR--VVLLWVNNHFTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFRIVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRALEILTGTTHLSISVKSNLLGFKE 502          

HSP 2 Score: 73.559 bits (179), Expect = 1.282e-12
Identity = 53/173 (30.64%), Postives = 94/173 (54.34%), Query Frame = 2
Query: 2441 FDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQK---ITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKD 2950
              K+ +L +    WV+SEIC+E    ++R K++  FI++A   +   + +  F+++SGL    +SRL QTW+++ +  ++LF +L+++++ + N+   R L         P IP   +V KDLT I   N T V+G          LINF+K+R +A+  R  +  +C+   D
Sbjct:  908 LSKFAELVNREMFWVVSEICAEHNI-VRRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPIVKKDLTFIHLGNDTRVDG----------LINFEKLRMLAKEVR-LLTHMCSSPYD 1068          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Match: PDZ-GEF (gene:FBgn0265778 transcript:FBtr0300038)

HSP 1 Score: 81.6481 bits (200), Expect = 3.818e-15
Identity = 84/407 (20.64%), Postives = 169/407 (41.52%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTI--LIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLI----PSQELVTKTNDEDRTIIAVYE-----------------PCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSI---------MESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNI-------------VSVPRDSDQFVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE 1390
             ++ CL+ D  +RS+ +V  L +  + +K F     +    +C       +D+    ++      D W  ++NG++ +E    +   L  GD +G IL T D L     + +  D C  + I++ D        +E   +  DE+  ++ V E                     ++ L+    +V+ +GT + L+++L  + ++    +VEDF +T++IF  +P  +         +E + ++ T +L +   +  ++L W++ ++ +FE +   M FL     +L  +K    L  L+  C   A  RS     S +D               V++   +     YI +++   K     L  GD I  +   S   +T     ++      LS+ V+++ LG+ E
Sbjct:   99 AVRDCLEKDPAERSEEDVEVLLEFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHANGSREELQMGDSFG-ILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHEDENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENSMTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTR--VVLLWVNNHFTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFRIVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRALEILTGTTHLSISVKSNLLGFKE 502          

HSP 2 Score: 73.559 bits (179), Expect = 1.282e-12
Identity = 53/173 (30.64%), Postives = 94/173 (54.34%), Query Frame = 2
Query: 2441 FDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQK---ITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKD 2950
              K+ +L +    WV+SEIC+E    ++R K++  FI++A   +   + +  F+++SGL    +SRL QTW+++ +  ++LF +L+++++ + N+   R L         P IP   +V KDLT I   N T V+G          LINF+K+R +A+  R  +  +C+   D
Sbjct:  908 LSKFAELVNREMFWVVSEICAEHNI-VRRMKIVKQFIKIARHCKECRNFNSMFAIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPIVKKDLTFIHLGNDTRVDG----------LINFEKLRMLAKEVR-LLTHMCSSPYD 1068          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 84.3445 bits (207), Expect = 7.211e-16
Identity = 53/174 (30.46%), Postives = 95/174 (54.60%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            T   H     T N  D +++  +  + WV++E+C   +CP   KR +L+  FI++A+  +   +++ FF++I GL +  + RLSQTW+++ +  KK +   +N+++ + N R  R+   K+  P IP   L++KD+T   E N T+ +           L+NF+KMR +A   R
Sbjct:  760 TFGRHHFKKTTAN-LDLFLRRFNEVQLWVVTEVC---LCPALSKRVQLLKKFIKIAAHCKEFKNLNSFFAIIMGLGNPAVCRLSQTWEKLPSKFKKFYGEFENLMDPSRNHRAYRLTMAKLEPPIIPFMPLLIKDMTFTHEGNKTFTD----------RLVNFEKMRMIANTVR 919          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 83.9593 bits (206), Expect = 9.088e-16
Identity = 53/174 (30.46%), Postives = 95/174 (54.60%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            T   H     T N  D +++  +  + WV++E+C   +CP   KR +L+  FI++A+  +   +++ FF++I GL +  + RLSQTW+++ +  KK +   +N+++ + N R  R+   K+  P IP   L++KD+T   E N T+ +           L+NF+KMR +A   R
Sbjct:  793 TFGRHHFKKTTAN-LDLFLRRFNEVQLWVVTEVC---LCPALSKRVQLLKKFIKIAAHCKEFKNLNSFFAIIMGLGNPAVCRLSQTWEKLPSKFKKFYGEFENLMDPSRNHRAYRLTMAKLEPPIIPFMPLLIKDMTFTHEGNKTFTD----------RLVNFEKMRMIANTVR 952          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 83.1889 bits (204), Expect = 1.791e-15
Identity = 82/316 (25.95%), Postives = 159/316 (50.32%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV+  A+ +  L + + +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A++++ E    ++L+L  VE A +L +R+ +  C    T+ I  +      LKT      +   F++ I    F   WV +E+  E    +KR K++  FI++A   +   + +  F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R L   Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  797 KADQQSRYIMIGKDTTAKEVVAQAIREFALTAAAEAYSLCEVSVTPEG--VIKQRRLPEQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQELLRESH-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLF----KLKTRLTGPPSLKLFEEAINRETF---WVATEVVRE-ANQLKRMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYRNLLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1090          

HSP 2 Score: 69.3218 bits (168), Expect = 3.605e-11
Identity = 62/287 (21.60%), Postives = 123/287 (42.86%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETT--TILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD----LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S    +C       ++     ++      D W  ILNGS+ +    +   IL  G+ +G    +P +  E  +  + +  D C  + I++ D    L   ++ + K  +E   ++      ++ +   K   +++ KGT + L   L  + + V   ++EDF +TY+ F P P  + + +L          K    +LL W++ ++ +FE + A   FL +    L  +K   +L  L   C   A  R V
Sbjct:  279 IVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTHPDSRNEILCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKG--HIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLPSPMVVGKRLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTHFLEEFEYNLEREKMCGHLRLLNIACAAKAKLRVV 559          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 83.1889 bits (204), Expect = 1.820e-15
Identity = 82/316 (25.95%), Postives = 159/316 (50.32%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV+  A+ +  L + + +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A++++ E    ++L+L  VE A +L +R+ +  C    T+ I  +      LKT      +   F++ I    F   WV +E+  E    +KR K++  FI++A   +   + +  F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R L   Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  756 KADQQSRYIMIGKDTTAKEVVAQAIREFALTAAAEAYSLCEVSVTPEG--VIKQRRLPEQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQELLRESH-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLF----KLKTRLTGPPSLKLFEEAINRETF---WVATEVVRE-ANQLKRMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYRNLLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1049          

HSP 2 Score: 69.3218 bits (168), Expect = 3.626e-11
Identity = 62/287 (21.60%), Postives = 123/287 (42.86%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETT--TILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD----LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S    +C       ++     ++      D W  ILNGS+ +    +   IL  G+ +G    +P +  E  +  + +  D C  + I++ D    L   ++ + K  +E   ++      ++ +   K   +++ KGT + L   L  + + V   ++EDF +TY+ F P P  + + +L          K    +LL W++ ++ +FE + A   FL +    L  +K   +L  L   C   A  R V
Sbjct:  238 IVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTHPDSRNEILCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKG--HIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLPSPMVVGKRLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTHFLEEFEYNLEREKMCGHLRLLNIACAAKAKLRVV 518          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 83.1889 bits (204), Expect = 1.839e-15
Identity = 82/316 (25.95%), Postives = 159/316 (50.32%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV+  A+ +  L + + +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A++++ E    ++L+L  VE A +L +R+ +  C    T+ I  +      LKT      +   F++ I    F   WV +E+  E    +KR K++  FI++A   +   + +  F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R L   Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  797 KADQQSRYIMIGKDTTAKEVVAQAIREFALTAAAEAYSLCEVSVTPEG--VIKQRRLPEQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQELLRESH-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLF----KLKTRLTGPPSLKLFEEAINRETF---WVATEVVRE-ANQLKRMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYRNLLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1090          

HSP 2 Score: 69.3218 bits (168), Expect = 3.503e-11
Identity = 62/287 (21.60%), Postives = 123/287 (42.86%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETT--TILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD----LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S    +C       ++     ++      D W  ILNGS+ +    +   IL  G+ +G    +P +  E  +  + +  D C  + I++ D    L   ++ + K  +E   ++      ++ +   K   +++ KGT + L   L  + + V   ++EDF +TY+ F P P  + + +L          K    +LL W++ ++ +FE + A   FL +    L  +K   +L  L   C   A  R V
Sbjct:  279 IVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTHPDSRNEILCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKG--HIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLPSPMVVGKRLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTHFLEEFEYNLEREKMCGHLRLLNIACAAKAKLRVV 559          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 86.6557 bits (213), Expect = 1.600e-16
Identity = 52/156 (33.33%), Postives = 94/156 (60.26%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTC 2941
            WV++EIC   +CP   KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRLS TW+++ +  KK++   +N+++ + N R  R+   K+  P IP T L++KD+T   E N T+++          NL+NF+KMR +A    N + +I  C
Sbjct:  686 WVVTEIC---LCPQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLSLTWEKLPSKFKKIYAEFENLMDPSRNHRAYRLTVAKLDPPIIPFTPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIA----NTLRTIRYC 824          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 86.6557 bits (213), Expect = 1.933e-16
Identity = 52/156 (33.33%), Postives = 94/156 (60.26%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTC 2941
            WV++EIC   +CP   KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRLS TW+++ +  KK++   +N+++ + N R  R+   K+  P IP T L++KD+T   E N T+++          NL+NF+KMR +A    N + +I  C
Sbjct:  839 WVVTEIC---LCPQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLSLTWEKLPSKFKKIYAEFENLMDPSRNHRAYRLTVAKLDPPIIPFTPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIA----NTLRTIRYC 977          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 86.6557 bits (213), Expect = 2.021e-16
Identity = 50/148 (33.78%), Postives = 90/148 (60.81%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            WV++EIC   +CP   KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRLS TW+++ +  KK++   +N+++ + N R  R+   K+  P IP T L++KD+T   E N T+++          NL+NF+KMR +A   R 
Sbjct:  812 WVVTEIC---LCPQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLSLTWEKLPSKFKKIYAEFENLMDPSRNHRAYRLTVAKLDPPIIPFTPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTLRT 946          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Match: RAPGEF4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:100497690])

HSP 1 Score: 86.6557 bits (213), Expect = 2.074e-16
Identity = 50/148 (33.78%), Postives = 90/148 (60.81%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            WV++EIC   +CP   KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRLS TW+++ +  KK++   +N+++ + N R  R+   K+  P IP T L++KD+T   E N T+++          NL+NF+KMR +A   R 
Sbjct:  772 WVVTEIC---LCPQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLSLTWEKLPSKFKKIYAEFENLMDPSRNHRAYRLTVAKLDPPIIPFTPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTLRT 906          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Match: birc5 (Rap guanine nucleotide exchange factor 3 [Source:NCBI gene;Acc:100491495])

