Serine/threonine-protein kinase DCLK3

Overview
NameSerine/threonine-protein kinase DCLK3
Smed IDSMED30032800
Length (bp)3366
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase DCLK3 (SMED30032800) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase DCLK3 (SMED30032800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase DCLK3 (SMED30032800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase DCLK3 (SMED30032800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30032800h1SMcG0009062 SmedASXL_014393SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30032800h1SMcG0009062 dd_Smed_v6_12689_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30032800h1SMcG0009062 dd_Smed_v4_12689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Match: DCLK3 (doublecortin like kinase 3 [Source:HGNC Symbol;Acc:HGNC:19005])

HSP 1 Score: 338.961 bits (868), Expect = 1.417e-102
Identity = 154/278 (55.40%), Postives = 210/278 (75.54%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLG--NSIRFSKPI 3194
            + EK+Y+ G  IG GNF+ VKE + + T + +A KIIDK RLK KED+++ EI I++S  HPNIVKL E +ET  +++L+ EY++ GDLFDAI E++KFPE  +A+M+ D+ +AL+++H K IVHRD+KPENLL    ++    LKL+DFGLA  +  P++ +CGTPTYVAPEILSE+GYG+EVD+WA+GVI YILLCGFPPFRSPER+Q ELF  I+ G FE++ PYWD IS  +KDL++ +L+VDP KR+T    L HPWI T G  N+++  K +
Sbjct:  351 NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLSHPNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENLLVQRNEDKSTTLKLADFGLAKHVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQV 628          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Match: DCLK3 (doublecortin like kinase 3 [Source:HGNC Symbol;Acc:HGNC:19005])

HSP 1 Score: 338.576 bits (867), Expect = 1.211e-100
Identity = 154/278 (55.40%), Postives = 210/278 (75.54%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLG--NSIRFSKPI 3194
            + EK+Y+ G  IG GNF+ VKE + + T + +A KIIDK RLK KED+++ EI I++S  HPNIVKL E +ET  +++L+ EY++ GDLFDAI E++KFPE  +A+M+ D+ +AL+++H K IVHRD+KPENLL    ++    LKL+DFGLA  +  P++ +CGTPTYVAPEILSE+GYG+EVD+WA+GVI YILLCGFPPFRSPER+Q ELF  I+ G FE++ PYWD IS  +KDL++ +L+VDP KR+T    L HPWI T G  N+++  K +
Sbjct:  520 NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLSHPNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENLLVQRNEDKSTTLKLADFGLAKHVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQV 797          

HSP 2 Score: 89.3521 bits (220), Expect = 2.071e-17
Identity = 44/111 (39.64%), Postives = 74/111 (66.67%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGS-NWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEK---MSDHS 1046
            KPR++T+++ G +      +LLN+ S Q++E LL+DIS+A GS  WK   +++++N+ G+EI+  SDFFR G  F+A+G K+P L  + ++  V EL+PN  +   ++ HS
Sbjct:   93 KPRVVTVVKLGGQRPRKITLLLNRRSVQTFEQLLADISEALGSPRWKNDRVRKLFNLKGREIRSVSDFFREGDAFIAMG-KEP-LTLKSIQVAVEELYPNKARALTLAQHS 201          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 292.738 bits (748), Expect = 3.227e-85
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   ++TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET  ++FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T    L HPW+
Sbjct:  393 YKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWV 650          

HSP 2 Score: 72.0182 bits (175), Expect = 4.152e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  I+P   +  +G                     +        + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNINPNWSVNIKGG--------------------TSRALAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 270          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 293.123 bits (749), Expect = 3.858e-85
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   ++TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET  ++FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T    L HPW+
Sbjct:  410 YKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWV 667          

HSP 2 Score: 72.4034 bits (176), Expect = 3.765e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  I+P   +  +G                     +        + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNINPNWSVNIKGG--------------------TSRALAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 270          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 292.352 bits (747), Expect = 2.326e-84
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   ++TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET  ++FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T    L HPW+
Sbjct:  393 YKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWV 650          

HSP 2 Score: 72.4034 bits (176), Expect = 3.904e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  I+P   +  +G                     +        + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNINPNWSVNIKGG--------------------TSRALAAASSVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 270          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 227.254 bits (578), Expect = 4.973e-66
Identity = 111/259 (42.86%), Postives = 163/259 (62.93%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKA-TGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y   + +G+G FS+V  A+ K+  G+ +A K IDKK LK KE+ +E EI++L+   H NIV+L + ++    V+LV E +  G+LFD I     + E  ++ ++R +  A+ ++H  G+VHRD+KPENLL   ++    + +SDFGL+  E    +   CGTP YVAPE+L ++ YG  VD+W+ GVI YILLCG+PPF   + +   LF  I  GE+E+  PYWD+IS  +KD I +++  DP  RFT  D L HPWI
Sbjct:   22 YDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFY--DESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWI 278          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 214.927 bits (546), Expect = 1.136e-61
Identity = 111/264 (42.05%), Postives = 161/264 (60.98%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE-DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEI--KEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            F   Y +   +G G FS V+    K TG  FAAKII+ K+L  ++   +E E RI +  +HPNIV+L +  +  +  +LV + +  G+LF+ I     + E+ ++  ++ I  ++ Y HS GIVHRD+KPENLL + K     +KL+DFGLA+E+   E  +   GTP Y++PE+L +  Y   VDIWA GVI YILL G+PPF   + +Q  L+  IKAG ++Y  P WD ++PE+K LI++ML V+P KR T    L  PWI
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFW--DEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 214.927 bits (546), Expect = 1.136e-61
Identity = 111/264 (42.05%), Postives = 161/264 (60.98%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE-DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEI--KEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            F   Y +   +G G FS V+    K TG  FAAKII+ K+L  ++   +E E RI +  +HPNIV+L +  +  +  +LV + +  G+LF+ I     + E+ ++  ++ I  ++ Y HS GIVHRD+KPENLL + K     +KL+DFGLA+E+   E  +   GTP Y++PE+L +  Y   VDIWA GVI YILL G+PPF   + +Q  L+  IKAG ++Y  P WD ++PE+K LI++ML V+P KR T    L  PWI
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFW--DEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 214.927 bits (546), Expect = 1.136e-61
Identity = 111/264 (42.05%), Postives = 161/264 (60.98%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE-DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEI--KEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            F   Y +   +G G FS V+    K TG  FAAKII+ K+L  ++   +E E RI +  +HPNIV+L +  +  +  +LV + +  G+LF+ I     + E+ ++  ++ I  ++ Y HS GIVHRD+KPENLL + K     +KL+DFGLA+E+   E  +   GTP Y++PE+L +  Y   VDIWA GVI YILL G+PPF   + +Q  L+  IKAG ++Y  P WD ++PE+K LI++ML V+P KR T    L  PWI
Sbjct:    8 FSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFW--DEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Match: F32D8.1 (pep chromosome:WBcel235:V:10880837:10883399:1 gene:WBGene00009326.1 transcript:F32D8.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32D8.1)

HSP 1 Score: 214.157 bits (544), Expect = 1.158e-61
Identity = 105/269 (39.03%), Postives = 163/269 (60.59%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Q+++  +D EK Y++G  IG GNFS V   ++K  G   A K ++K+ ++ K   ++ E+ +L   +H +I+ + + F T N+ F+V E+ + GDL++ I +N +  E  +A++   +  AL Y+H + +VHRD+KPENLL   K    ++KL DFGLA  I  PLY ICGTPTY APE+L E GY    DIW+ GV+ Y++L G+ PFR+P+  QT LF+ I   +     P W  IS ++KDL++ ++     +R      + HPWI
Sbjct:   59 QRVDGRQDIEKQYEIGAIIGKGNFSSVHLTRRKEDGTKCALKQVEKRAMRGKCFFVDNEVEMLSLIQHDHIISIIDAFSTENQYFIVFEHAQYGDLYETIRKNGRIEEPDAAIITLQVASALNYLHERNVVHRDVKPENLLLVDK---FSVKLCDFGLACHILGPLYRICGTPTYCAPEVLRETGYSTRCDIWSLGVVLYVMLVGYAPFRAPD--QTRLFKLIMQAKPNLDMPEWKGISLKAKDLVSRLMNKTEERRPLASQIMAHPWI 322          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 283.878 bits (725), Expect = 8.086e-82
Identity = 135/273 (49.45%), Postives = 181/273 (66.30%), Query Frame = 3
Query: 2358 ETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI--KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN 3170
            E   +    Y LG  IG GNF+ V + K + TG  +A KIIDK + K KE  I+ E+R++K   HP+I+ L    +    ++LV EY+  GDLFDAI +  +F E+QS +M+R +  A+ Y+HS GIVHRDIKPENLL  +     ++ LKL+DFGLA E+ + LY +CGTPTYVAPEIL E GYG+++D+WA+G+I YILLCGFPPF +P+  Q  LF+ I +G +E+  PYW +I    +DLI NML  DP  RFT  D L H W  T+GN
Sbjct:  468 ELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW--TIGN 738          

HSP 2 Score: 81.6481 bits (200), Expect = 2.523e-15
Identity = 76/279 (27.24%), Postives = 117/279 (41.94%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGGQVQDIDDLEHRNIYIC-CGQESLKTYDYDTKYFELIHKGHLHN--HNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGD------KDPNLNQEEVRNI 1001
            RK  R+ F  NG+R + G  + ++  RY     L +DLT+       IP  VR IY+  G ++  +D+LE    Y+C C  E+ K  +Y+T   + +    L N   NSH      P     N     S   P    G                        +RL +R              PRI+T+IR+G KP    ++LLNK +S S++ +L+ I+           +++++ + G  + + SDFF S   F A G       +D  L  EE R I
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGS-QPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGT---------------GNGSPLIASRLSDRV---------TVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVV--RLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAEDFKLEAEEQRAI 406          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 283.878 bits (725), Expect = 8.086e-82
Identity = 135/273 (49.45%), Postives = 181/273 (66.30%), Query Frame = 3
Query: 2358 ETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI--KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN 3170
            E   +    Y LG  IG GNF+ V + K + TG  +A KIIDK + K KE  I+ E+R++K   HP+I+ L    +    ++LV EY+  GDLFDAI +  +F E+QS +M+R +  A+ Y+HS GIVHRDIKPENLL  +     ++ LKL+DFGLA E+ + LY +CGTPTYVAPEIL E GYG+++D+WA+G+I YILLCGFPPF +P+  Q  LF+ I +G +E+  PYW +I    +DLI NML  DP  RFT  D L H W  T+GN
Sbjct:  468 ELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLACEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW--TIGN 738          

HSP 2 Score: 81.6481 bits (200), Expect = 2.523e-15
Identity = 76/279 (27.24%), Postives = 117/279 (41.94%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGGQVQDIDDLEHRNIYIC-CGQESLKTYDYDTKYFELIHKGHLHN--HNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGD------KDPNLNQEEVRNI 1001
            RK  R+ F  NG+R + G  + ++  RY     L +DLT+       IP  VR IY+  G ++  +D+LE    Y+C C  E+ K  +Y+T   + +    L N   NSH      P     N     S   P    G                        +RL +R              PRI+T+IR+G KP    ++LLNK +S S++ +L+ I+           +++++ + G  + + SDFF S   F A G       +D  L  EE R I
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIYNLCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGS-QPLSNLPLSNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACGGGT---------------GNGSPLIASRLSDRV---------TVVHPRIVTLIRSGTKPRRIMRLLLNKRNSPSFDHVLTAITQVV--RLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTAEDFKLEAEEQRAI 406          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 246.128 bits (627), Expect = 3.923e-72
Identity = 130/290 (44.83%), Postives = 181/290 (62.41%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKAT-GKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTE 3212
            ++L      E+ Y L   +G+G FSEV+ A+ K + G+ FA KIIDKK LK KE+ +E EIR+L+   HPNIV+L E +E  +KV+LV E +  G+LFD I E   + E  ++ ++R I  A+ Y+H +G+VHRD+KPENLL    +    + +SDFGL+ +E    +   CGTP YVAPE+L+++ YG  VD+W+ GVI YILLCG+PPF   + N   LF  I  G+FE+  PYWDEIS  +K  I N++ V   KR+T    L H WI   GN    S+ I   V+E
Sbjct:   19 KELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFY--DENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWIS--GNEAS-SRNIHGTVSE 303          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 236.113 bits (601), Expect = 2.397e-68
Identity = 131/305 (42.95%), Postives = 182/305 (59.67%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKAT-GKPFAAKIIDKKRLKDKEDLIEEEIRILK---------SC------EHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTE 3212
            ++L      E+ Y L   +G+G FSEV+ A+ K + G+ FA KIIDKK LK KE+ +E EIR+L+          C       HPNIV+L E +E  +KV+LV E +  G+LFD I E   + E  ++ ++R I  A+ Y+H +G+VHRD+KPENLL    +    + +SDFGL+ +E    +   CGTP YVAPE+L+++ YG  VD+W+ GVI YILLCG+PPF   + N   LF  I  G+FE+  PYWDEIS  +K  I N++ V   KR+T    L H WI   GN    S+ I   V+E
Sbjct:   19 KELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFY--DENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWIS--GNEAS-SRNIHGTVSE 318          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 236.113 bits (601), Expect = 2.397e-68
Identity = 131/305 (42.95%), Postives = 182/305 (59.67%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKAT-GKPFAAKIIDKKRLKDKEDLIEEEIRILK---------SC------EHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTE 3212
            ++L      E+ Y L   +G+G FSEV+ A+ K + G+ FA KIIDKK LK KE+ +E EIR+L+          C       HPNIV+L E +E  +KV+LV E +  G+LFD I E   + E  ++ ++R I  A+ Y+H +G+VHRD+KPENLL    +    + +SDFGL+ +E    +   CGTP YVAPE+L+++ YG  VD+W+ GVI YILLCG+PPF   + N   LF  I  G+FE+  PYWDEIS  +K  I N++ V   KR+T    L H WI   GN    S+ I   V+E
Sbjct:   19 KELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFY--DENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWIS--GNEAS-SRNIHGTVSE 318          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 302.368 bits (773), Expect = 6.969e-89
Identity = 148/302 (49.01%), Postives = 202/302 (66.89%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISK--NTS 3281
            Y++G  IG GNF+ VKE  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++VM+ D+  AL Y+H   IVHRDIKPENLL C   NG  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  E+  P+WD IS  +K+LI +ML V+   R+T  D L HPW+             +D   E  +++++   + K  N++ K  NTS
Sbjct:  392 YKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWV------------TEDAAMENNMKMEVAGKLKKHFNSVQKQSNTS 681          

HSP 2 Score: 101.293 bits (251), Expect = 2.644e-21
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            S++  +  +++ + +T +     +K K+V F  NG++ F G + +++ +R+   + LL +LT+  S+ +  P GVR IY  +GG+ +  +DDL     Y+C   E  +  DY                        NP  +  N  +  S   P                          +  N L ER  K  I       KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA        +++R+Y ++GK+I    DFF     F+A G
Sbjct:   43 SAHCSFYRTRTLQSLTSE-----KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNV--------------------NPN-WSVNVKTGASRSMPSL-----------------------TATKNELRERESKDYI-------KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 303.138 bits (775), Expect = 7.665e-89
Identity = 148/302 (49.01%), Postives = 202/302 (66.89%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISK--NTS 3281
            Y++G  IG GNF+ VKE  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++VM+ D+  AL Y+H   IVHRDIKPENLL C   NG  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  E+  P+WD IS  +K+LI +ML V+   R+T  D L HPW+             +D   E  +++++   + K  N++ K  NTS
Sbjct:  420 YKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWV------------TEDAAMENNMKMEVAGKLKKHFNSVQKQSNTS 709          

HSP 2 Score: 101.293 bits (251), Expect = 2.257e-21
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            S++  +  +++ + +T +     +K K+V F  NG++ F G + +++ +R+   + LL +LT+  S+ +  P GVR IY  +GG+ +  +DDL     Y+C   E  +  DY                        NP  +  N  +  S   P                          +  N L ER  K  I       KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA        +++R+Y ++GK+I    DFF     F+A G
Sbjct:   43 SAHCSFYRTRTLQSLTSE-----KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNV--------------------NPN-WSVNVKTGASRSMPSL-----------------------TATKNELRERESKDYI-------KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 302.368 bits (773), Expect = 7.687e-89
Identity = 148/302 (49.01%), Postives = 202/302 (66.89%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISK--NTS 3281
            Y++G  IG GNF+ VKE  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++VM+ D+  AL Y+H   IVHRDIKPENLL C   NG  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  E+  P+WD IS  +K+LI +ML V+   R+T  D L HPW+             +D   E  +++++   + K  N++ K  NTS
Sbjct:  401 YKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWV------------TEDAAMENNMKMEVAGKLKKHFNSVQKQSNTS 690          

HSP 2 Score: 100.908 bits (250), Expect = 2.816e-21
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            S++  +  +++ + +T +     +K K+V F  NG++ F G + +++ +R+   + LL +LT+  S+ +  P GVR IY  +GG+ +  +DDL     Y+C   E  +  DY                        NP  +  N  +  S   P                          +  N L ER  K  I       KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA        +++R+Y ++GK+I    DFF     F+A G
Sbjct:   43 SAHCSFYRTRTLQSLTSE-----KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNV--------------------NPN-WSVNVKTGASRSMPSL-----------------------TATKNELRERESKDYI-------KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 302.368 bits (773), Expect = 7.687e-89
Identity = 148/302 (49.01%), Postives = 202/302 (66.89%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISK--NTS 3281
            Y++G  IG GNF+ VKE  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++VM+ D+  AL Y+H   IVHRDIKPENLL C   NG  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  E+  P+WD IS  +K+LI +ML V+   R+T  D L HPW+             +D   E  +++++   + K  N++ K  NTS
Sbjct:  401 YKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWV------------TEDAAMENNMKMEVAGKLKKHFNSVQKQSNTS 690          

HSP 2 Score: 100.908 bits (250), Expect = 2.816e-21
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            S++  +  +++ + +T +     +K K+V F  NG++ F G + +++ +R+   + LL +LT+  S+ +  P GVR IY  +GG+ +  +DDL     Y+C   E  +  DY                        NP  +  N  +  S   P                          +  N L ER  K  I       KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA        +++R+Y ++GK+I    DFF     F+A G
Sbjct:   43 SAHCSFYRTRTLQSLTSE-----KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNV--------------------NPN-WSVNVKTGASRSMPSL-----------------------TATKNELRERESKDYI-------KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 302.368 bits (773), Expect = 1.215e-88
Identity = 148/302 (49.01%), Postives = 202/302 (66.89%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISK--NTS 3281
            Y++G  IG GNF+ VKE  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++VM+ D+  AL Y+H   IVHRDIKPENLL C   NG  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  E+  P+WD IS  +K+LI +ML V+   R+T  D L HPW+             +D   E  +++++   + K  N++ K  NTS
Sbjct:  417 YKIGKVIGDGNFAVVKECVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLIEEVDTPAELYLVMELVKGGDLFDAITSSTKYTEKDASVMVFDLAAALKYLHRMCIVHRDIKPENLLVCEYPNGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILLGHLEFPSPFWDNISDSAKELIGHMLQVNVEARYTAEDVLSHPWV------------TEDAAMENNMKMEVAGKLKKHFNSVQKQSNTS 706          

HSP 2 Score: 100.908 bits (250), Expect = 2.951e-21
Identity = 74/280 (26.43%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            S++  +  +++ + +T +     +K K+V F  NG++ F G + +++ +R+   + LL +LT+  S+ +  P GVR IY  +GG+ +  +DDL     Y+C   E  +  DY                        NP  +  N  +  S   P                          +  N L ER  K  I       KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA        +++R+Y ++GK+I    DFF     F+A G
Sbjct:   43 SAHCSFYRTRTLQSLTSE-----KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNV--------------------NPN-WSVNVKTGASRSMPSL-----------------------TATKNELRERESKDYI-------KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Match: ovch1 (ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526])