HSP 1 Score: 81.2629 bits (199), Expect = 7.556e-15
Identity = 51/176 (28.98%), Postives = 100/176 (56.82%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMC--PMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNF 2920
            T    R  N T    +++++  +  + WV +E+C   +C    +RA L+  FI+LA+  +   +++ FF+++ GL +  +SRLS+TW ++ N  +KL+   + +++ + N R  R+   K+++P IP   L++KDLT + E N + ++          +L+NF+KMR +A+  + F
Sbjct:  666 TFGKQRFRNATTANLERFMRRFNEVQFWVATEVC---LCQEEERRALLLKKFIKLAAYLKEQKNLNSFFAVMFGLSNTAVSRLSRTWQKLPNKFRKLYSIFERLMDPSWNHRSYRLAVAKLSAPLIPFLPLILKDLTFLHEGNRSTLD----------SLVNFEKMRMIAKTVQMF 828          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Match: Rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:MGI Symbol;Acc:MGI:2441741])

HSP 1 Score: 88.9669 bits (219), Expect = 3.032e-19
Identity = 57/147 (38.78%), Postives = 90/147 (61.22%), Query Frame = 2
Query: 2480 WVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:   10 WVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 143          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Match: Rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:MGI Symbol;Acc:MGI:2441741])

HSP 1 Score: 92.0485 bits (227), Expect = 2.779e-18
Identity = 64/185 (34.59%), Postives = 106/185 (57.30%), Query Frame = 2
Query: 2366 DLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            +LI YV      L    L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  646 ELIHYV------LGPQHLRDVTTANLERFMRRFNELQYWVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 811          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Match: Rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:MGI Symbol;Acc:MGI:2441741])

HSP 1 Score: 92.0485 bits (227), Expect = 3.164e-18
Identity = 64/185 (34.59%), Postives = 106/185 (57.30%), Query Frame = 2
Query: 2366 DLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            +LI YV      L    L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  688 ELIHYV------LGPQHLRDVTTANLERFMRRFNELQYWVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 853          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Match: Rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:MGI Symbol;Acc:MGI:2441741])

HSP 1 Score: 90.1225 bits (222), Expect = 1.261e-17
Identity = 59/168 (35.12%), Postives = 100/168 (59.52%), Query Frame = 2
Query: 2417 LSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  691 LRDVTTANLERFMRRFNELQYWVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 845          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Match: Rapgef3 (Rap guanine nucleotide exchange factor (GEF) 3 [Source:MGI Symbol;Acc:MGI:2441741])

HSP 1 Score: 85.1149 bits (209), Expect = 3.684e-16
Identity = 60/185 (32.43%), Postives = 94/185 (50.81%), Query Frame = 2
Query: 2366 DLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            +LI YV      L    L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+  S                  N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  688 ELIHYV------LGPQHLRDVTTANLERFMRRFNELQYWVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWEDPS-----------------WNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 836          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z1C8|RPGF3_RAT (Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.339e-17
Identity = 69/207 (33.33%), Postives = 113/207 (54.59%), Query Frame = 2
Query: 2300 VVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            + E    LF R H+        +LI YV      L    L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  673 LTEHDWNLFNRIHQ-------VELIHYV------LGPQHLRDVTTANLERFMRRFNELQYWVATELC---LCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDMTFIHEGNHTLVE----------NLINFEKMRMMARAVR 853          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VCC8|RPGF3_MOUSE (Rap guanine nucleotide exchange factor 3 OS=Mus musculus OX=10090 GN=Rapgef3 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 8.820e-17
Identity = 59/168 (35.12%), Postives = 100/168 (59.52%), Query Frame = 2
Query: 2417 LSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMK--RAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            L + T    +++++  +  + WV +E+C   +CP+   RA+L+  FI+LA+  +   +++ FF+++ GL +  ISRL+ TW+R+ +  +KL+  L+ +L+ + N R  R+   K++ P IP   L++KD+T I E N T VE          NLINF+KMR MAR  R
Sbjct:  691 LRDVTTANLERFMRRFNELQYWVATELC---LCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHEGNHTLVE----------NLINFEKMRMMARAVR 845          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9EQZ6|RPGF4_MOUSE (Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.000e-14
Identity = 50/175 (28.57%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + WV++E+C   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R 
Sbjct:  800 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEVC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTAAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTART 960          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WZA2|RPGF4_HUMAN (Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.196e-14
Identity = 51/175 (29.14%), Postives = 98/175 (56.00%), Query Frame = 2
Query: 2399 TLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            T   H     T N  D +++  +  + WV++EIC   +C    KR +L+  FI++A+  +   +++ FF+++ GL ++ +SRL+ TW+++ +  KK +   +++++ + N R  R+   K+  P IP   L++KD+T   E N T+++          NL+NF+KMR +A  +R 
Sbjct:  800 TFGRHNFKKTTAN-LDLFLRRFNEIQFWVVTEIC---LCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIANTART 960          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Match: sp|G5EDB9|RPGF_CAEEL (Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.681e-14
Identity = 72/270 (26.67%), Postives = 138/270 (51.11%), Query Frame = 2
Query: 2132 MIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNL----RHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            +I ++ L P   NL  ++ + S++YLK++S     L+  + A ++++E Q+  +L L     A +L ++          T+ +  +    +   + +L      EF+   QL +    WV +EIC+E+    KRAKLI  FI++A   + + + +  F+++SGLD   + RL  +W+RVS+   ++   +  +++ + N+    +HL  + Q+   P +P+  ++ KDLT   + N TY E           LINF+K+R +A+  R  +
Sbjct:  839 VIKQRRLPPQMENLAERIALNSRYYLKNNSR-SEPLVPDELAPELLKEAQT-QLLSLNAQVVAAQLTLQDFSVFSAIEPTEFLDNLFKLDSKYGSPKL-----EEFE---QLFNREMWWVATEICTERHV-QKRAKLIKKFIKVARYCRDLRNFNSMFAIMSGLDKPAVRRLHSSWERVSSKYIRMLDEIHQLVDPSRNMSKYRQHLAEVAQE--PPVVPIYPVIKKDLTFAHDGNATYSE----------KLINFEKLRLIAKSIRGVM 1085          

HSP 2 Score: 70.0922 bits (170), Expect = 1.327e-10
Identity = 62/285 (21.75%), Postives = 118/285 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDR---TIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            ++ CL+ +  +R+  ++  L   ++ +  F     S    +C +     +++    ++      D W  I+NG + +    GE     + GD +G+   TP        + +  D C+ +++   D       +    ++DR   T   V E  +    +  +   VL KG  D LI  L  +R  NV   +V+DF +TY++F  DP +I E ++      +   K    +LL W++ ++ +FE  +   + L +    L        L  L   C+  A  R V
Sbjct:  319 VRECLEKEPSERNSEDLAVLLDFMQHMSAFAALPMSIKRQLCLKMVFAVVNDAGTVVLAHNEKLDSWSVIVNGCVEVVKPSGERVEYKL-GDSFGA-EPTPATQIHIGEMRTMVDDCEFVLVEHRDFCSIMSTIGDHIEKDRDGLTGEVVSE--VERRTVGTHCGQVLIKGKPDKLIHHLVDERDHNVDPHYVDDFLLTYRVFIRDPTTIFEKLMLWFADSIYRDKVARLVLL-WVNNHFNDFETNDEMWNLLERFEGALERDGMHSQLSLLNIACSVKAKPRQV 598          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Match: A0A2J7QQ64 (Uncharacterized protein (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G06142 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.178e-29
Identity = 236/1046 (22.56%), Postives = 433/1046 (41.40%), Query Frame = 2
Query:  323 IKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLE---GETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQ---ELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIV--SVPRDSDQ-FVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE----------NVVNDLS------------FDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSP-APTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFS-TNFQ--RQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKD-----IFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRXXXXXXXXXXXXXXXXXXXXXXXVRVNSDLAASQAFNFQNGYL--WIDFYLSNLNKMVINDPMKLSEISLSCEPN 3307
            I+ CL+ D  +R++ +V  L +  + +K F     +    +C       +++    ++      D W  ++NG + +E   GET  + + GD +G IL T D L     + +  D C  + I++ +    Q   E   + ++ED  I+ V E      +      +V+ +GT + L+ +L  + +V    +VEDF +T++ F      +   +L      +   +    +LL W++ ++ +FE + A M FL      L  +K Q  L  L   C   A  R+V      +D ++  S+    ++ F  +I  + K  K     L  GD IL +   S   +T     ++      LS+ V+++ L + E          N +   S             D   +   P+   S S +   + SV+I+   S   SP   T+     KK             +G  G     PK+    L+R   K   M ++P N     V S D S TN Q   Q+M + +                  SNP+I+         S +Y   R++   E  +++Y  D     + +++  + H                      EV+++AL +  +   SS          +    +I ++ L     NL  ++ + S++YLK ++    +L+  + A +++ E Q    L+L  VE AI+L ++         +T+ +  +   K+      LS        ++ +L +    WV++E+CSE    ++R+K+I  FI++A + +   + +  F+++SGL    +SRL  +W+++ +  ++LF +L+++++ + N+   R L   ++   P IP   +V KDLT I   N + +EG          LINF+K+R +A+  R   N +C      S P     Y+  T L             L G   ++ +VALN          ++ S +           R  S    +    F+   +   +  YL+N+   VI D  KL  +SL CEP+
Sbjct:  120 IRECLEKDPSERTEDDVETLLEFTQHLKAFTNMTLAVRRALCSVMVFAVVEKAGTVVMNDGEELDSWSVLINGHVEVEHVNGETEQLQV-GDSFG-ILPTMDKLYHRGVMRTRCDDCQFVCITQTEYYRIQHQGEENIRRHEEDGRIVMVTEQR-GALEGGGRRGHVVIRGTSERLMLQLIEENSVIDPTYVEDFLLTHRTFINGSVQVANQLLQWFNEGVVRDRVTRVVLL-WVNNHFTDFETDPAMMEFLETFEIGLEQEKMQGQLRLLNIACAAKARTRNVTLARPSRDEVLHFSILGGYERGFGIFISKVDKRSKAEDVGLKRGDQILEVNGQSFDHVTHPKALEVLRGTTHLSITVKSNLLAFKEMLQTPENSPRNKIRKNSEIPLLQPDPRARLDVMHLSVMPT--ISNSSNTPTTPSVTITLGTSLTASPIKETNGGTGGKK-------------DGHKGFMTLGPKH---RLRRALEK---MNILPKNTITDGVHSEDNSFTNMQPSHQTMLIHS-----------------HSNPDIM---------STIYDDLRSSDYPEHVLKVYKPDQTCKYLLVHKETTAH----------------------EVVMLALQEFGITDPSSHFSLCEVSVAEGG--IIKQRRLPDQLQNLAERIGLSSRYYLK-TNGTTETLVPDEMAPELVRESQ-VHFLQLNAVEVAIQLTLQDFSIFRQIESTEYVDDLFELKSRYGVPMLS--------QFAELVNREMFWVVTEVCSEHNL-VRRSKIIKQFIKVARQCKECKNFNSMFAIVSGLGHGAVSRLRLSWEKLPSKYQRLFSDLQDLMDPSRNMSKYRQLVSSEQSQPPIIPFYPVVKKDLTFIHLGNDSKIEG----------LINFEKLRMIAKEVRTLTN-MC------SSP-----YDLLTML------------GLGGQPPSNAMVALN--------QLTMASGAGGQQGAATVKRRKKSTAQPNPKKMFEEAQMVRRVKAYLNNMR--VITDEDKLHSLSLECEPS 1035          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Match: A0A5S6R690 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.351e-29
Identity = 197/900 (21.89%), Postives = 382/900 (42.44%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIP-----SQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIV--SVPRDSDQFVFYIH------NLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYST----PS--TVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTV---GRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTN-QKQEFPIRIY-----FKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXD-ESNMMIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMAR 2905
            +++ CL+ +  +RS+ +V  L   ++ +  F    S     +C+R     +D+    ++K     D W  I+NG + +   +G      + GD +G +  T +       + +  D C  ++++++D +P     S+  + + +     ++   E  +    L     YVLTK T   LI+ L   R  NV   +VED  + Y+ F  D   + E ILS       + K    +LL W++ ++ +FE     MS L +    L  +   ++   L   C+  + +R V    S +D ++  S+    ++    ++      N   E   L  GD IL +   +   IT     ++      LS+ V+N+ LG+ E +  +   D+ ++Y      PS   +YS S   K          DS +           +K    +    LT    G     G   K     S  +KR    S   TL+  +    D        N    S   S +       R+KH R    SNP+++ S            +     Q  E  ++IY     FK + +Y+  +  N                      V+ +AL +  ++  SSS       +V   ++ +I ++ L     NL  ++ + S++YLK S+   + ++   +A ++++E ++  +++L     A +L ++      +   T+ +  +   ++     +L        D++ +L +    WV +E+C E+  P++RAK++  FI++A + +   + +  F+++ GL+   + RL  TWDRVS+  +K+ ++L+ +++ + N+   R  + +  I  P IP+  ++ KDLT I E NPT+          +  L+NF+K+R +A+
Sbjct:  294 LVRECLEKEPSERSEDDVAVLLDFMQHMPAFANLPSDVKCELCRRMVFAVVDKATTVVMKHGEQLDSWSVIINGEVEVVMPDGSRFEYRL-GDCFG-VEPTAEAQFHCGEMRTLVDDCQFVLVAQEDYVPIMCRLSESYLRQMDALTGRVVCEKERRV----LDDRDGYVLTKATPSKLIEALIEDRDCNVDSHYVEDLLLMYRTFIDDAVVMFEKILSWFADGAYKEKVARLVLL-WVNNHFNDFESSPRMMSLLEKFEGSLEDEAMYNHQQLLNIACSVKSRSRVVTYARSNRDEVLHFSILGGGERQCCGVYVAKVDCNSAAERVGLKRGDQILEVNGNNFRRITRQRALEILRSSTHLSMTVKNNLLGFKEMLSCE-QCDSSALYGGAKVRPSLPAIYSASLGPKFPGGRDFV--DSRL-------SRRQHKIHADVRQALLTKSSTGETIGSGAIAKEGSRLSKLIKRLRQGSSASTLLSWDEDRVDAGLARPCKNVASSSPHGSPMPC-----RLKHSR----SNPDLVASLRQPSFGQMSQYYQPVRPQHPEHILKIYRGDQSFKYLSVYKETTAQN----------------------VVQLALQEFGMSDPSSSSLQWSLCEVTVTADGLIKQRRLPDEMQNLAERISLNSRYYLK-SNGCSAPVVADDQASELVKESET-VLMQLHASTVAAQLTLQDFAVFASIEPTEYVDNLFKLESRYGWPKL--------DQFERLVNRETWWVATEVCKERS-PLRRAKIVKKFIKIAKQCRDFKNFNSMFAIVCGLEKPCVRRLHATWDRVSSKYRKVMEDLQLLMDPSRNMSKYRQHLTEAAIEPPSIPLLPVLKKDLTFIHECNPTW---------CDDGLVNFEKLRMIAK 1125          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Match: A0A5S6Q0Y8 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.509e-29
Identity = 197/900 (21.89%), Postives = 382/900 (42.44%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIP-----SQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKR--NVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIV--SVPRDSDQFVFYIH------NLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYST----PS--TVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTV---GRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTN-QKQEFPIRIY-----FKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXD-ESNMMIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMAR 2905
            +++ CL+ +  +RS+ +V  L   ++ +  F    S     +C+R     +D+    ++K     D W  I+NG + +   +G      + GD +G +  T +       + +  D C  ++++++D +P     S+  + + +     ++   E  +    L     YVLTK T   LI+ L   R  NV   +VED  + Y+ F  D   + E ILS       + K    +LL W++ ++ +FE     MS L +    L  +   ++   L   C+  + +R V    S +D ++  S+    ++    ++      N   E   L  GD IL +   +   IT     ++      LS+ V+N+ LG+ E +  +   D+ ++Y      PS   +YS S   K          DS +           +K    +    LT    G     G   K     S  +KR    S   TL+  +    D        N    S   S +       R+KH R    SNP+++ S            +     Q  E  ++IY     FK + +Y+  +  N                      V+ +AL +  ++  SSS       +V   ++ +I ++ L     NL  ++ + S++YLK S+   + ++   +A ++++E ++  +++L     A +L ++      +   T+ +  +   ++     +L        D++ +L +    WV +E+C E+  P++RAK++  FI++A + +   + +  F+++ GL+   + RL  TWDRVS+  +K+ ++L+ +++ + N+   R  + +  I  P IP+  ++ KDLT I E NPT+          +  L+NF+K+R +A+
Sbjct:  294 LVRECLEKEPSERSEDDVAVLLDFMQHMPAFANLPSDVKCELCRRMVFAVVDKATTVVMKHGEQLDSWSVIINGEVEVVMPDGSRFEYRL-GDCFG-VEPTAEAQFHCGEMRTLVDDCQFVLVAQEDYVPIMCRLSESYLRQMDALTGRVVCEKERRV----LDDRDGYVLTKATPSKLIEALIEDRDCNVDSHYVEDLLLMYRTFIDDAVVMFEKILSWFADGAYKEKVARLVLL-WVNNHFNDFESSPRMMSLLEKFEGSLEDEAMYNHQQLLNIACSVKSRSRVVTYARSNRDEVLHFSILGGGERQCCGVYVAKVDCNSAAERVGLKRGDQILEVNGNNFRRITRQRALEILRSSTHLSMTVKNNLLGFKEMLSCE-QCDSSALYGGAKVRPSLPAIYSASLGPKFPGGRDFV--DSRL-------SRRQHKIHADVRQALLTKSSTGETIGSGAIAKEGSRLSKLIKRLRQGSSASTLLSWDEDRVDAGLARPCKNVASSSPHGSPMPC-----RLKHSR----SNPDLVASLRQPSFGQMSQYYQPVRPQHPEHILKIYRGDQSFKYLSVYKETTAQN----------------------VVQLALQEFGMSDPSSSSLQWSLCEVTVTADGLIKQRRLPDEMQNLAERISLNSRYYLK-SNGCSAPVVADDQASELVKESET-VLMQLHASTVAAQLTLQDFAVFASIEPTEYVDNLFKLESRYGWPKL--------DQFERLVNRETWWVATEVCKERS-PLRRAKIVKKFIKIAKQCRDFKNFNSMFAIVCGLEKPCVRRLHATWDRVSSKYRKVMEDLQLLMDPSRNMSKYRQHLTEAAIEPPSIPLLPVLKKDLTFIHECNPTW---------CDDGLVNFEKLRMIAK 1125          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Match: A0A085LWU2 (General transcription factor IIH subunit 4 OS=Trichuris suis OX=68888 GN=M513_09705 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 9.713e-29
Identity = 195/898 (21.71%), Postives = 388/898 (43.21%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKT---NDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVH---REFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIV--SVPRDSDQFVFYIH------NLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSIST--NDSDVGSPAPTDKSPNNKKRPSLIPN----FLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFST---NFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTN-QKQEFPIRIY-----FKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMAR 2905
            +++ CL+ +  +RS+ +V  L   ++ +  F    S     +C+R     +D+    ++K     D W  I+NG + +   +G      + GD +G +  T +       + +  D C  ++++++D +     ++++     + RT   V E       L     YVLTK T   LI+ L   R+ H     +VED  + Y+ F  D   ++E ILS       + K    +LL W++ ++ +FE     MS L +    L  +   ++   L   C+  + +R V    S +D ++  S+   SD+    I+      N   E   L  GD IL +   +   +      ++      LS+ V+N+ LG+ E     LS + C+  ++ ST    + +  +  + S ST    S  G      ++ + + + SL  +     LT    G      K     S  +KR    S   TL+  +    D S+    +   +FQ  S  +          R+KH R    SNP+++ S            +     Q  E  ++IY     FK + +Y+  +   S N  +L      +    P S  +  +L ++ +                 ++ +I ++ L     NL  ++ + S++YLK+++     L+   +A ++++E ++  +++L     A +L ++      +   T+ +  +    +     +L        D++ QL +    WV +E+C E+   ++RAK++  FI++A + +   + +  F+++ GL+   + RL  TWD+VS+  +K+ ++L+ +++ + N+   R  + +  +  P IP+  ++ KDLT I E NPT+          +  L+NF+K+R +A+
Sbjct:  820 LVRECLEKEPSERSEDDVAVLLDFMQHMPAFANLPSYVKCELCRRMVFAVVDKAATIVMKHGEQLDSWSVIINGEVEVIMPDGSRCEYRL-GDCFG-VEPTSEAQYHCGEMRTLVDDCQFVLVAQEDYVQIMSRLSESYLRQMDARTGHVVCEK--ERRVLDDREGYVLTKATPSKLIEALIEDRDSHYVDSHYVEDMLLMYRTFIDDAAVMLEKILSWFADGAFKEKVARLVLL-WVNNHFNDFESSPKMMSLLEKFEGSLEDEAMYNHQQLLNIACSVKSRSRLVTYARSNRDEVLHFSILGGSDRHCCGIYIAKVDCNSAAERVGLKRGDQILEVNGNNFRRVNRQRALEILRSSTHLSMTVKNNLLGFKEM----LSCEQCNSSNSYSTQGGGAKARPLLPTGSASTIRPKSPCGRDYVDSRACHRQHKLSLHGDVRQTLLTKSSTGETIGIAKEGSRLSKLIKRLRQGSSASTLLSWDEDRVDHSARPIKSAVPSFQHGSPMLC---------RLKHSR----SNPDLVASLRQPSFGQISQYYQPIRPQHPEHILKIYRGDQSFKYLSVYKETT---SQNVVQLALQEFGMSD--PASSSLQWSLCEVTVT----------------ADGLIKQRRLPEEMQNLAERISLNSRYYLKNNN-CSVPLVTDDQANELLKESET-VLMQLHASTLAAQLTLQDFAVFASIEPTEYVDNLFKLDSRYGWPKL--------DQFEQLVNRETWWVATEVCKERSL-LRRAKIVKKFIKIAKQCRDFKNFNSMFAIVCGLEKPCVRRLHNTWDKVSSKYRKVLEDLQLLMDPSRNMSKYRQHLTEAALEPPSIPLLPVLKKDLTFIHECNPTW---------CDDGLVNFEKLRMIAK 1654          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Match: A0A085N2F7 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M514_09705 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.121e-28
Identity = 195/898 (21.71%), Postives = 388/898 (43.21%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKT---NDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVH---REFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIV--SVPRDSDQFVFYIH------NLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSIST--NDSDVGSPAPTDKSPNNKKRPSLIPN----FLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFST---NFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTN-QKQEFPIRIY-----FKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNL--KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMAR 2905
            +++ CL+ +  +RS+ +V  L   ++ +  F    S     +C+R     +D+    ++K     D W  I+NG + +   +G      + GD +G +  T +       + +  D C  ++++++D +     ++++     + RT   V E       L     YVLTK T   LI+ L   R+ H     +VED  + Y+ F  D   ++E ILS       + K    +LL W++ ++ +FE     MS L +    L  +   ++   L   C+  + +R V    S +D ++  S+   SD+    I+      N   E   L  GD IL +   +   +      ++      LS+ V+N+ LG+ E     LS + C+  ++ ST    + +  +  + S ST    S  G      ++ + + + SL  +     LT    G      K     S  +KR    S   TL+  +    D S+    +   +FQ  S  +          R+KH R    SNP+++ S            +     Q  E  ++IY     FK + +Y+  +   S N  +L      +    P S  +  +L ++ +                 ++ +I ++ L     NL  ++ + S++YLK+++     L+   +A ++++E ++  +++L     A +L ++      +   T+ +  +    +     +L        D++ QL +    WV +E+C E+   ++RAK++  FI++A + +   + +  F+++ GL+   + RL  TWD+VS+  +K+ ++L+ +++ + N+   R  + +  +  P IP+  ++ KDLT I E NPT+          +  L+NF+K+R +A+
Sbjct:  295 LVRECLEKEPSERSEDDVAVLLDFMQHMPAFANLPSYVKCELCRRMVFAVVDKAATIVMKHGEQLDSWSVIINGEVEVIMPDGSRCEYRL-GDCFG-VEPTSEAQYHCGEMRTLVDDCQFVLVAQEDYVQIMSRLSESYLRQMDARTGHVVCEK--ERRVLDDREGYVLTKATPSKLIEALIEDRDSHYVDSHYVEDMLLMYRTFIDDAAVMLEKILSWFADGAFKEKVARLVLL-WVNNHFNDFESSPKMMSLLEKFEGSLEDEAMYNHQQLLNIACSVKSRSRLVTYARSNRDEVLHFSILGGSDRHCCGIYIAKVDCNSAAERVGLKRGDQILEVNGNNFRRVNRQRALEILRSSTHLSMTVKNNLLGFKEM----LSCEQCNSSNSYSTQGGGAKARPLLPTGSASTIRPKSPCGRDYVDSRACHRQHKLSLHGDVRQTLLTKSSTGETIGIAKEGSRLSKLIKRLRQGSSASTLLSWDEDRVDHSARPIKSAVPSFQHGSPMLC---------RLKHSR----SNPDLVASLRQPSFGQISQYYQPIRPQHPEHILKIYRGDQSFKYLSVYKETT---SQNVVQLALQEFGMSD--PASSSLQWSLCEVTVT----------------ADGLIKQRRLPEEMQNLAERISLNSRYYLKNNN-CSVPLVTDDQANELLKESET-VLMQLHASTLAAQLTLQDFAVFASIEPTEYVDNLFKLDSRYGWPKL--------DQFEQLVNRETWWVATEVCKERSL-LRRAKIVKKFIKIAKQCRDFKNFNSMFAIVCGLEKPCVRRLHNTWDKVSSKYRKVLEDLQLLMDPSRNMSKYRQHLTEAALEPPSIPLLPVLKKDLTFIHECNPTW---------CDDGLVNFEKLRMIAK 1129          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Match: rapgef4 (Rap guanine nucleotide exchange factor 4 [Source:NCBI gene;Acc:103034068])