HSP 1 Score: 316.235 bits (809), Expect = 2.090e-93
Identity = 146/265 (55.09%), Postives = 199/265 (75.09%), Query Frame = 3
Query: 2382 YYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIK-NGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNS 3173
            YY++G +IG GNF+ VK  +     + +A KIIDK +L+ KED+IE E+RI+K   HPNIVKL   +ET  +++L+ EYI+ GDLFD I E+IKF E  +A+M+ D+  AL YIHSK IVHRD+KPENLL     +G  +LKL+DFGLA+    P++ +CGTPTYVAPEILSE+GYG++VD+WA+GVI YILLCGFPPFRSP+RNQ ELF+ I++GE+E++ PYWD IS E KDLI+ +L+++P  R++    L H W+ + G +
Sbjct:  428 YYEIGRTIGDGNFAVVKVCRPWNENQEYAMKIIDKSKLRGKEDIIENEVRIIKHLSHPNIVKLFSDYETEKEIYLILEYIRGGDLFDVITESIKFTEHDAALMLIDLCEALKYIHSKHIVHRDLKPENLLVQHNPDGSKSLKLADFGLAIYATGPIFTVCGTPTYVAPEILSEKGYGLKVDMWATGVILYILLCGFPPFRSPDRNQEELFQIIQSGEYEFLPPYWDHISEEVKDLISKLLVLNPEIRYSAKCVLQHSWVTSRGQT 692          

HSP 2 Score: 83.9593 bits (206), Expect = 8.486e-16
Identity = 47/123 (38.21%), Postives = 73/123 (59.35%), Query Frame = 3
Query:  702 IAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFG-SNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSAD-DSRL 1064
            I   N   KPRI+T+++ G  P     +LLNK S Q++E L++DIS+A G   WK   ++++YN+ GKEI+  SDFFR    F+A+G +   L  +   ++  EL+P  E+ +  S D D +L
Sbjct:   30 IHSENSPVKPRIVTVVKPGSHPLKKITLLLNKRSVQTFEQLVADISEALGFPRWKNDRVRKLYNLRGKEIRSISDFFRGDDIFIALGRE--KLTTKCTESVFNELYP--ERSAKKSKDQDGKL 148          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 280.411 bits (716), Expect = 3.794e-84
Identity = 136/286 (47.55%), Postives = 193/286 (67.48%), Query Frame = 3
Query: 2319 LSQRIVPVLAQQLETDEDFE------KYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            L    +PV+ +    DE F+      + Y++G +IG GNF+ VKE  +++TG+ +A KII+K + + KE +I+ E+ IL+  +HPNIV L E+ + P++++LV E +K GDLFDAI    K+ E  +  M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G  ++  PYWD +S  +K+LI  ML VD  +R++ L  L HPW+
Sbjct:   31 LKATYLPVICKADIMDEGFQVPVSISERYKVGRTIGDGNFAIVKECIERSTGREYALKIINKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMSAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATVVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITMMLQVDVDQRYSALKVLEHPWV 316          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 280.026 bits (715), Expect = 8.297e-84
Identity = 135/279 (48.39%), Postives = 188/279 (67.38%), Query Frame = 3
Query: 2322 SQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            S R VPV            + Y++G +IG GNF+ VKE  +++TG+ +A KII+K + + KE +I+ E+ IL+  +HPNIV L E+ + P++++LV E +K GDLFDAI    K+ E  +  M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G  ++  PYWD +S  +K+LI  ML VD  +R++ L  L HPW+
Sbjct:   53 SARSVPV---------SISERYKVGRTIGDGNFAIVKECIERSTGREYALKIINKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMSAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATVVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITMMLQVDVDQRYSALKVLEHPWV 322          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 277.715 bits (709), Expect = 1.204e-83
Identity = 130/258 (50.39%), Postives = 182/258 (70.54%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G +IG GNF+ VKE  +++TG+ +A KII+K + + KE +I+ E+ IL+  +HPNIV L E+ + P++++LV E +K GDLFDAI    K+ E  +  M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G  ++  PYWD +S  +K+LI  ML VD  +R++ L  L HPW+
Sbjct:   50 YKVGRTIGDGNFAIVKECIERSTGREYALKIINKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMSAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATVVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITMMLQVDVDQRYSALKVLEHPWV 307          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 280.026 bits (715), Expect = 1.262e-83
Identity = 130/258 (50.39%), Postives = 182/258 (70.54%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G +IG GNF+ VKE  +++TG+ +A KII+K + + KE +I+ E+ IL+  +HPNIV L E+ + P++++LV E +K GDLFDAI    K+ E  +  M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G  ++  PYWD +S  +K+LI  ML VD  +R++ L  L HPW+
Sbjct:   83 YKVGRTIGDGNFAIVKECIERSTGREYALKIINKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDMPSELYLVMELVKGGDLFDAITSTNKYTERDANGMLYNLMSAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATVVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGHMDFPSPYWDNVSDSAKELITMMLQVDVDQRYSALKVLEHPWV 340          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Match: Dclk3 (doublecortin-like kinase 3 [Source:MGI Symbol;Acc:MGI:3039580])

HSP 1 Score: 343.969 bits (881), Expect = 5.309e-103
Identity = 154/269 (57.25%), Postives = 208/269 (77.32%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNS 3173
            D EK+Y +G  IG GNF+ VKE + + T + +A K+IDK +LK KED+++ EI I++S  HPNIVKL E +ET  +++L+ EY++ GDLFDAI EN+KFPE ++AVM+ D+ +AL+++H K IVHRD+KPENLL    ++  I LKL+DFGLA  +  P++ +CGTPTYVAPEILSE+GYG+EVD+WA+GVI YILLCGFPPFRSPER+Q ELF  I+ G+FE++ PYWD IS  +KDL+ N+L VDP KR+T    L HPWI  +G++
Sbjct:  509 DVEKHYDIGGVIGDGNFATVKECRHRETKQAYAMKMIDKSQLKGKEDIVDSEILIIQSLSHPNIVKLHEVYETEAEIYLIMEYVQGGDLFDAIVENVKFPEPEAAVMITDLCKALVHMHDKNIVHRDVKPENLLVQRNEDKSITLKLADFGLAKYVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDAAKDLVRNLLEVDPKKRYTAEQVLQHPWIEMVGHT 777          

HSP 2 Score: 85.8853 bits (211), Expect = 1.994e-16
Identity = 39/105 (37.14%), Postives = 69/105 (65.71%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFG-SNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMS 1037
            KPR++T+++ G +P     +LLN+ S Q++E LLSDIS+A G   WK   +++++ + G+E++  SDFFR G  F+A+G K+P L  + ++  + EL+P    ++
Sbjct:   95 KPRVVTVVKLGGQPLRKATLLLNRRSVQTFEQLLSDISEALGFPRWKNDRVRKLFTLKGREVKSVSDFFREGDAFIAMG-KEP-LTLKSIQLAMEELYPKNRALA 197          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 293.123 bits (749), Expect = 2.782e-85
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   + TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET   +FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+HS  IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VD+WA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T  + L HPW+
Sbjct:  409 YRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWV 666          

HSP 2 Score: 73.1738 bits (178), Expect = 1.606e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  ++P   +  +G                          L   + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNVNPNWSVNIKGG---------------------TTRTLAVASAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 292.738 bits (748), Expect = 1.055e-84
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   + TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET   +FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+HS  IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VD+WA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T  + L HPW+
Sbjct:  392 YRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWV 649          

HSP 2 Score: 73.1738 bits (178), Expect = 1.538e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  ++P   +  +G                          L   + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNVNPNWSVNIKGG---------------------TTRTLAVASAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 292.738 bits (748), Expect = 1.066e-84
Identity = 139/258 (53.88%), Postives = 180/258 (69.77%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   + TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET   +FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+HS  IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VD+WA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T  + L HPW+
Sbjct:  393 YRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWV 650          

HSP 2 Score: 73.1738 bits (178), Expect = 1.501e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  ++P   +  +G                          L   + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNVNPNWSVNIKGG---------------------TTRTLAVASAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Match: Dclk1 (doublecortin-like kinase 1 [Source:MGI Symbol;Acc:MGI:1330861])

HSP 1 Score: 280.796 bits (717), Expect = 1.444e-84
Identity = 129/258 (50.00%), Postives = 183/258 (70.93%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G +IG GNF+ VKE  +++T + +A KII K + + KE +I+ E+ IL+  +HPNIV L E+ + P +++LV E +K GDLFDAI    K+ E  ++ M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G+ ++  PYWD +S  +K+LIN ML+V+  +RF+ +  L HPW+
Sbjct:   83 YKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEHPWV 340          
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Match: sp|Q8BWQ5|DCLK3_MOUSE (Serine/threonine-protein kinase DCLK3 OS=Mus musculus OX=10090 GN=Dclk3 PE=1 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 3.714e-102
Identity = 154/269 (57.25%), Postives = 208/269 (77.32%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNS 3173
            D EK+Y +G  IG GNF+ VKE + + T + +A K+IDK +LK KED+++ EI I++S  HPNIVKL E +ET  +++L+ EY++ GDLFDAI EN+KFPE ++AVM+ D+ +AL+++H K IVHRD+KPENLL    ++  I LKL+DFGLA  +  P++ +CGTPTYVAPEILSE+GYG+EVD+WA+GVI YILLCGFPPFRSPER+Q ELF  I+ G+FE++ PYWD IS  +KDL+ N+L VDP KR+T    L HPWI  +G++
Sbjct:  509 DVEKHYDIGGVIGDGNFATVKECRHRETKQAYAMKMIDKSQLKGKEDIVDSEILIIQSLSHPNIVKLHEVYETEAEIYLIMEYVQGGDLFDAIVENVKFPEPEAAVMITDLCKALVHMHDKNIVHRDVKPENLLVQRNEDKSITLKLADFGLAKYVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQVGQFEFLSPYWDNISDAAKDLVRNLLEVDPKKRYTAEQVLQHPWIEMVGHT 777          