HSP 1 Score: 81.6481 bits (200), Expect = 3.981e-15
Identity = 49/147 (33.33%), Postives = 87/147 (59.18%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            WV++E+C   +C    KR +L+  FI++A+  +   +++ FFS+I GL +  +SRLSQTW+++ +  KK +   +N+++ + N R  R+   K+  P IP   L++KD+T   E N T+++          +L+NF+KMR +A   R
Sbjct:  825 WVVTEVC---LCSALSKRVQLLKKFIKIAAHCKEFRNLNSFFSIIMGLGNPAVSRLSQTWEKLPSKFKKFYGEFENLMDPSRNHRAYRLTVAKLDPPIIPFMPLLIKDMTFTHEGNKTFID----------SLVNFEKMRMIANTVR 958          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 81.2629 bits (199), Expect = 5.701e-15
Identity = 66/246 (26.83%), Postives = 133/246 (54.07%), Query Frame = 2
Query: 2174 KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMAR 2905
            ++++  ++YLK S+    +L   ++A++++ E Q  ++L+L  VE A +L +R+ +  C    T+ I  +      L++      +   F++ I    F   WV +E+  E    +KR K++  FI++A   +   + +  F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R  +  Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+
Sbjct:  674 RIQLSGRYYLK-SNMETETLCSDEDAQELLRESQ-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLF----KLRSRASGPSSLKLFEEAINRETF---WVATEVVREPN-QLKRMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAK 899          

HSP 2 Score: 68.5514 bits (166), Expect = 4.823e-11
Identity = 76/371 (20.49%), Postives = 154/371 (41.51%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD----LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVS---VPRDSDQFVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLG 1381
            +++ CL+ D   R+D ++ +L + +  +  F     S    +C       ++     ++      D W  ILNGS+ +   EG  T IL  G+ +G    +P +  E  +  + +  D C  + I++ D    L   ++ + K  +E   ++      ++ +   K   +++ KGT + L   L  + + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE +     FL +    L  +K   +L  L   C   A  R V      ++  ++   +      F  +I +++   K     L  GD IL +   +   + +    ++      LS+ V+ + LG
Sbjct:  113 IVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPEGR-TEILCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKG--HIVIKGTTERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWFHDSSLRDKVTRVVLL-WVNNHFNDFEGDPEMTHFLEEFENNLEREKMCGHLRLLNIACAAKAKLRVVTLTKPSREAPLAFTLLGGSEKGFRIFIDHVEPGSKAAEAGLKRGDQILEVNGQNFENVQLSKANEILRNNTHLSITVKTNLLG 476          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 81.2629 bits (199), Expect = 6.557e-15
Identity = 67/250 (26.80%), Postives = 135/250 (54.00%), Query Frame = 2
Query: 2174 KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            ++++  ++YLK S+    +L   ++A++++ E Q  ++L+L  VE A +L +R+ +  C    T+ I  +      L++      +   F++ I    F   WV +E+  E    +KR K++  FI++A   +   + +  F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R  +  Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  693 RIQLSGRYYLK-SNMETETLCSDEDAQELLRESQ-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLF----KLRSRASGPSSLKLFEEAINRETF---WVATEVVREPNQ-LKRMKIVKHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFSDLQDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 922          

HSP 2 Score: 67.3958 bits (163), Expect = 1.001e-10
Identity = 63/288 (21.88%), Postives = 123/288 (42.71%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD----LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S    +C       ++     ++      D W  ILNGS+ +   EG  T IL  G+ +G    +P +  E  +  + +  D C  + I++ D    L   ++ + K  +E   ++      ++ +   K   +++ KGT + L   L  + + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE +     FL +    L  +K   +L  L   C   A  R V
Sbjct:  106 IVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPEGR-TEILCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKG--HIVIKGTTERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWFHDSSLRDKVTRVVLL-WVNNHFNDFEGDPEMTHFLEEFENNLEREKMCGHLRLLNIACAAKAKLRVV 386          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-253i9.4 (si:dkey-253i9.4 [Source:ZFIN;Acc:ZDB-GENE-090313-280])

HSP 1 Score: 80.8777 bits (198), Expect = 6.719e-15
Identity = 73/252 (28.97%), Postives = 127/252 (50.40%), Query Frame = 2
Query: 2174 KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQK--ITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            ++++ +++YLK S+    +L    EA+++  E Q   +L L   E A +L  R++    +   TD IT +   +   +   L N     F+  I    F   WV +EI  E    +KR K+I  FI++A   +   + +  F++ISGL+   +SRL  TW+R+    +KL   L+ + + + N+   R L  K  +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +AR  R+ +
Sbjct:  809 RIQLCARYYLK-SNMETETLCSDVEAQELQRESQ-VCLLSLSCTEIANQLSARNYLLFASVEPTDYITDLFKLRPHERPANLRN-----FEDLINQETF---WVATEIVREAN-QVKRMKIIKHFIKVALHCRDCKNFNSMFAIISGLNLAPVSRLRATWERLPGKYEKLLSELQEVFDPSRNMAKYRNLLNKHNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAREIRHVV 1039          

HSP 2 Score: 75.0998 bits (183), Expect = 3.935e-13
Identity = 80/378 (21.16%), Postives = 159/378 (42.06%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL---EGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFS---YVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSM-QKNQDYLLFLYDTCTNHASARSVRCRLSFKDN------IVSVPRDSDQFVFYIHNLQK-EHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVV 1399
            +++ CL+ D   R+D ++ +L + ++ +  F   + S    +C       ++     ++      D W  ILNG++ +   +G+  T+ + G F  S     +L+     + +  D C  + I++ D   ++   E  T+  +E+  I+ V E    + +L +  +   +++ KGT + LI+ L    + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE +    +FL +    L   QK    L  L   C   A  R V      ++       I    R +  F+  +    K E   L  GD IL +   +   + +    ++      LS+ V+ + L + E V 
Sbjct:  243 IVRDCLEKDPMDRTDDDIEQLLEFVQQLPAFASLSVSVRRELCAVMVFAVVERAGTIVLNHGEELDSWSVILNGAVEVMYPDGQCETVGMGGSFGVSPSMEKELMV--GVMRTKVDDCQFVCIAQQDYCCILNQVEQNTQRVEEEGEIVMVKE----HRELDRTGTRKGHIVVKGTTERLIQHLVEDHSVVDPTYIEDFLLTYRTFVSSPLIVGQRLLDWFNDPGLRDKVTRVVLL-WVNNHFSDFEGDPDMTNFLEEFQNYLERDQKMTGQLRLLNIACAAKAKPRVVSITRGSREMPLPFTLIGGAERGTRLFISSVEMGSKAEEAGLKRGDQILEVNGQTFENVQLSKATEILKNNLHLSMTVKTNLLVFKELVA 613          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042144.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:33358051:33411927:-1 gene:ENSAMXG00000030155.1 transcript:ENSAMXT00000042144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 2.735e-14
Identity = 56/183 (30.60%), Postives = 103/183 (56.28%), Query Frame = 2
Query: 2372 ITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCP--MKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            + Y T S+ +   H ++       +  +Q  +  + WV++E+    +CP   KR +L+  FI++A+  +   +++ FF++I GL++  ISRLSQTW++V    KKLF  L+++ + + N +  R   +K+ SP IP   L++KD+T I E N T+++           L+NF+K+  +A + R
Sbjct:  300 LVYFTLSRDSCAGHTVA------LELLLQRCNEVQQWVMTEV---LLCPALCKRVQLLKKFIKIAAHCKAQRNLNSFFAIIMGLNTAAISRLSQTWEKVPGKFKKLFSELESLTDPSFNHKAYRDAFKKMKSPKIPFLPLLLKDITFIHEGNKTFLD----------KLVNFEKLHMIADMVR 463          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Sea Lamprey
Match: rapgef2 (Rap guanine nucleotide exchange factor (GEF) 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6959])