HSP 2 Score: 85.8853 bits (211), Expect = 1.394e-15
Identity = 39/105 (37.14%), Postives = 69/105 (65.71%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFG-SNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMS 1037
            KPR++T+++ G +P     +LLN+ S Q++E LLSDIS+A G   WK   +++++ + G+E++  SDFFR G  F+A+G K+P L  + ++  + EL+P    ++
Sbjct:   95 KPRVVTVVKLGGQPLRKATLLLNRRSVQTFEQLLSDISEALGFPRWKNDRVRKLFTLKGREVKSVSDFFREGDAFIAMG-KEP-LTLKSIQLAMEELYPKNRALA 197          
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Match: sp|Q9C098|DCLK3_HUMAN (Serine/threonine-protein kinase DCLK3 OS=Homo sapiens OX=9606 GN=DCLK3 PE=2 SV=2)

HSP 1 Score: 338.961 bits (868), Expect = 6.804e-102
Identity = 154/278 (55.40%), Postives = 210/278 (75.54%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLG--NSIRFSKPI 3194
            + EK+Y+ G  IG GNF+ VKE + + T + +A KIIDK RLK KED+++ EI I++S  HPNIVKL E +ET  +++L+ EY++ GDLFDAI E++KFPE  +A+M+ D+ +AL+++H K IVHRD+KPENLL    ++    LKL+DFGLA  +  P++ +CGTPTYVAPEILSE+GYG+EVD+WA+GVI YILLCGFPPFRSPER+Q ELF  I+ G FE++ PYWD IS  +KDL++ +L+VDP KR+T    L HPWI T G  N+++  K +
Sbjct:  351 NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILIIQSLSHPNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMDLCKALVHMHDKSIVHRDLKPENLLVQRNEDKSTTLKLADFGLAKHVVRPIFTVCGTPTYVAPEILSEKGYGLEVDMWAAGVILYILLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWIETAGKTNTVKRQKQV 628          
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Match: sp|Q5MPA9|DCLK2_RAT (Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus OX=10116 GN=Dclk2 PE=1 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 2.114e-84
Identity = 138/258 (53.49%), Postives = 181/258 (70.16%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   ++TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET  ++FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VD+WA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T  + L HPW+
Sbjct:  409 YRIGKVIGDGNFAVVKECMDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETTTELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLASALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWV 666          

HSP 2 Score: 74.7146 bits (182), Expect = 3.317e-12
Identity = 63/258 (24.42%), Postives = 108/258 (41.86%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  ++P   +  +G                          L   + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGV-------------------RTIYTVDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNVNPNWSVNIKGG---------------------TTRTLAVASAKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 269          
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Match: sp|D2I3C6|DCLK2_AILME (Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca OX=9646 GN=DCLK2 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 3.791e-84
Identity = 139/258 (53.88%), Postives = 181/258 (70.16%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE   ++TGK FA KIIDK +   KE LIE E+ IL+  +HPNI+ L E+ ET  ++FLV E +K GDLFDAI  + K+ E   + M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I AG+ E+  PYWD I+  +K+LI+ ML V+   R T  + L HPW+
Sbjct:  411 YKIGKVIGDGNFAVVKECMDRSTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWV 668          

HSP 2 Score: 72.7886 bits (177), Expect = 1.538e-11
Identity = 63/258 (24.42%), Postives = 110/258 (42.64%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADST--ISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            +K K+  F  NG+R F G + +I+ +R+   + LL +LT+  S+ +  P GV                   R IY   G   + + D             L    S++     P   F   D T  I+P   +  +G     +++                      + K  + E+    KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI++A         ++R+  +DGK++    DFF     F+A G
Sbjct:   69 KKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLMELTRSLSDNVNLPQGV-------------------RTIYTIDGSRKVTSLD------------ELLEGESYVCASNEP---FRKVDYTKNINPNWSVNIKGGTARALAAPS--------------------SVKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACG 270          
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Match: sp|O08875|DCLK1_RAT (Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus OX=10116 GN=Dclk1 PE=1 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 4.122e-84
Identity = 133/273 (48.72%), Postives = 190/273 (69.60%), Query Frame = 3
Query: 2358 ETDEDFE------KYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            E+DE F+      + Y++G +IG GNF+ VKE  +++T + +A KII K + + KE +I+ E+ IL+  +HPNIV L E+ + P +++LV E +K GDLFDAI    K+ E  ++ M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G+ ++  PYWD +S  +K+LIN ML+V+  +RF+ +  L HPW+
Sbjct:   68 ESDEGFQIPATITERYKVGRTIGDGNFAVVKECIERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEHPWV 340          
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Match: K1S2X4 (Serine/threonine-protein kinase DCLK3 OS=Crassostrea gigas OX=29159 GN=CGI_10028458 PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 1.606e-110
Identity = 181/352 (51.42%), Postives = 247/352 (70.17%), Query Frame = 3
Query: 2226 PRSETVNLFMKGKSFQKPTRTK---------KQSSVLQNPLSQRIV--PVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIR--FSKPIKDVVTETRVELQMET 3239
            PR +  +   K KS + P  TK         K+ +  +     +IV    L +Q+  DE     Y LG ++G GNF+ V+++K KA    +A K+IDK +L+ KE ++E EI I+K C H NIVKL E++ET +K++LV E +K GDLFDAI +++KF E  SA M++D+  AL Y+HS+ IVHRD+KPENLL    K+G I+LKL+DFGLA+E+KEP++ +CGTPTYVAPEILSE GYG+EVD+WA GVI YILLCGFPPFRSP+RNQTELFEFIKAGE+E++ PYWD ISP +KDLI ++L+VD  KR+T ++ L HPWI+  G+  R   S  + ++   TR EL+++ 
Sbjct:  419 PRDQKADAVTKEKSPRDPKATKEKTDPALKDKEKAEKKRKSKSKIVRKSKLERQVSGDEHITNKYDLGRTLGDGNFAIVRQSKLKAGSGEYAMKVIDKPKLRGKEHMVENEIEIMKDCHHHNIVKLYEEYETSDKIYLVMELVKGGDLFDAITQSVKFGEVDSARMVKDLCNALFYLHSRSIVHRDLKPENLLVHRNKDGSISLKLADFGLAMEVKEPIFTVCGTPTYVAPEILSEIGYGLEVDMWAVGVITYILLCGFPPFRSPDRNQTELFEFIKAGEYEFLSPYWDNISPYAKDLIEHLLVVDKKKRYTAIETLSHPWILLNGDMSRPPESSKLDEMRKNTRKELELQA 770          

HSP 2 Score: 97.4413 bits (241), Expect = 9.596e-17
Identity = 53/148 (35.81%), Postives = 91/148 (61.49%), Query Frame = 3
Query:  714 NMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASY 1157
            N+  KP+++TI+R G KP +  KILLN+ S QS+E L++DIS+AFG  +K   ++++++I G+E+Q  SDFFR    F+ +G +  +L + ++ +IV EL+P+    S  +    R ++ NK K +N+     +T  DH     D+ +
Sbjct:   91 NIPLKPKVVTIVRNGHKPRNNVKILLNRRSVQSFEQLMADISEAFGPKYKNNKVKKLFSIRGREVQGISDFFRDDDVFIGVGGE--SLTETDIVDIVEELYPD----SSMAKSILRELERNKRKRHNL---AKQTQADHDADKRDSGF 229          
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Match: A0A210QQR8 (Serine/threonine-protein kinase DCLK3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04931 PE=4 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.823e-107
Identity = 172/297 (57.91%), Postives = 226/297 (76.09%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN--SIRFSKPIKDVVTETRVELQ 3230
            +Q+  D      Y LG ++G GNF+ VK+A  K T   FA KIIDK +LK KE ++E EI I+K C+HPNIVKL E++ET +K++LV E +K GDLFDAI +++KF E  SA M++D+  AL Y+HS+ IVHRD+KPENLL    K+  I LKL+DFGLA+++K+P+Y +CGTPTYVAPEILSE GYG+EVD+WA GVICYILLCGFPPFRS +RNQTELFEFIKAGE+E++ PYWD+IS  +KDLI ++LIV+  KRFT +D L HPWI+  G+   I  +  ++ + T+TR EL+
Sbjct:  539 RQVSGDSHILSKYDLGKTLGDGNFAIVKQATLKNTKNEFAMKIIDKAKLKGKEHMVENEIEIMKDCQHPNIVKLYEEYETIDKIYLVMELVKGGDLFDAITQSVKFGEVDSAHMVKDLCNALFYLHSRSIVHRDLKPENLLVHRNKDSTITLKLADFGLAMDVKDPIYTVCGTPTYVAPEILSEIGYGLEVDMWAVGVICYILLCGFPPFRSADRNQTELFEFIKAGEYEFLSPYWDQISRGAKDLIEHLLIVEKKKRFTAIDTLSHPWIMYNGDMGKITDNAELEKLKTKTRNELE 835          