HSP 1 Score: 82.0333 bits (201), Expect = 5.375e-16
Identity = 79/333 (23.72%), Postives = 144/333 (43.24%), Query Frame = 2
Query:  443 MCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSL---RLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFS---YVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQ---FVFYIHNLQKEHKL----LMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE 1390
            +C       +++    +++     D W  ILNGS+   R +G T T+ +   F  S     +L+T    + +  D C  + I++ D   ++   E   +  +E+  I+ V E    + +L +  +   +++ KGT + LI  L  + +V    +VEDF +TY+ F P    I + +L          K    +LL W++ ++ +FE +   M FL      L  +K   +L  L   C   A  R V  R + +++ +    D  Q   F  Y+ +L  + K     L  GD IL +   +   + +     +  +   LS+ V+N+ L Y E
Sbjct:  108 LCASMVFAVVEKAGTVVLRDGEELDSWCVILNGSVEISRADGRTETLCMGNCFGVSPSMEKELMT--GVMKTKVDDCQFVCIAQKDYCRILNKVERNMQKVEEEGEIVMVKE----HRELDRTGTRKGHIVIKGTPERLINHLVEEHSVVDPTYVEDFLLTYRTFQPHGLDIGKRLLQWFNDSSLRDKVTRVVLL-WVNNHFNDFESDPDLMQFLENFESCLEREKMHGHLRLLNIACAAKARVRHVTVRRASRESPLGFKLDGGQDRGFPLYVSSLDLQSKASESGLKRGDQILEVNGQNFDNVLLSQAMDIMKKSTHLSITVKNNLLSYKE 433          

HSP 2 Score: 71.2478 bits (173), Expect = 1.112e-12
Identity = 65/262 (24.81%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 2177 LKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKS 2956
            +++ +++YLK++S     L   + A+++++E Q  ++L+L  +E A ++ IR  +   +   T+ +  +           L       F++ +    F   WV SE+  E    +KR KLI  ++++A   +   + +  F++ISGL    + RL   WD++ +  +KLF +L+++ + + N+   R L     +  P IP+  +V KDLT + + N + VEG          L+NF+K+R +A+  R+ +  + + ++D +
Sbjct:  630 IQLNARYYLKNNSQT-EPLCSDEHAQELLKESQ-ISLLQLSTLEVATQISIRDFQIFRSIEPTEYVANLFRLGGAAACEHL-----QAFEETLNRETF---WVPSEVLRETGL-LKRVKLIKHYLKIALNCRDSRNFNSMFAIISGLSHSSVMRLRSAWDKLPSKYEKLFSDLQDLFDPSRNMAKYRNLLSSPSLQPPIIPLFPVVKKDLTFLHDGNDSRVEG----------LVNFEKLRMIAKEVRH-VGRLASANQDPA 869          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005082.1 (pep scaffold:Pmarinus_7.0:GL478314:141397:156611:1 gene:ENSPMAG00000004611.1 transcript:ENSPMAT00000005082.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.340e-10
Identity = 43/150 (28.67%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 2480 WVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFI 2923
            WV SE+ +E    +KR K++  FI++A   +   + +  F++ISGL    ++RL+ TW+++    + L++ L+++ + + N+   R  +  Q +  P IP+  +V KDLT + E N + V+G          ++NF+K+R +A+  R  +
Sbjct:   52 WVASEVLAEPGQ-IKRVKVLKHFIKIALHCRECKNFNSMFAIISGLSHSSVARLNGTWEKLPTKYESLYRELQDLFDPSRNMAKYRNVLSSQSLQPPLIPLFPVVKKDLTFLHEGNDSRVDG----------MVNFEKLRMIAKEVRQVV 190          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Nematostella
Match: EDO37398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFW1])

HSP 1 Score: 77.7962 bits (190), Expect = 1.915e-14
Identity = 53/139 (38.13%), Postives = 84/139 (60.43%), Query Frame = 2
Query: 2480 WVISEIC-SEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMR 2893
            WVI+EIC + Q+   KR  L+  FI++AS  +   +++  F++I  L+   ISRL+QTW+++ N  KKL++ L  IL+ +GN R  R++  K+  P IP   L++KD+T+I   N T+V            L+NF+KMR
Sbjct:  782 WVITEICLATQL--SKRVFLLKKFIKIASYCKDYKNLNSAFAIIMALNCAAISRLTQTWEKIPNKYKKLYRELDAILDPSGNHRVYRLVVAKMKPPVIPFMVLIMKDITIINYGNKTFV----------NELVNFEKMR 908          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Nematostella
Match: EDO41810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S390])

HSP 1 Score: 74.3294 bits (181), Expect = 2.213e-13
Identity = 67/249 (26.91%), Postives = 127/249 (51.00%), Query Frame = 2
Query: 2174 KLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRIL--QQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR 2914
            ++ + S++YLK+++   ++ +LQ +A   + +    T+L+L   E A  L ++  +    F A D   Y+              +      K+ +  +    WV++EIC E    +KR KLI  FI++A   +   +I+  F++ISGL    + RL  TW+++ N   K++++L+N+++ + ++   R L   + +  P IP   ++ +DLT+I   N + V+G          LINF+K+R +AR  R
Sbjct:  524 RISLNSRYYLKNNN--ETAQLLQGDATHDLGKECHVTLLQLKTQEVARHLTLQDFEL---FRAIDPREYI------YDVWEFGPEFSPNLAKFEETVNRETFWVVTEICGESNV-VKRMKLIKHFIKIAKYCKDCKNINSAFAIISGLGHTAVKRLKNTWEKLPNRYYKMYEDLENLMDPSRSMFKYRSLLNSEHVNPPLIPFFPVIKRDLTLIYLNNKSVVDG----------LINFEKLRMIAREVR 750          

HSP 2 Score: 66.2402 bits (160), Expect = 6.452e-11
Identity = 76/333 (22.82%), Postives = 138/333 (41.44%), Query Frame = 2
Query:  443 MCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGS--LRLEGETTTILIPGDFYGSILDTPDL--LTEENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNV-HREFVEDFFVTYKIFNPDPFSIMESILSN-LTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNI----VSVPRDSDQFVFYIHNLQKEHKLLMDG----DIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHE 1390
            +C       +++ +  ++K     D W  ILNGS  + +E E    L  GD +G     P L  +     + +  + C  + I++ D   ++   E   +  +ED  ++ V E    ++D       V+ K     LI  L    +V    FVEDF +T+K F   P  I   +L+  L  DL +   +  ++L W++ +Y +FE +     +L      L +QK    L  L   C+  A +R +       D      ++  R+ + F  +++ +  E      G    D +L + D S   IT D  + L      L+L ++ +  G+ +
Sbjct:    9 LCAVMVFAVVEKADAIVMKDGEELDSWCVILNGSVIIEVENEPPIELHLGDSFGV---EPSLKKMYHHGLMRTRVNDCQFVCIAQSDYYRILTQGESNIQVIEEDGEVVMVTEH--RSTDGGNRQGQVVIKAKSGKLITHLVEDHSVIDPTFVEDFLLTFKTFFDQPTKICGKLLNWFLEDDLRDKVTR--VMLLWVNNHYNDFEGDHVMEDYLQAFESALEVQKMSGQLDLLLMACSVKAKSRVISLERQSHDQPWGFSIAGGRE-NGFGIFVYKIDPECSAFTAGVRKADQVLKVNDISFENITYDKARDLLSSSIRLTLALKKNIAGFKD 333          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Nematostella
Match: EDO32740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU64])

HSP 1 Score: 49.2914 bits (116), Expect = 9.874e-6
Identity = 34/115 (29.57%), Postives = 63/115 (54.78%), Query Frame = 2
Query: 2480 WVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANP 2824
            WV+ EI + +     R  ++S FIR+A +   + ++    ++I+GL S  + RL+QTW+++S  D  +F+ L+++L+   N + LR        P IP   + + DL  I+  +P
Sbjct:  118 WVVREILNAKKLKT-RVAVMSHFIRIAKRLYEMNNLHSLKAVIAGLQSAPVYRLNQTWEQLSRRDHTIFEKLEDLLSEDQNRKRLRDHLNSTRLPCIPHLGMYLTDLMYIDTIHP 231          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 86.2705 bits (212), Expect = 1.617e-18
Identity = 62/203 (30.54%), Postives = 105/203 (51.72%), Query Frame = 2
Query: 2480 WVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMR------KMARLSRNFINS-----------ICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLH 3031
            WVI+EIC   +C    KR +L+  FI++A+  +   +++ FF++I GL +  +SRLSQTW+++ +  KK +   +N+++ + N R  R++  K+  P IP   L++KD+T   E N T+++          NL+NF+KMR      K+ R  R+   S            C C K K  P    +      ++N+ IL  + H
Sbjct:   10 WVITEIC---LCSQISKRVQLLKKFIKIAAHCKDYKNLNAFFAIIMGLSNPAVSRLSQTWEKLPSKFKKFYGEFENLMDPSRNHRSYRLIFSKLEPPVIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKMRMIAKTVKIVRYCRSQTFSKFRDKDWSKLQRCVCKKSKHHPDVWTYVRQFNVIDNQRILTQLSH 199          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Match: rapgef2 (Rap guanine nucleotide exchange factor 2 [Source:NCBI gene;Acc:101158677])

HSP 1 Score: 85.1149 bits (209), Expect = 4.249e-16
Identity = 82/316 (25.95%), Postives = 158/316 (50.00%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV++ A+ +  L +   +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A+ ++ E Q  ++L+L  VE A +L +R+ +  C    T+ I  +   ++   +  L       F++ I    F   WV SE+  E    +KR K+I  FI++A   +   +    F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R  +  Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  790 KADQQSRYIMIGKDTTAKEVVVQAIREFALTAAPEAYSLCEVSVTPEG--VIKQRRLPDQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQDLLREGQ-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLFKRRSKTGSASL-----KRFEEAINHETF---WVASEVTREPN-QLKRMKIIKHFIKIALHCRECKNFSSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFGDLQDLFDPSRNMAKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1082          

HSP 2 Score: 69.707 bits (169), Expect = 1.839e-11
Identity = 62/289 (21.45%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL--EGETTTILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFS---YVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S  + +C       ++     ++      D W  ILNGS+ +      T +L  G+ +G    +P +  E  +  + +  D C  + I++ +   ++   E   +  +E+  I+ V E    + +L +  +   +++ KGT + L   L  + + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE + A   FL +   +L  +K   +L  L   C   A  R V
Sbjct:  267 IVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRKQLCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDSRTEVLCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQEYCCILNQVEKNMQRVEEEGEIVMVKE----HRELDRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTRFLEEFENMLEKEKMCGHLRLLNIACAAKAKPRLV 547          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Match: rapgef4 (Rap guanine nucleotide exchange factor (GEF) 4 [Source:ZFIN;Acc:ZDB-GENE-070912-385])

HSP 1 Score: 82.0333 bits (201), Expect = 4.310e-16
Identity = 51/158 (32.28%), Postives = 93/158 (58.86%), Query Frame = 2
Query: 2423 NQTENEFDKYIQLSDFYKNWVISEICSEQMCPM--KRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKM 2890
            N+T    D +++  +  + WVI+EIC   +C    KR +L+  FI++A+  +   +++ FF++I GL +  +SRLSQTW+++ +  KK +   +N+++ + N R  R++  K+  P IP   L++KD+T   E N T+++          NL+NF+KM
Sbjct:  144 NKTSVNLDLFLRRFNEIQFWVITEIC---LCSQISKRVQLLKKFIKIAAHCKDYKNLNAFFAIIMGLSNPAVSRLSQTWEKLPSKFKKFYGEFENLMDPSRNHRSYRLIFSKLEPPVIPFMPLLIKDMTFTHEGNKTFID----------NLVNFEKM 288          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Match: rapgef2 (Rap guanine nucleotide exchange factor 2 [Source:NCBI gene;Acc:101158677])