HSP 2 Score: 140.198 bits (352), Expect = 5.004e-30
Identity = 102/307 (33.22%), Postives = 156/307 (50.81%), Query Frame = 3
Query:  153 SQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYF--SNFIPTGVRRIYDRNGGQ-VQDIDDLEHRNIYICCGQESLK-TYDYDTKYFE--LIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKS----------KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAEL-FPN 1022
            SQ+ +DI D   ++LR+P+++ F VNG+  F GK L+ITP+RY   NDLL+DLT     S  +P GVR+IY  +GG+ V +I+ L    IY+  G E+ K    Y  +  E   +  G   N N+       P  +    D  +       YRG R Y           +             R Y       N  S          KP+++TI+R G +P +  KILLN+ S QS+E L+ D+S+AFG  ++   ++++Y I G+E+Q  SDFFR    FVA+G +   L+  ++ +I+ E+ FP+
Sbjct:   18 SQTHKDIVDTKMKDLRRPRKIRFYVNGDGYFKGKKLNITPHRYSTFNDLLNDLTGKLPSSVNLPYGVRQIYTPSGGRRVTEIEGLADGQIYVLAGFEAFKPQVRYGQQVLEPWSMEVGR-RNLNAR------PHNHDIEGDGAMYGHGS--YRGGRSYGAFQPGPYLQKSTG----------HRRYPGAFGTANKGSYLQNADSGQVKPKVITIVRNGARPRNNIKILLNRRSVQSFEQLMLDVSEAFGPKYRNNKMEKLYTIRGREVQGISDFFRDENVFVAVGIE--KLSGGDLIDIIEEIDFPD 303          
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Match: F6SUL1 (Protein kinase domain-containing protein OS=Ciona intestinalis OX=7719 GN=LOC100181877 PE=3 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 8.748e-107
Identity = 158/268 (58.96%), Postives = 207/268 (77.24%), Query Frame = 3
Query: 2370 DFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGN 3170
            + E  Y++G +IG GNF+ VKE + + T   FA KIIDK +LK KED+IE EI I+K+C HPNIV+L E+FET N+++LV EY+K GDLFDAI E++KF E  +A M+ D+  AL ++HSK I+HRD+KPENLL S  K+G + LKL+DFGLA+E+ EP+Y +CGTPTYVAPEIL+E GYG+EVD+WA+GVI YILLCGFPPFRS ER+Q ELFE I+ G++E++ PYWD IS  +KDLI  +L+VD  +R+T    L HPWI + G 
Sbjct:    5 NIEARYEIGKTIGDGNFAVVKECRLRNTESEFAMKIIDKSKLKGKEDMIENEIAIMKNCHHPNIVRLIEEFETENEIYLVLEYVKGGDLFDAITESVKFTERDAANMVADLSEALAFLHSKNIIHRDLKPENLLVSRNKDGSMTLKLADFGLAMEVTEPIYTVCGTPTYVAPEILAETGYGLEVDMWATGVITYILLCGFPPFRSLERDQEELFEIIQLGDYEFLSPYWDNISEAAKDLIQRLLVVDTKRRYTAEQVLSHPWIQSEGT 272          
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Match: R7TC90 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_217544 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 3.104e-105
Identity = 161/279 (57.71%), Postives = 216/279 (77.42%), Query Frame = 3
Query: 2343 LAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSI 3176
            L +Q+ + +     Y +  ++G GNF+ VK+ + K T   +A KIIDK +LK KE +IE EI I+K C   NIV+L E+FET + ++L+ E +K GDLFDAI +++KFPE +S+ M+RD+  AL Y+HS+ IVHRD+KPENL+ C  K+G ++LKL+DFGLA+E+K+ ++ +CGTPTYVAPEILSE GYG+EVD+WA GVI YILLCGFPPFRSP+RNQTELFEFIKAGE+E++ PYWD+IS  +KDLI+ +L+VD  KRFT +D L H WIIT G S+
Sbjct:  489 LERQVSSVQHVMDRYDVSKTLGDGNFAIVKQCQLKETKADYAMKIIDKAKLKGKEQMIENEIEIMKKCNQANIVRLIEEFETKDDIYLIMELVKGGDLFDAITQSVKFPEVKSSSMVRDLANALHYLHSREIVHRDLKPENLMVCHNKDGSMSLKLADFGLAMEVKQDIFTVCGTPTYVAPEILSETGYGLEVDMWALGVISYILLCGFPPFRSPDRNQTELFEFIKAGEYEFLSPYWDKISRSAKDLISRLLVVDRKKRFTAIDTLSHAWIITNGGSL 767          

HSP 2 Score: 93.2041 bits (230), Expect = 2.258e-15
Identity = 41/105 (39.05%), Postives = 69/105 (65.71%), Query Frame = 3
Query:  708 ETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPN 1022
            + N+  KP+++T++R   KP +  KILLN+ S QSYE L+ DI++AFG  WK   +++++ + G+E++  SDFFR    F+ IG++   L+   V  I+ EL+P+
Sbjct:  139 QENIPMKPKVITVVRNSGKPRTSVKILLNRRSVQSYEQLMKDITEAFGPKWKNNKMRKLFTVRGREVKGISDFFREDDVFIGIGNE--QLSSGHVAEILEELYPD 241          
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Match: A0A1I8IN06 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 5.824e-104
Identity = 150/270 (55.56%), Postives = 205/270 (75.93%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIR 3179
            FE+Y  LG ++G GNF+ V+   K+ +G  +AAK+IDKK+L+ KE ++  E+RI++ C HPNIV+L +++ET  +++L+ E +K GDLFDAI + +KF E Q++ M+ DI  AL Y+HS+ IVHRD+KPENLL    K+  I+LKL DFGLA+E++E ++ +CGTPTYVAPEILSE GYG+EVD+WA GVI YILLCGFPPFRS +R Q+ELF+ IK G FEY+ PYWD +S  +KDLIN +L+VD   R T +D LCH W+++ G S R
Sbjct:    2 FERY-DLGRTLGDGNFAVVRACVKRDSGNEYAAKVIDKKKLRGKEHMVLNEVRIMRLCRHPNIVRLVDEYETKAEIYLIMELVKGGDLFDAISQVVKFNEIQASSMVADIAGALHYLHSRRIVHRDLKPENLLVYRSKDNKISLKLGDFGLAMEVEEAIFTVCGTPTYVAPEILSETGYGLEVDMWALGVIAYILLCGFPPFRSRDRRQSELFQMIKTGTFEYLSPYWDHVSAPAKDLINRLLVVDKAARLTAIDVLCHAWVLSRGGSQR 270          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Match: ENSAMXT00000039497.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:8818577:8831816:1 gene:ENSAMXG00000040052.1 transcript:ENSAMXT00000039497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 298.901 bits (764), Expect = 1.060e-87
Identity = 140/268 (52.24%), Postives = 187/268 (69.78%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWII---TLGNSI 3176
            Y++G  IG GNF+ VKE  ++ATG+ +A KIIDK +   KE LI  E+ IL+   HP+I+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++ M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q ELFE I  G  E+  PYWD ++P +KDLI  ML V+   R+T  + L HPW++   TL N++
Sbjct:  384 YKVGKVIGDGNFAVVKECVERATGQEYALKIIDKAKCSGKEHLIANEVAILRRVRHPSIIMLIEEVDTPTELYLVMELVKGGDLFDAITSSTKYTERDASAMVYNLTGALRYLHRMCIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSERNQQEELFEQILLGRLEFPAPYWDNVTPSAKDLIGKMLQVNVSARYTAEEVLSHPWVLDDSTLENNV 651          

HSP 2 Score: 68.9366 bits (167), Expect = 2.490e-11
Identity = 28/78 (35.90%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            KP+++T+IR+G+KP    +ILLNK ++ S++ +L+DI++A        +++++Y +DGK++    DFF     F+A G
Sbjct:  195 KPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLADITEAI--KLDSGAVKKLYTLDGKQLTSLQDFFGDDDVFIACG 270          

HSP 3 Score: 58.9214 bits (141), Expect = 2.400e-8
Identity = 32/104 (30.77%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  153 SQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            +++ R +T +     ++ ++V F  NG+R F+G L +++ +R+  L+ LL +LT+  ++   +P GVR IY  +G  ++  +D+L     Y+C   ES K  DY
Sbjct:   62 TRTLRALTSE-----KRARKVRFYRNGDRYFTGLLYAVSADRFRSLDTLLAELTRSLADSLHLPQGVRAIYTVDGAKKISSLDELVEGESYVCASNESYKKVDY 160          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Match: ENSAMXT00000043405.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:8818577:8831816:1 gene:ENSAMXG00000040052.1 transcript:ENSAMXT00000043405.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 298.516 bits (763), Expect = 1.132e-87
Identity = 140/268 (52.24%), Postives = 187/268 (69.78%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWII---TLGNSI 3176
            Y++G  IG GNF+ VKE  ++ATG+ +A KIIDK +   KE LI  E+ IL+   HP+I+ L E+ +TP +++LV E +K GDLFDAI  + K+ E  ++ M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q ELFE I  G  E+  PYWD ++P +KDLI  ML V+   R+T  + L HPW++   TL N++
Sbjct:  370 YKVGKVIGDGNFAVVKECVERATGQEYALKIIDKAKCSGKEHLIANEVAILRRVRHPSIIMLIEEVDTPTELYLVMELVKGGDLFDAITSSTKYTERDASAMVYNLTGALRYLHRMCIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRSERNQQEELFEQILLGRLEFPAPYWDNVTPSAKDLIGKMLQVNVSARYTAEEVLSHPWVLDDSTLENNV 637          

HSP 2 Score: 68.5514 bits (166), Expect = 2.584e-11
Identity = 28/78 (35.90%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            KP+++T+IR+G+KP    +ILLNK ++ S++ +L+DI++A        +++++Y +DGK++    DFF     F+A G
Sbjct:  195 KPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLADITEAI--KLDSGAVKKLYTLDGKQLTSLQDFFGDDDVFIACG 270          

HSP 3 Score: 58.9214 bits (141), Expect = 2.609e-8
Identity = 32/104 (30.77%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  153 SQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            +++ R +T +     ++ ++V F  NG+R F+G L +++ +R+  L+ LL +LT+  ++   +P GVR IY  +G  ++  +D+L     Y+C   ES K  DY
Sbjct:   62 TRTLRALTSE-----KRARKVRFYRNGDRYFTGLLYAVSADRFRSLDTLLAELTRSLADSLHLPQGVRAIYTVDGAKKISSLDELVEGESYVCASNESYKKVDY 160          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 302.753 bits (774), Expect = 1.227e-87
Identity = 147/320 (45.94%), Postives = 208/320 (65.00%), Query Frame = 3
Query: 2361 TDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWII---TLGNSIR----------FSKPIKDVVTETRVELQMETAIFKSNNTISKNT 3278
            T     + Y++G  IG GNF+ VK+  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP++++LV E +K GDLFD+I  + K+ E  ++ M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  ++  PYW+ IS  +K+LI  ML V+   R+T  D LCHPW+     + N+++          F+   K   T   V + M TA+ K N  +S++ 
Sbjct:  434 TSSSILEKYKVGKIIGDGNFAVVKDCVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLMEEVDTPSELYLVMELVKGGDLFDSITSSTKYTERDASAMVYNLAGALKYLHRMSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATLVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNQQEDLFDQILQGRLDFPSPYWENISHSAKELIGRMLQVNVEARYTAEDVLCHPWVTEDAAMENNMKMEVTGKLKKHFTSVQKQGNTSAGVSVIMSTALDKENIQLSRHA 753          

HSP 2 Score: 72.4034 bits (176), Expect = 1.996e-12
Identity = 51/174 (29.31%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNK 1247
            KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA         ++R+Y ++GK+I    DFF     F+A G +     Q++       +  +  K S+    + R++   K+ + +  MT  R        SP ++ R      + S   V   P H ST  Q P K
Sbjct:  189 KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGVVKRLYTLEGKQITCLQDFFGEDDVFIACGPEKFRYAQDDF------VLDHSGKASEAFLTECRVL---KSSYGSRSMTPVRAGGS---KSPGSTRR------SKSPGTVRRNPGHFSTSSQSPVK 342          

HSP 3 Score: 56.6102 bits (135), Expect = 1.634e-7
Identity = 32/112 (28.57%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            S++  +  +++ + +T +     +K ++V F  NG+R F G + +++ +R+  L+ LL +LT+  S+ +  P GVR IY  +G  +V  +DDL     Y+C   E  +  +Y
Sbjct:   43 SAHCSFYRTRTLQSLTTE-----KKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEY 149          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 299.671 bits (766), Expect = 1.231e-87
Identity = 138/270 (51.11%), Postives = 190/270 (70.37%), Query Frame = 3
Query: 2349 QQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            + L +    EKY ++G  IG GNF+ VK+  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP++++LV E +K GDLFD+I  + K+ E  ++ M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  ++  PYW+ IS  +K+LI  ML V+   R+T  D LCHPW+
Sbjct:  415 KNLTSSSILEKY-KVGKIIGDGNFAVVKDCVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLMEEVDTPSELYLVMELVKGGDLFDSITSSTKYTERDASAMVYNLAGALKYLHRMSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATLVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNQQEDLFDQILQGRLDFPSPYWENISHSAKELIGRMLQVNVEARYTAEDVLCHPWV 683          

HSP 2 Score: 72.4034 bits (176), Expect = 1.929e-12
Identity = 51/174 (29.31%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNK 1247
            KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA         ++R+Y ++GK+I    DFF     F+A G +     Q++       +  +  K S+    + R++   K+ + +  MT  R        SP ++ R      + S   V   P H ST  Q P K
Sbjct:  189 KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGVVKRLYTLEGKQITCLQDFFGEDDVFIACGPEKFRYAQDDF------VLDHSGKASEAFLTECRVL---KSSYGSRSMTPVRAGGS---KSPGSTRR------SKSPGTVRRNPGHFSTSSQSPVK 342          

HSP 3 Score: 56.225 bits (134), Expect = 2.020e-7
Identity = 32/112 (28.57%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            S++  +  +++ + +T +     +K ++V F  NG+R F G + +++ +R+  L+ LL +LT+  S+ +  P GVR IY  +G  +V  +DDL     Y+C   E  +  +Y
Sbjct:   43 SAHCSFYRTRTLQSLTTE-----KKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEY 149          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Match: dclk2a (doublecortin like kinase 2 [Source:NCBI gene;Acc:103023338])

HSP 1 Score: 298.901 bits (764), Expect = 1.720e-87
Identity = 135/258 (52.33%), Postives = 185/258 (71.71%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VK+  +++TGK FA KIIDK + + KE LIE E+ +L+  +HPNI+ L E+ +TP++++LV E +K GDLFD+I  + K+ E  ++ M+ ++  AL Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PLY +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q +LF+ I  G  ++  PYW+ IS  +K+LI  ML V+   R+T  D LCHPW+
Sbjct:  378 YKVGKIIGDGNFAVVKDCVERSTGKEFALKIIDKNKCRGKEHLIENEVAVLRRVKHPNIIMLMEEVDTPSELYLVMELVKGGDLFDSITSSTKYTERDASAMVYNLAGALKYLHRMSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATLVEGPLYTVCGTPTYVAPEIIAESGYGLKVDIWAAGVITYILLCGFPPFRSENNQQEDLFDQILQGRLDFPSPYWENISHSAKELIGRMLQVNVEARYTAEDVLCHPWV 635          

HSP 2 Score: 71.2478 bits (173), Expect = 3.832e-12
Identity = 31/78 (39.74%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            KP+++T+IR+G+KP    +ILLNK ++ S+E +L+DI+DA         ++R+Y ++GK+I    DFF     F+A G
Sbjct:  190 KPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAI--KLDSGVVKRLYTLEGKQITCLQDFFGEDDVFIACG 265          

HSP 3 Score: 54.299 bits (129), Expect = 8.172e-7
Identity = 32/112 (28.57%), Postives = 62/112 (55.36%), Query Frame = 3
Query:  129 SSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            S++  +  +++ + +T +     +K ++V F  NG+R F G + +++ +R+  L+ LL +LT+  S+ +  P GVR IY  +G  +V  +DDL     Y+C   E  +  +Y
Sbjct:   44 SAHCSFYRTRTLQSLTTE-----KKARKVRFYRNGDRYFKGLVYAVSGDRFRSLDALLMELTRSLSDNVNLPQGVRFIYTVDGARRVTSLDDLLEGESYVCASNEPFRKMEY 150          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.834 bits (782), Expect = 3.121e-91
Identity = 141/290 (48.62%), Postives = 200/290 (68.97%), Query Frame = 3
Query: 2337 PVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKP--------FAAKIIDKKRLKDKEDLIEEEIRIL-KSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSI-KNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEIS---PESKDLINNMLIVDPLKRFTVLDCLCHPWIITLG 3167
            P L   + + +D E  Y++G +IG GNF+ VKE ++ ++G           A KIIDK +L  +E+++  E+ +  +  +HPN+V+L E  E+P+  +LV E ++ GDLFDAI E+++F E  +A M+ D+ RAL Y+H+  IVHRD+KPENLL     +G   LKL+D GLA+E+  P+Y +CGTPTYVAPEIL+E GYG+EVD+WA+GVI YILLCGFPPFRS ER+Q ELFE I+ GE+E++ PYWD IS     +KDL++ +L+VD  +R+T    L HPW+   G
Sbjct:  347 PNLPMPIVSLQDIESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTGPIYTVCGTPTYVAPEILAETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSDGG 636          

HSP 2 Score: 88.1965 bits (217), Expect = 4.361e-18
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDRNGGQ--VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSF-FKILLNKTSSQSYEDLLSDISDAFG-SNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKD 968
            R+PK V F  NG+R F  + L ITP+RY    +LL DL++     +P GVRR+Y   GG      +D L     Y+C   E  ++     K F         + N   +  YN         +T    T    +G R                      N L     +P   E  + ++P+++T++R G +       +LLN+ ++QS+E+LL DIS+A G   W+   ++R+Y + G+E +  SDFFR    F+A   KD
Sbjct:    1 RRPKVVRFYRNGDRYFRARTLHITPHRYVSWPELLADLSRAVP--LPYGVRRLYTPLGGSPVAGSVDALRDGEAYVCASFEPFRS----VKDF---------SRNKQPQLSYN---------ATCGASTICLDKGVR---------------------QNFLR----RP---ENYVPARPKVITVVRVGGRGPRRRITLLLNRRAAQSFEELLGDISEALGLPRWRTNHVRRLYTLRGREARSVSDFFRGDDVFLAATRKD 209          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 1.267e-62
Identity = 109/265 (41.13%), Postives = 165/265 (62.26%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDL-IEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEI---KEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            F   YQL   +G G FS V+   K +TG+ FAAKII+ K+L  ++   +E E RI +  +H NIV+L E        +LV + +  G+LF+ I     + E+ ++  ++ I  ++ + H  GIVHRD+KPENLL + K     +KL+DFGLA+E+   ++  +   GTP Y++PE+L +  YG  VD+WA GVI YILL G+PPF   + +Q +L++ IKAG +++  P WD ++ E+K+LIN ML ++P KR T  + L HPWI
Sbjct:   10 FTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFW--DEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWI 272          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 2.495e-57
Identity = 103/257 (40.08%), Postives = 161/257 (62.65%), Query Frame = 3
Query: 2412 GNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEY----IKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVI---CGTPTYV---APEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPW 3152
            G FSEV  A++++TG+  A K I K  L+ K++ +E E+ +L   +H NI+ LE+ +ET + ++L+ +     I+ G+LFD I E   + E  ++ ++R + RA+ ++H +G+VHRD+KPENLL         + +SDFGL+ +++ P  V+   CGTP YV   APE+L+++ Y   VD W+ GVI YILLCG+PPF   +   + LF+ I   E+E+  PYWD+IS  +KD I +++  D  +RFT    L HPW
Sbjct:    2 GAFSEVVLAEERSTGRHVAIKCIAKTALRGKDNTVENEVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLS-KVEAPGSVMSTACGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCGYPPFY--DEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 201.06 bits (510), Expect = 1.017e-56
Identity = 114/289 (39.45%), Postives = 168/289 (58.13%), Query Frame = 3
Query: 2337 PVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIID-------KKRLKDKEDLIEEEIRILKSCE-HPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIK--EPLYVICGTPTYVAPEIL------SEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            PV AQ      DF   Y+    +GSG  S V+    K TG+ FA KIID       ++ L+D      +E+ ILK+   HP+I+ L + +E+    FLV + +K G+LFD + E +   E  +  +MR IF  + ++H+K IVHRD+KPEN+L    +  +N++LSDFG +++++  E L  +CGTP Y++PE+L      S  GYG EVD+WA GVI Y LL G PPF    R Q  +   I  G++++  P W++ S   KDLI+ +L+V+P KRFT    L HP+ 
Sbjct:   15 PVAAQ------DFNDKYEPKEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTVKEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLHAKNIVHRDLKPENILL---DDNMNIRLSDFGFSMQLRPGERLRELCGTPGYLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSPPFW--HRKQMTMLRLIMDGKYDFSTPEWEDRSDTVKDLISRLLVVEPEKRFTAEQALAHPFF 292          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Match: stk33 (serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GENE-040724-242])