HSP 1 Score: 85.1149 bits (209), Expect = 4.586e-16
Identity = 82/316 (25.95%), Postives = 158/316 (50.00%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV++ A+ +  L +   +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A+ ++ E Q  ++L+L  VE A +L +R+ +  C    T+ I  +   ++   +  L       F++ I    F   WV SE+  E    +KR K+I  FI++A   +   +    F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R  +  Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  784 KADQQSRYIMIGKDTTAKEVVVQAIREFALTAAPEAYSLCEVSVTPEG--VIKQRRLPDQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQDLLREGQ-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLFKRRSKTGSASL-----KRFEEAINHETF---WVASEVTREPN-QLKRMKIIKHFIKIALHCRECKNFSSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFGDLQDLFDPSRNMAKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1076          

HSP 2 Score: 69.707 bits (169), Expect = 1.919e-11
Identity = 62/289 (21.45%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL--EGETTTILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFS---YVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S  + +C       ++     ++      D W  ILNGS+ +      T +L  G+ +G    +P +  E  +  + +  D C  + I++ +   ++   E   +  +E+  I+ V E    + +L +  +   +++ KGT + L   L  + + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE + A   FL +   +L  +K   +L  L   C   A  R V
Sbjct:  261 IVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRKQLCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDSRTEVLCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQEYCCILNQVEKNMQRVEEEGEIVMVKE----HRELDRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTRFLEEFENMLEKEKMCGHLRLLNIACAAKAKPRLV 541          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Match: rapgef2 (Rap guanine nucleotide exchange factor 2 [Source:NCBI gene;Acc:101158677])

HSP 1 Score: 85.1149 bits (209), Expect = 4.669e-16
Identity = 82/316 (25.95%), Postives = 158/316 (50.00%), Query Frame = 2
Query: 1982 KSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQ--SKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLR--ILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRN 2917
            K++ +  +IMI       EV++ A+ +  L +   +          E   +I ++ L    + L  ++Q   ++YLK S+    +L   ++A+ ++ E Q  ++L+L  VE A +L +R+ +  C    T+ I  +   ++   +  L       F++ I    F   WV SE+  E    +KR K+I  FI++A   +   +    F++ISGL+   +SRL  TW+++ +  +KLF +L+++ + + N+   R  +  Q +  P IP+  ++ KDLT + E N + V+G          L+NF+K+R +A+  R+
Sbjct:  790 KADQQSRYIMIGKDTTAKEVVVQAIREFALTAAPEAYSLCEVSVTPEG--VIKQRRLPDQLSKLADRIQLSGRYYLK-SNMETETLCSDEDAQDLLREGQ-ISLLQLSTVEVATQLSMRAFELFCAIEPTEYIDDLFKRRSKTGSASL-----KRFEEAINHETF---WVASEVTREPN-QLKRMKIIKHFIKIALHCRECKNFSSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFGDLQDLFDPSRNMAKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDG----------LVNFEKLRMIAKEIRH 1082          

HSP 2 Score: 69.707 bits (169), Expect = 2.090e-11
Identity = 62/289 (21.45%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  320 VIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRL--EGETTTILIPGDFYGSILDTPDLLTE--ENNVYSNSDYCDLMVISKDD---LIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFS---YVLTKGTLDVLIKKLTTKRN-VHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV 1153
            +++ CL+ D   R+D ++ +L + +  +  F     S  + +C       ++     ++      D W  ILNGS+ +      T +L  G+ +G    +P +  E  +  + +  D C  + I++ +   ++   E   +  +E+  I+ V E    + +L +  +   +++ KGT + L   L  + + V   ++EDF +TY+ F   P  + + +L          K    +LL W++ ++ +FE + A   FL +   +L  +K   +L  L   C   A  R V
Sbjct:  267 IVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRKQLCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDSRTEVLCMGNSFGV---SPTMEKEYMKGVMKTKVDDCQFVCIAQQEYCCILNQVEKNMQRVEEEGEIVMVKE----HRELDRTGTRKGHIVIKGTAERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWFHDPSLRDKVTRVVLL-WVNNHFNDFEGDPAMTRFLEEFENMLEKEKMCGHLRLLNIACAAKAKPRLV 547          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Match: SMESG000060051.1 (SMESG000060051.1)

HSP 1 Score: 2087 bits (5406), Expect = 0.000e+0
Identity = 1129/1131 (99.82%), Postives = 1130/1131 (99.91%), Query Frame = 2
Query:   65 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIXXXXXXXXXXXXTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRXXXXXXXXXXXXXXXXXXXXXXXVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNXXXXXXXXXXXXXXXDDLIFNHNHFQTNSEEINDISDKAAEILGLK 3457
            MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLP+VEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDS EISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLK
Sbjct:    1 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPIVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSTEISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLK 1131          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Match: SMESG000060051.1 (SMESG000060051.1)

HSP 1 Score: 2083.92 bits (5398), Expect = 0.000e+0
Identity = 1132/1147 (98.69%), Postives = 1133/1147 (98.78%), Query Frame = 2
Query:   65 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIXXXXXXXXXXXXTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRXXXXXXXXXXXXXXXXXXXXXXXVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNXXXXXXXXXXXXXXXDDLIFNHNHFQTNSEEINDISDKAAEILGLKEPNPEIQAEDFWSVID 3505
            MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYS             TLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLP+VEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDS EISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLKEPNPEIQAEDFWSVID
Sbjct:    1 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSK------------TLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPIVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSTEISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLKEPNPEIQAEDFWSVID 1135          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Match: SMESG000060051.1 (SMESG000060051.1)

HSP 1 Score: 2050.4 bits (5311), Expect = 0.000e+0
Identity = 1116/1131 (98.67%), Postives = 1117/1131 (98.76%), Query Frame = 2
Query:   65 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIXXXXXXXXXXXXTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRXXXXXXXXXXXXXXXXXXXXXXXVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNXXXXXXXXXXXXXXXDDLIFNHNHFQTNSEEINDISDKAAEILGLK 3457
            MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYS             TLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLP+VEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDS EISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLK
Sbjct:    1 MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFENFNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDGDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSFDTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSK------------TLVPNNRSISDVSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKDLDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPASTNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPIVEFAIELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSTEISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSRNFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQIVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGYLWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQDDLIFNHNHFQTNSEEINDISDKAAEILGLK 1119          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Match: SMESG000009223.1 (SMESG000009223.1)

HSP 1 Score: 238.424 bits (607), Expect = 1.317e-63
Identity = 263/988 (26.62%), Postives = 464/988 (46.96%), Query Frame = 2
Query:  296 EVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLE--------------GETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDL--IPSQELVTKTN--DEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKL-TTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV------------------RCRLSFKD----NIVSVPRDSDQFVFYIHNLQKEHKLLMD----------GDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHEN-VVNDLSFDTCSIYSTPSTVYSQSHS-------DKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRK-YSKSRPMTLVPNNRSIS--------DVSSLDFSTNFQRQSM---SVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLK--LKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVT----------------------ASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVE--GKINGLQV-NKNLINFDKMRKMARLSRNFINSICTCDKDKSKPI 2965
            E+   D+  IK  LQ  S  RS  E   +  ++++I  F  +  S     C+ A+L  ++     ++KK      W + L G+L +                +    L   D +G+ L   +    +  + S S+ C LM+I+  +   I SQE  T T   + ++T++ +   C  ++D S     VL K T+  LI+ L      V   F+EDFF+TY ++      + ++I+  +     + K   +I+++W+  ++KE E +   M F++ +  +L  +  +++   +Y TC+ H++ R+V                    R+S KD     I + PR+   F  +  N QK + L +           GD ++ I + S   +T      +  + +   L V+ DP G++   +VN L         +P    S +HS         I    S       +G   P ++    K  P+ +    TS     + +  K    +++E K+K  SKSR     P+   +S        ++S L  ++N    S    S+S I  +  + +++  R   GS P++          +   S   ++   E  I++Y+KD     ++S+  S  KS +K ++++I       EVI+ +L++LNL+  S+SEF L E+ V E+  +I +KI+K  ++NL   +K+ ++F++K   F G  LI   + E++  E  + +   LPV E A ++F+  +      + +++I +VT                      A    L      +++ N F ++++L + Y  +V++ +CSE     KR K++   IR+A   + +G+I++FFSL++GLD +EISRL  TWDRV N D K+++ ++ +L+V+GN+R LR L +    P IP+ ALV KDLT I E +PT VE  G  N  +  N+ LINFDK+R MA  +R+F N +  C  + SK I
Sbjct:  223 EISCQDH--IKDILQKPSADRSTQENEVIMNVIQNIPLFSLWTQSLRCAACKLARLQVVENTQTVLIKKDEKMTDWIYCLQGTLEVRRTVENLNQSTDKNLSDVLETLRYSDSFGADLRKSEEQISKFYLVSTSNDCWLMLINWKEFMKIKSQEPTTLTQIIENNKTVMIMELRC--SADGSTK-GQVLVKATVRKLIEYLFENHGQVDETFIEDFFLTYNMYLTSTVLVRKAIIEQIPRVSEKRKKCTDIVVKWIKNHFKELENQSEIMKFIDFLSMLLFRENEEEHAGKIYHTCSTHSTQRNVTIMSNDKDQGSRPVIVGNGSRISSKDKAIMTIENYPREFMSFNLF-RNGQKLNNLFISQIRNCSDLHVGDRVIQINNISEENLTQKEANTILSKSQLTILTVKYDPEGFYAPFLVNYLKRKN----QSPVDRSSLTHSAMLDFPDSPIEPGYSTLPLKPKLGGIGPQNQGKMKKMLPNNVNQSATSSALKKMMKRCKANSSFTDEKKQKCKSKSRSAHNSPDRFQVSTPDLAFNENLSDLKINSNVMSTSFTETSISNIRAETPTVKMRKIRSRCGSQPDL-------RKSAFFNSGEFSSSTCESVIKVYYKD----PTDSI--SIGKSNVKSVYLIISKETEALEVIVKSLVELNLSCASNSEFCLCEISV-ETGPIIKQKIIKENTSNLMSIVKLNNRFFIKRRDFSGK-LIDNVDIEEINSEM-NVSFFDLPVCELATQIFVEGYNAFKKISLSEIIDFVTGKLRKESSNNKSKPEPTPGQPFAIGTNLDNRDGKSESVNNFQEFLKLGEKYMYFVVNVVCSETNSTSKRGKILKRLIRMARLCKELGNIEVFFSLMNGLDRVEISRLRNTWDRVPNKDLKMYRQMQQLLDVSGNMRLLRSLHKSCKPPVIPMAALVTKDLTTINEVHPTKVEDDGPENDQKSENEYLINFDKLRIMANRARSFKNLLYDCSINSSKAI 1184          
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Match: SMESG000009223.1 (SMESG000009223.1)