HSP 1 Score: 194.126 bits (492), Expect = 1.604e-55
Identity = 103/286 (36.01%), Postives = 165/286 (57.69%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE-DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIK---NGL--INLKLSDFGLAVEIKEP------LYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPI 3194
            F+ YY+LG  +GSG+F  V EA    TG  +A K ++K+R       L+E E+ ILK  +H NI+ LEE  ET  +V+LV E  + G+L   + +  +  E+++  +   +  A+ Y+H   IVHRD+K EN+L        G+  ++++++DFGL+  ++E       L   CGTP Y+A E++  Q Y  + D+W+ GVI Y+LLCG PPF +   +Q +LFE I  GE  + +P W+E+S  +K+L+  +L VDP  R T  + L   W+   G++    +P+
Sbjct:    1 FQNYYRLGRQLGSGSFGTVYEATHVETGVKWAIKTVNKERAGSSGVRLLEREVVILKRVQHQNIIHLEEVLETHKRVYLVMELCELGELRAVLEQRKRLSEAEARHVAHSLAGAIAYLHKHDIVHRDLKLENILAKSSEPHEGIDHLDIRVTDFGLSA-VREGNGAASMLQSPCGTPIYMAAEVIQSQDYSQQCDVWSIGVILYMLLCGEPPFMA--HSQEKLFELIIKGELSFTQPAWEEVSESAKELLRGLLKVDPAHRLTASELLHDHWVT--GDTSSLGRPL 281          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 199.904 bits (507), Expect = 4.450e-56
Identity = 110/269 (40.89%), Postives = 165/269 (61.34%), Query Frame = 3
Query: 2376 EKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIE---EEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIK---EPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEF--EYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWII 3158
            +K Y  G ++G+G F  V++AK   TG+  A KI+ KK LK  +  +E   +E+ IL+   HPNIV  ++ FE+ +K +++ +  K G+LFD I +  KF E  +  ++ +I  A+ Y+HS+ IVHRD+KPENLL   K+    L ++DFG+A  +K   E LY   G+  YVAPE+L++ G+G   DIW+ GVI Y LLCG+  FR+ ER Q +  +    GE+  ++ +PYWD +S ++K  I   L +DP KR T  + L  PWII
Sbjct:   34 KKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRA-ERVQ-DFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWII 300          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 199.134 bits (505), Expect = 2.990e-55
Identity = 118/333 (35.44%), Postives = 181/333 (54.35%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKD--KEDLIEEEIRILKSCEHPNIVKLEEQFETPN-----KVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGL----------------INLKLSDFGLAVEIKEPLYV--ICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS*L*CL 3296
            F+KY  LG  +G+G+++ VKEAK K TG+  A KI   ++  D  K     EE  IL   +HPNIV L + F  P      + +LV E I +G+LF+ I       + +S  + + +   L Y+H + I+HRDIKPEN+L +I                    I +K++DFGLA    E  +   +CGTP+YVAPE+L+++GY  +VD+W++GVI Y+ LCGFPPF S +     L E I   ++ +  PYWD+I      LI+N+L+++P +R+ + + L HPW               D+  ++ V L+++     ++N I K  S L CL
Sbjct:  197 FDKYL-LGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPF-SDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPW-------------FNDIQQQSSVSLELQRLQI-TDNKIPKTYSELSCL 513          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 180.259 bits (456), Expect = 2.406e-49
Identity = 109/306 (35.62%), Postives = 169/306 (55.23%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE---DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIK---EPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEF--EYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVT--ETRVELQMETAIFKSNNTISK 3272
            Y  G ++G+G+F  V++A+K +T +  A KI+ KK L+       ++ EE+ IL+   HPNIV  ++ FE+ +K ++V +    G+LFD I    KF E  +  ++  I  A+ Y+HSK +VHRD+KPEN+L   K+    L ++DFG+A ++K   + +Y   G+  YVAPE+L++ G+G   DIW+ GVI Y LLCG+ PF +   +     E   A  +   +  PYWD IS + K  I   L ++P  R T  + L  PWI +    +  S  + DV      R +L+    I K NN I +
Sbjct:   47 YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIA--ESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITS--KRVETSNILPDVKKGFSLRKKLRDAIEIVKLNNRIKR 348          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 179.489 bits (454), Expect = 2.074e-46
Identity = 105/289 (36.33%), Postives = 164/289 (56.75%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDL----------IEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEP--LYVICGTPTYVAPEILSEQGY-GIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTE 3212
            ++LG ++G G+  +V+ A+ + TG   A K+I K    +  +           IE EI I+K   HPN++ L + +ET N ++L+ EY ++G+LF+ + ++   PE ++    R I   + Y H+ GIVHRD+KPENLL    +   N+K++DFG+A    +   L   CG+P Y APEI+S   Y G   D+W+ GVI + LL G  PF     N  +L   ++ G+FE   P   EIS +++DLI  +L+VDP +R  + D L HP ++    +I+ SK IKD+  E
Sbjct:   21 WKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL---DSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM--PNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHP-LLKKYQTIKDSKSIKDLPRE 303          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 176.792 bits (447), Expect = 2.030e-45
Identity = 112/295 (37.97%), Postives = 161/295 (54.58%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE------------DL----IEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEP--LYVICGTPTYVAPEILSEQGY-GIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTE 3212
            ++LG ++G G+  +V+ A+  +TG+  A K+I K                   D     IE EI I+K   HPN+++L + +ET   ++LV EY ++G+LF+ + E    PE ++    R I   + Y H+ GIVHRD+KPENLL   K    N+K++DFG+A    E   L   CG+P Y APEI+S   Y G   D+W+ GVI + LL G  PF   + N   L   ++ GEFE   P  DEIS E++DLI  +L VDP +R    D L HP ++    SIR SK I+ +  E
Sbjct:   19 WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK---YNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM--PSDDEISREAQDLIRKILTVDPERRIKTRDILKHP-LLQKYPSIRDSKSIRGLPRE 307          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 324.709 bits (831), Expect = 8.644e-100
Identity = 144/273 (52.75%), Postives = 200/273 (73.26%), Query Frame = 3
Query: 2337 PVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIK-NGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPW 3152
            P   + L TD++    Y  G  +G GNF+ V++ K K T K FA KIIDK++++ KE +I++EI I++ C HPNIV+L E +++  +++LV E IK GDLFDAI  ++KF E  +    RD+ +AL Y+H + IVHRD+KPENLL   + +G  +LKL+DFGLA+E+  P++ +CGTPTYVAPEIL E GYG++VD+WA+GVI YI+LCGFPPFRSP R+Q ELF+ I++GEFE++ PYWD +S ++KDLI+ ML+VDP KR T    L H W
Sbjct:  230 PKYKRPLVTDKEVTDVYNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDDEIAIMRRCRHPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLAMEVTAPIFTVCGTPTYVAPEILEENGYGLKVDMWAAGVITYIMLCGFPPFRSPNRDQDELFDLIQSGEFEFLSPYWDPVSDDAKDLISTMLVVDPTKRATADQVLQHRW 502          

HSP 2 Score: 51.2174 bits (121), Expect = 2.146e-6
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 3
Query:  207 KRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDR-NGGQVQDIDDLEHRNIYICCGQESLKTYDYDTK 464
            K V+F  NG+  FS   ++ITP +Y   + LL +L+      +P GVR + D+ NG QV++I+DL+    Y+C     LK   Y  K
Sbjct:    6 KTVIFYKNGD-VFSKYPVTITPRKYRSFDILLAELS--MKTELPQGVRYLLDKENGAQVKNIEDLQDGKEYVCASNARLKRLAYGKK 89          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 313.153 bits (801), Expect = 6.444e-99
Identity = 145/258 (56.20%), Postives = 198/258 (76.74%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ V+E K + T K +A KII+K ++K KE +IE EI IL+  +H +IV+L E++ETP ++FLV E +K GDLF+AI E  K+ E  ++ M+RD+  AL Y+H   IVHRDIKPENLL  ++ NG  +LKL+DFGLA+E+K P++++CGTPTYVAPEIL E GYG++VDIWA+GVI YILLCGFPPFRSP  +Q ELF+ I AGEFEY+ P+W++IS  +KDLI++ML+VD  +R++    L HPW+
Sbjct:    1 YRIGKVIGDGNFAVVRECKHRKTNKEYALKIINKAKVKGKEHMIENEISILRRVKHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKSLKLADFGLAMEVKSPMFLVCGTPTYVAPEILDESGYGLKVDIWAAGVISYILLCGFPPFRSP--DQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPWV 256          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 230.72 bits (587), Expect = 4.198e-68
Identity = 120/266 (45.11%), Postives = 166/266 (62.41%), Query Frame = 3
Query: 2364 DEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLY-VICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            D+   K Y L   +G+G FSEV  A++KATG  FA K I KK LK KE+ +E EI ILK   H NI+ L++ F+  + ++LV + ++ G+LFD I E   + E  ++ +++ I  A  Y+HS GIVHRD+KPENLL    +    + +SDFGL+ +E +       CGTP YVAPE+L +Q YG  VD W+ GVI YILLCG+PPF   + +   LF  I   E+E+  PYWDEIS  +KD I +++ +DP  R+T    L HPWI
Sbjct:   10 DDKITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFY--DDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWI 273          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Match: EDO49898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF52])