HSP 1 Score: 238.424 bits (607), Expect = 1.440e-63
Identity = 263/988 (26.62%), Postives = 464/988 (46.96%), Query Frame = 2
Query:  296 EVLLHDYSVIKRCLQTDSCQRSDSEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTKDKWFFILNGSLRLE--------------GETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYCDLMVISKDDL--IPSQELVTKTN--DEDRTIIAVYEPCINNSDLSKNFSYVLTKGTLDVLIKKL-TTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDLNESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFLYDTCTNHASARSV------------------RCRLSFKD----NIVSVPRDSDQFVFYIHNLQKEHKLLMD----------GDIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHEN-VVNDLSFDTCSIYSTPSTVYSQSHS-------DKISDSVSISTNDSDVGSPAPTDKSPNNKKRPSLIPNFLTSIQNGTVGRFFKNPKYYSNELKRK-YSKSRPMTLVPNNRSIS--------DVSSLDFSTNFQRQSM---SVSTISIQRFSRRIKHQRKSAGSNPEIIXXXXXXXXXXXXXXXXRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMIKPIMPVSEVIIIALLKLNLAXXXXXXXXXXXXXXDESNMMIHEKILKPASTNLK--LKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFAIELFIRSHKCICNFNATDLITYVT----------------------ASKATLKTHRLSNQTENEFDKYIQLSDFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISGLDSMEISRLSQTWDRVSNSDXXXXXXXXXXXXVTGNLRHLRILQQKITSPFIPVTALVVKDLTMIEEANPTYVE--GKINGLQV-NKNLINFDKMRKMARLSRNFINSICTCDKDKSKPI 2965
            E+   D+  IK  LQ  S  RS  E   +  ++++I  F  +  S     C+ A+L  ++     ++KK      W + L G+L +                +    L   D +G+ L   +    +  + S S+ C LM+I+  +   I SQE  T T   + ++T++ +   C  ++D S     VL K T+  LI+ L      V   F+EDFF+TY ++      + ++I+  +     + K   +I+++W+  ++KE E +   M F++ +  +L  +  +++   +Y TC+ H++ R+V                    R+S KD     I + PR+   F  +  N QK + L +           GD ++ I + S   +T      +  + +   L V+ DP G++   +VN L         +P    S +HS         I    S       +G   P ++    K  P+ +    TS     + +  K    +++E K+K  SKSR     P+   +S        ++S L  ++N    S    S+S I  +  + +++  R   GS P++          +   S   ++   E  I++Y+KD     ++S+  S  KS +K ++++I       EVI+ +L++LNL+  S+SEF L E+ V E+  +I +KI+K  ++NL   +K+ ++F++K   F G  LI   + E++  E  + +   LPV E A ++F+  +      + +++I +VT                      A    L      +++ N F ++++L + Y  +V++ +CSE     KR K++   IR+A   + +G+I++FFSL++GLD +EISRL  TWDRV N D K+++ ++ +L+V+GN+R LR L +    P IP+ ALV KDLT I E +PT VE  G  N  +  N+ LINFDK+R MA  +R+F N +  C  + SK I
Sbjct:  224 EISCQDH--IKDILQKPSADRSTQENEVIMNVIQNIPLFSLWTQSLRCAACKLARLQVVENTQTVLIKKDEKMTDWIYCLQGTLEVRRTVENLNQSTDKNLSDVLETLRYSDSFGADLRKSEEQISKFYLVSTSNDCWLMLINWKEFMKIKSQEPTTLTQIIENNKTVMIMELRC--SADGSTK-GQVLVKATVRKLIEYLFENHGQVDETFIEDFFLTYNMYLTSTVLVRKAIIEQIPRVSEKRKKCTDIVVKWIKNHFKELENQSEIMKFIDFLSMLLFRENEEEHAGKIYHTCSTHSTQRNVTIMSNDKDQGSRPVIVGNGSRISSKDKAIMTIENYPREFMSFNLF-RNGQKLNNLFISQIRNCSDLHVGDRVIQINNISEENLTQKEANTILSKSQLTILTVKYDPEGFYAPFLVNYLKRKN----QSPVDRSSLTHSAMLDFPDSPIEPGYSTLPLKPKLGGIGPQNQGKMKKMLPNNVNQSATSSALKKMMKRCKANSSFTDEKKQKCKSKSRSAHNSPDRFQVSTPDLAFNENLSDLKINSNVMSTSFTETSISNIRAETPTVKMRKIRSRCGSQPDL-------RKSAFFNSGEFSSSTCESVIKVYYKD----PTDSI--SIGKSNVKSVYLIISKETEALEVIVKSLVELNLSCASNSEFCLCEISV-ETGPIIKQKIIKENTSNLMSIVKLNNRFFIKRRDFSGK-LIDNVDIEEINSEM-NVSFFDLPVCELATQIFVEGYNAFKKISLSEIIDFVTGKLRKESSNNKSKPEPTPGQPFAIGTNLDNRDGKSESVNNFQEFLKLGEKYMYFVVNVVCSETNSTSKRGKILKRLIRMARLCKELGNIEVFFSLMNGLDRVEISRLRNTWDRVPNKDLKMYRQMQQLLDVSGNMRLLRSLHKSCKPPVIPMAALVTKDLTTINEVHPTKVEDDGPENDQKSENEYLINFDKLRIMANRARSFKNLLYDCSINSSKAI 1185          
The following BLAST results are available for this feature:
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAPGEF41.081e-1528.92Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF41.897e-1529.14Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF42.003e-1529.31Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF42.122e-1529.14Rap guanine nucleotide exchange factor 4 [Source:H... [more]
RAPGEF42.156e-1529.14Rap guanine nucleotide exchange factor 4 [Source:H... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxf-19.212e-1626.67Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-19.212e-1626.67Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.124e-1526.67Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.321e-1526.67Rap guanine nucleotide exchange factor [Source:Un... [more]
pxf-11.321e-1526.67Rap guanine nucleotide exchange factor [Source:Un... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epac3.220e-1529.48gene:FBgn0085421 transcript:FBtr0112636[more]
Epac3.220e-1529.48gene:FBgn0085421 transcript:FBtr0329851[more]
PDZ-GEF3.676e-1520.64gene:FBgn0265778 transcript:FBtr0300039[more]
PDZ-GEF3.818e-1520.64gene:FBgn0265778 transcript:FBtr0333242[more]
PDZ-GEF3.818e-1520.64gene:FBgn0265778 transcript:FBtr0300038[more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rapgef47.211e-1630.46Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef49.088e-1630.46Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef21.791e-1525.95Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
rapgef21.820e-1525.95Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
rapgef21.839e-1525.95Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAPGEF41.600e-1633.33Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF41.933e-1633.33Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF42.021e-1633.78Rap guanine nucleotide exchange factor 4 [Source:N... [more]
RAPGEF42.074e-1633.78Rap guanine nucleotide exchange factor 4 [Source:N... [more]
birc57.556e-1528.98Rap guanine nucleotide exchange factor 3 [Source:N... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rapgef33.032e-1938.78Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
Rapgef32.779e-1834.59Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
Rapgef33.164e-1834.59Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
Rapgef31.261e-1735.12Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
Rapgef33.684e-1632.43Rap guanine nucleotide exchange factor (GEF) 3 [So... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1C8|RPGF3_RAT1.339e-1733.33Rap guanine nucleotide exchange factor 3 OS=Rattus... [more]
sp|Q8VCC8|RPGF3_MOUSE8.820e-1735.12Rap guanine nucleotide exchange factor 3 OS=Mus mu... [more]
sp|Q9EQZ6|RPGF4_MOUSE1.000e-1428.57Rap guanine nucleotide exchange factor 4 OS=Mus mu... [more]
sp|Q8WZA2|RPGF4_HUMAN1.196e-1429.14Rap guanine nucleotide exchange factor 4 OS=Homo s... [more]
sp|G5EDB9|RPGF_CAEEL1.681e-1426.67Rap guanine nucleotide exchange factor OS=Caenorha... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7QQ641.178e-2922.56Uncharacterized protein (Fragment) OS=Cryptotermes... [more]
A0A5S6R6901.351e-2921.89Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q0Y81.509e-2921.89Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A085LWU29.713e-2921.71General transcription factor IIH subunit 4 OS=Tric... [more]
A0A085N2F71.121e-2821.71Uncharacterized protein OS=Trichuris suis OX=68888... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rapgef43.981e-1533.33Rap guanine nucleotide exchange factor 4 [Source:N... [more]
rapgef25.701e-1526.83Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
rapgef26.557e-1526.80Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
si:dkey-253i9.46.719e-1528.97si:dkey-253i9.4 [Source:ZFIN;Acc:ZDB-GENE-090313-2... [more]
ENSAMXT00000042144.12.735e-1430.60pep primary_assembly:Astyanax_mexicanus-2.0:10:333... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rapgef25.375e-1623.72Rap guanine nucleotide exchange factor (GEF) 2 [So... [more]
ENSPMAT00000005082.13.340e-1028.67pep scaffold:Pmarinus_7.0:GL478314:141397:156611:1... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO373981.915e-1438.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418102.213e-1326.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327409.874e-629.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rapgef41.617e-1830.54Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef24.249e-1625.95Rap guanine nucleotide exchange factor 2 [Source:N... [more]
rapgef44.310e-1632.28Rap guanine nucleotide exchange factor (GEF) 4 [So... [more]
rapgef24.586e-1625.95Rap guanine nucleotide exchange factor 2 [Source:N... [more]
rapgef24.669e-1625.95Rap guanine nucleotide exchange factor 2 [Source:N... [more]
back to top
BLAST of Ras guanine nucleotide exchange factor domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060051.10.000e+099.82SMESG000060051.1[more]
SMESG000060051.10.000e+098.69SMESG000060051.1[more]
SMESG000060051.10.000e+098.67SMESG000060051.1[more]
SMESG000009223.11.317e-6326.62SMESG000009223.1[more]
SMESG000009223.11.440e-6326.62SMESG000009223.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032801 ID=SMED30032801|Name=Ras guanine nucleotide exchange factor domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3762bp
ATTTATTCAAATATTATTATATCTACATTTTCAATGATATATTTGAAAAG
TAATTAAATAGCTTATGGAAATAGTTAACAATGATTGTATGTTGGAGTCT
AATTTTCGTAATGAATCTTCAACTCTGTACCATTTAAGTAGTATGCCAGA
CGATCGTGTATTTAATACAGACAACCAATTATACGATTCTTCTATTTGTC
AATCTTTTGAAAATTTTAATATACTAGATGAATCTCCATCTAAATTTATA
GACGATGCATCAGACAATGCTTCCTCAAGTTTGGACACTGAGTTCGAAGT
TCTCCTCCACGATTACAGTGTCATTAAAAGATGCTTACAGACTGATAGCT
GTCAACGATCTGACAGTGAAGTTAATAAATTGTCTCAGTTATTAGAATCG
ATAAAAGAATTCAGATATTTCAACAGCAGTGAGTTGGAAATGATGTGCCA
ACGAGCGAAATTATTGACAATCGATGAAATTAACAGAAAAATTGTGAAAA
AATTTTCTACTAAAGACAAATGGTTTTTCATTTTGAATGGTTCACTGAGA
CTAGAAGGAGAAACTACAACGATTTTAATTCCTGGAGATTTTTATGGTTC
AATTTTGGATACTCCAGATCTGTTGACCGAAGAAAATAACGTGTATTCGA
ACAGTGATTATTGCGATCTCATGGTCATTAGTAAAGATGACTTGATTCCT
TCTCAAGAACTAGTTACTAAAACTAACGACGAAGACAGGACAATCATAGC
CGTTTATGAACCTTGCATCAATAATTCTGATTTATCCAAAAACTTTAGTT
ACGTTTTGACGAAGGGAACACTGGATGTTTTAATCAAGAAGTTGACAACT
AAAAGAAATGTTCACCGAGAATTTGTGGAGGACTTTTTTGTGACGTATAA
GATATTTAATCCAGACCCTTTTAGCATCATGGAAAGTATTCTTTCGAATT
TAACGAGTGACTTGAATGAATCTAAAGCGAAATTTGAAATACTACTTCAA
TGGTTGTCACAGAACTATAAAGAATTTGAGAAAGAAGAAGCGAAAATGAG
CTTCTTGAATCAAATTATTGAAATTTTGTCTATGCAAAAAAATCAAGACT
ACTTATTGTTTTTGTATGATACCTGTACAAATCATGCATCGGCAAGATCA
GTTAGATGCAGATTGTCATTCAAAGACAACATTGTATCCGTTCCTCGAGA
TAGTGATCAATTTGTGTTTTATATTCATAATTTACAGAAAGAGCACAAAC
TATTGATGGACGGCGATATCATTTTAGCCATTGAAGATTATTCACATCAT
GCAATCACAATAGATTTGGTGAAAAAACTATGCGATGAATTAAAAGAGTT
GTCATTAATTGTTCGAAATGATCCTTTAGGATATCACGAGAATGTCGTGA
ATGACTTATCCTTTGATACATGTTCAATCTATTCAACTCCGTCCACAGTA
TATTCTCAAAGCCATTCCGACAAAATATCCGATTCAGTATCAATTTCTAC
AAACGATAGCGATGTCGGTTCTCCGGCACCAACCGATAAATCTCCCAACA
ACAAAAAGCGGCCATCGCTAATTCCAAACTTTTTGACAAGTATTCAAAAT
GGAACTGTCGGTCGATTTTTCAAAAATCCCAAATACTATTCAAATGAATT
AAAACGAAAATATTCCAAATCTAGGCCTATGACCCTTGTACCAAATAATC
GTAGCATTTCTGATGTCTCATCCTTGGATTTCAGCACAAACTTTCAGAGG
CAGAGTATGAGCGTATCAACAATATCTATACAGAGATTTTCCCGTCGAAT
AAAGCATCAACGAAAAAGCGCTGGTAGTAATCCTGAAATAATTAAGAGTT
TCGATGATAAAGATCTCGACAGTGACCTCTATTCATTTTATCGTACAAAT
CAGAAACAAGAATTCCCAATTCGTATATATTTTAAGGACATATTCATATA
TCGCTCAGAATCCCTTCACAATTCCTCAAACAAATCGGAGCTAAAATTCA
TCCACATTATGATTAAACCAATAATGCCCGTGTCTGAAGTGATCATTATA
GCGCTATTGAAATTAAACCTAGCATCAGTGAGTAGTTCTGAGTTCTTTTT
GGTAGAGGTCAAAGTTGACGAATCAAACATGATGATCCACGAGAAAATAC
TCAAACCGGCATCGACAAATTTAAAGCTCAAAGTCCAGTCGAAGTTCTAT
TTGAAACATTCATCTTTCATTGGCAGTAGTTTGATTTTGCAAAAAGAAGC
CGAAAAAATGATAGAAGAATTTCAATCGTTTACGATTTTGAAATTGCCGG
TCGTGGAATTCGCTATCGAACTGTTCATTCGCAGTCACAAGTGCATTTGC
AACTTCAATGCGACAGATTTGATAACTTACGTGACAGCCAGCAAGGCCAC
CCTGAAGACCCATAGGCTTTCAAATCAAACTGAGAATGAGTTTGATAAAT
ATATCCAATTAAGTGACTTCTATAAGAACTGGGTCATCAGTGAGATATGT
TCTGAGCAAATGTGCCCGATGAAACGGGCGAAATTAATATCATTTTTCAT
TCGATTGGCTTCAAAAGCTCAAATTATCGGTCACATAGATTTGTTTTTTA
GTCTCATTAGTGGATTGGATTCGATGGAAATATCCCGATTGTCTCAGACG
TGGGATCGAGTATCAAATAGCGATAAAAAGTTGTTCAAAAATCTCAAAAA
TATTCTTAATGTAACTGGTAACTTGAGACACTTGCGTATTTTGCAACAAA
AAATTACCAGCCCATTTATTCCGGTCACGGCTTTGGTTGTGAAAGATTTG
ACAATGATTGAAGAAGCCAATCCAACATATGTTGAAGGAAAAATAAACGG
GTTGCAAGTAAATAAAAATTTGATTAATTTTGACAAAATGCGAAAAATGG
CCCGACTGTCAAGAAATTTCATCAATTCGATTTGTACGTGTGATAAAGAC
AAATCAAAGCCAATAAGAAAGCATTTCTACAATTGTACCACCAAGCTAGA
AAATGAAGAAATATTAAAAGGAATGCTTCATAAAAAATTGAAAGGAAGCA
GTCGGAATAGTCAGATTGTTGCGTTGAATTACGATAGAAAGCACAGTGTA
TCAAATGCATCTGTGAAGAGCAGTTCATCCGAAAGTATTTCTCATCCGGC
ATCTCCTGTTAGAGTCAACTCGGATCTTGCGGCTTCCCAAGCATTTAATT
TTCAAAATGGATACTTATGGATAGATTTCTATTTGTCTAATTTAAATAAA
ATGGTCATAAATGATCCTATGAAATTATCAGAAATTTCATTATCGTGTGA
ACCGAATATACAACATAATCAGAGCACTTTGAAATCAAAGCAAGTAAAAT
CTCAAAAATCTCAAGATGATCTCATTTTTAATCACAATCACTTTCAAACA
AATTCAGAAGAAATTAATGATATTTCTGATAAAGCTGCTGAAATTCTTGG
ATTAAAAGAACCGAATCCTGAAATCCAAGCGGAAGATTTCTGGTCAGTTA
TTGATTAATTTCCCTCTTATTTTAAATAATCAATCAAAAATTGATCGATT
TGGACAACAATATTGATTGTGTACACGTGTAAATTGTAAATCAGATCAGC
TGGTAATCAAGATTTGTTGTACCTTTGTGAAGCCCATCATTTTATGTTGC
TGGCCTTGATTTATTTGCCACGCTTCAGATGTATGTCAAATATATAATTA
TTTTAGTAATCTGACGTTTTTATTCATTACACGTTTAATGTTGATGTTTT
ATTGTTTCTTCG
back to top

protein sequence of SMED30032801-orf-1

>SMED30032801-orf-1 ID=SMED30032801-orf-1|Name=SMED30032801-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1148bp
MEIVNNDCMLESNFRNESSTLYHLSSMPDDRVFNTDNQLYDSSICQSFEN
FNILDESPSKFIDDASDNASSSLDTEFEVLLHDYSVIKRCLQTDSCQRSD
SEVNKLSQLLESIKEFRYFNSSELEMMCQRAKLLTIDEINRKIVKKFSTK
DKWFFILNGSLRLEGETTTILIPGDFYGSILDTPDLLTEENNVYSNSDYC
DLMVISKDDLIPSQELVTKTNDEDRTIIAVYEPCINNSDLSKNFSYVLTK
GTLDVLIKKLTTKRNVHREFVEDFFVTYKIFNPDPFSIMESILSNLTSDL
NESKAKFEILLQWLSQNYKEFEKEEAKMSFLNQIIEILSMQKNQDYLLFL
YDTCTNHASARSVRCRLSFKDNIVSVPRDSDQFVFYIHNLQKEHKLLMDG
DIILAIEDYSHHAITIDLVKKLCDELKELSLIVRNDPLGYHENVVNDLSF
DTCSIYSTPSTVYSQSHSDKISDSVSISTNDSDVGSPAPTDKSPNNKKRP
SLIPNFLTSIQNGTVGRFFKNPKYYSNELKRKYSKSRPMTLVPNNRSISD
VSSLDFSTNFQRQSMSVSTISIQRFSRRIKHQRKSAGSNPEIIKSFDDKD
LDSDLYSFYRTNQKQEFPIRIYFKDIFIYRSESLHNSSNKSELKFIHIMI
KPIMPVSEVIIIALLKLNLASVSSSEFFLVEVKVDESNMMIHEKILKPAS
TNLKLKVQSKFYLKHSSFIGSSLILQKEAEKMIEEFQSFTILKLPVVEFA
IELFIRSHKCICNFNATDLITYVTASKATLKTHRLSNQTENEFDKYIQLS
DFYKNWVISEICSEQMCPMKRAKLISFFIRLASKAQIIGHIDLFFSLISG
LDSMEISRLSQTWDRVSNSDKKLFKNLKNILNVTGNLRHLRILQQKITSP
FIPVTALVVKDLTMIEEANPTYVEGKINGLQVNKNLINFDKMRKMARLSR
NFINSICTCDKDKSKPIRKHFYNCTTKLENEEILKGMLHKKLKGSSRNSQ
IVALNYDRKHSVSNASVKSSSSESISHPASPVRVNSDLAASQAFNFQNGY
LWIDFYLSNLNKMVINDPMKLSEISLSCEPNIQHNQSTLKSKQVKSQKSQ
DDLIFNHNHFQTNSEEINDISDKAAEILGLKEPNPEIQAEDFWSVID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036964RASGEF_cat_dom_sf
IPR008937Ras-like_GEF
IPR001895RASGEF_cat_dom
IPR014710RmlC-like_jellyroll
IPR000159RA_dom
IPR000651Ras-like_Gua-exchang_fac_N
IPR023578Ras_GEF_dom_sf
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001895Ras guanine-nucleotide exchange factors catalytic domainSMARTSM00147RasGEF_3coord: 741..995
e-value: 6.5E-16
score: 68.9
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPFAMPF00617RasGEFcoord: 748..943
e-value: 2.6E-30
score: 105.9
IPR001895Ras guanine-nucleotide exchange factors catalytic domainPROSITEPS50009RASGEF_CATcoord: 745..989
score: 34.268
IPR036964Ras guanine-nucleotide exchange factor catalytic domain superfamilyGENE3DG3DSA:1.10.840.10coord: 734..993
e-value: 1.3E-41
score: 144.5
NoneNo IPR availableGENE3DG3DSA:1.20.870.10coord: 212..347
e-value: 4.6E-7
score: 31.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..503
NoneNo IPR availablePANTHERPTHR23113:SF249DIZZY ISOFORM AIIcoord: 25..1078
NoneNo IPR availableCDDcd01785RA_PDZ-GEF1coord: 640..716
e-value: 4.69419E-4
score: 38.0597
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 95..211
e-value: 2.3E-5
score: 26.1
IPR008937Ras-like guanine nucleotide exchange factorPANTHERPTHR23113GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 25..1078
IPR000651Ras-like guanine nucleotide exchange factor, N-terminalPROSITEPS50212RASGEF_NTERcoord: 244..358
score: 12.029
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 622..718
score: 9.161
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 101..211
IPR023578Ras guanine nucleotide exchange factor domain superfamilySUPERFAMILYSSF48366Ras GEFcoord: 234..977