HSP 1 Score: 208.379 bits (529), Expect = 2.875e-58
Identity = 104/266 (39.10%), Postives = 159/266 (59.77%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKE-DLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEI---KEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWII 3158
            F + Y+L   +G G FS V++   + T   +A KI+D K +  ++   +E E RI +   HPN+V+L     +    FLV + +  G+LF+ I     + E+ ++  ++ +  ++ + H  GIVHRD+KPENLL + +     +KL+DFGLA+E+   +   Y   GTP Y++PE+L +  YG  VD+WA GVI YILL G+PPF   E  Q +L+  IKAG ++Y  P WD ++ ++KDLI+ ML VD  KR T  + L HPWI+
Sbjct:   13 FNEKYELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDVHKVEREARICRHLRHPNVVRLHANIMSDGFYFLVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGERLGWYGFAGTPGYLSPEVLKKDPYGKPVDLWACGVILYILLVGYPPFWDEE--QQKLYSQIKAGTYDYPSPEWDTVTADAKDLIDKMLTVDAPKRITAAEALKHPWIV 276          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Match: EDO44594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV77])

HSP 1 Score: 205.297 bits (521), Expect = 3.241e-58
Identity = 118/278 (42.45%), Postives = 164/278 (58.99%), Query Frame = 3
Query: 2358 ETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLI---EEEIRILKSCE-HPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIK--EPLYVICGTPTYVAPEILS------EQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            E    F   Y+    +G G  S V++   K TGK FA KIIDK   +   D+I    +E+ IL S + H NI++LE+ FE+    FLV E   +G+LFD + E +   E Q+  +M  IF A+ Y+H   +VHRD+KPEN+L   +   IN+K+SDFG AVE+K  E L  +CGTP Y+APE+L         GY  EVD+WA GVI Y LLCGFPPF    R Q  +   I  G++ +  P W+++S ++K+LI  +L+V P +R T  D L HPW+
Sbjct:   14 EATGGFIDKYEPKELLGCGVSSIVRKCYDKLTGKAFAVKIIDKLSDQGGSDIIATTRDEVNILLSLQGHKNIIRLEDVFESTAFFFLVFEIAPKGELFDYLTEKVTLSEKQTRRIMLSIFEAVDYMHYHNVVHRDLKPENILLDEE---INVKISDFGFAVELKEGETLRELCGTPGYLAPEVLQCSMFPDAPGYTKEVDMWACGVILYTLLCGFPPFW--HRRQVVMLRNIMNGKYNFSSPEWEDVSNDAKNLIKKLLVVHPKERITASDALKHPWL 286          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Match: dclk3 (doublecortin like kinase 3 [Source:NCBI gene;Acc:101156024])

HSP 1 Score: 285.034 bits (728), Expect = 2.219e-85
Identity = 131/281 (46.62%), Postives = 184/281 (65.48%), Query Frame = 3
Query: 2361 TDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCS-IKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKD 3200
            T  D E+ Y+ G  IG GNF+ V+E +++  G+  A KI+++ +L  +E +++ E+ +L S  HP IV+L     T    +LV E +  GDLF+AI +  KFPE+++ +++ D+  AL YIH K IVHRD+KPENLL   +   +  LKL DFGLA+ + EP++ ICGTPTYVAPEIL E GYG+ VD+WA GVI ++LLCGFPPFRS ER+Q ELF+ IK  +  +  PYWD IS E+K L+  +L VDP  R T    L HPW+  +  S+   + + D
Sbjct:   67 TLSDIERVYEFGRVIGDGNFAVVRECRRRDGGELLALKIVERSKLVGREHMMQNELSLLGSLCHPRIVRLFTHHHTRTHSYLVMELVSGGDLFEAISDRGKFPEAEAGLIVSDVSEALEYIHRKSIVHRDLKPENLLVERVAASVCRLKLGDFGLAMVVTEPVFTICGTPTYVAPEILHETGYGVAVDVWALGVILFVLLCGFPPFRSRERDQEELFKLIKQAQLHFPSPYWDSISEEAKSLVRCLLEVDPTLRLTAEQTLQHPWVKAMA-SVCMQRALTD 346          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Match: ENSORLT00000003850.2 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 293.508 bits (750), Expect = 2.501e-85
Identity = 138/258 (53.49%), Postives = 182/258 (70.54%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE  ++ATG+ FA KIIDK R   KE LIE E+ +L+   HP+I++L E  ETP+++FLV E +K GDLFDAI  + K+ E  ++ M+ ++  A+ Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PL+ +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q ELF+ I  G+ E+  P WD IS  +K LI+ ML V+   RFT  + L HPW+
Sbjct:  428 YKVGKVIGDGNFAVVKECVERATGQEFALKIIDKARCSGKEHLIENEVAVLRRVRHPSIIQLIEVDETPSQLFLVMELVKGGDLFDAITSSTKYSERDASAMVYNLAGAVKYLHRMNIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLFTVCGTPTYVAPEIIAETGYGLKVDIWAAGVIAYILLCGFPPFRSENNVQEELFDQILRGKLEFPSPDWDTISLPAKMLISQMLQVNVDARFTAEEVLSHPWV 685          

HSP 2 Score: 68.5514 bits (166), Expect = 3.251e-11
Identity = 28/78 (35.90%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            KP+++T+IR+G+KP    ++LLNK ++ S++ +L+DI++A        +++R+Y +DGK++    DFF     F+A G
Sbjct:  217 KPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAI--KLDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACG 292          

HSP 3 Score: 54.6842 bits (130), Expect = 5.311e-7
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            R+ K+V F  NG+R F G + +++ +R+   + LL +LT+  ++   +P GVR IY  +G  ++  +D+L     Y+C   +  +  DY
Sbjct:   72 RRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDY 160          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Match: ENSORLT00000031333.1 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 293.508 bits (750), Expect = 2.501e-85
Identity = 138/258 (53.49%), Postives = 182/258 (70.54%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLL-CSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G  IG GNF+ VKE  ++ATG+ FA KIIDK R   KE LIE E+ +L+   HP+I++L E  ETP+++FLV E +K GDLFDAI  + K+ E  ++ M+ ++  A+ Y+H   IVHRDIKPENLL C   +G  +LKL DFGLA  ++ PL+ +CGTPTYVAPEI++E GYG++VDIWA+GVI YILLCGFPPFRS    Q ELF+ I  G+ E+  P WD IS  +K LI+ ML V+   RFT  + L HPW+
Sbjct:  428 YKVGKVIGDGNFAVVKECVERATGQEFALKIIDKARCSGKEHLIENEVAVLRRVRHPSIIQLIEVDETPSQLFLVMELVKGGDLFDAITSSTKYSERDASAMVYNLAGAVKYLHRMNIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLFTVCGTPTYVAPEIIAETGYGLKVDIWAAGVIAYILLCGFPPFRSENNVQEELFDQILRGKLEFPSPDWDTISLPAKMLISQMLQVNVDARFTAEEVLSHPWV 685          

HSP 2 Score: 68.5514 bits (166), Expect = 3.251e-11
Identity = 28/78 (35.90%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG 959
            KP+++T+IR+G+KP    ++LLNK ++ S++ +L+DI++A        +++R+Y +DGK++    DFF     F+A G
Sbjct:  217 KPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAI--KLDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACG 292          

HSP 3 Score: 54.6842 bits (130), Expect = 5.311e-7
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSN--FIPTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            R+ K+V F  NG+R F G + +++ +R+   + LL +LT+  ++   +P GVR IY  +G  ++  +D+L     Y+C   +  +  DY
Sbjct:   72 RRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDY 160          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Match: dclk1a (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101167140])

HSP 1 Score: 280.026 bits (715), Expect = 1.282e-80
Identity = 132/262 (50.38%), Postives = 183/262 (69.85%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLG 3167
            Y++G  IG GNF+ V+E  + +TG+ +A KII+K + + KE +I+ E+ IL+  +HPNIV L E+ +T N+++LV E +K GDLFDAI    ++ E  ++ M+ ++  A+ Y+HS  IVHRDIKPENLL     +G  +LKL DFGLA  +  PLY +CGTPTYVAPEI+SE GYG++VDIWA+GVI YILLCGFPPFR    +Q  LF+ I  G+ E+  PYWD +S  +K+LI +ML V+  +R+T L  L HPW+   G
Sbjct:  382 YKVGRMIGDGNFAVVRECVELSTGREYALKIINKGKCRGKEHMIQNEVAILRRVKHPNIVLLIEEVDTYNELYLVMELVKGGDLFDAITSANRYTERDASGMLHNLANAIKYLHSLNIVHRDIKPENLLVYEHADGSKSLKLGDFGLATVVDGPLYTVCGTPTYVAPEIISETGYGLKVDIWAAGVITYILLCGFPPFRGCSDDQEALFDQILMGQLEFPFPYWDNVSETAKELIRSMLEVEVDQRYTALQVLEHPWVTNEG 643          

HSP 2 Score: 69.3218 bits (168), Expect = 1.856e-11
Identity = 34/96 (35.42%), Postives = 56/96 (58.33%), Query Frame = 3
Query:  726 KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG------DKDPNLNQEEVR 995
            +P+++T++R+G+KP    +ILLNK ++ SYE +L+DI+DA         +++IY ++GK +    DFF     FVA G        D  L++ E R
Sbjct:  178 RPKLVTVVRSGVKPRKAVRILLNKKTAHSYEQVLTDITDAI--KLDSGVVKKIYTLEGKLVSCLQDFFGDEDIFVACGPEKFRYQDDLMLDESECR 271          

HSP 3 Score: 57.3806 bits (137), Expect = 7.199e-8
Identity = 31/89 (34.83%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNGG-QVQDIDDLEHRNIYICCGQESLKTYDY 455
            ++ K+V F  NG+R F+G + +I+ +R+   + LL DLT+  S+ +  P GVR IY  +G  ++  +D L     Y+C   E+ K  DY
Sbjct:   47 KRAKKVRFYRNGDRYFNGIVYAISADRFRTFDALLADLTRSLSDNVNLPQGVRTIYALDGSKKISSVDQLVEGGSYVCSSTEAYKKLDY 135          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Match: dclk1b (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101155370])

HSP 1 Score: 278.485 bits (711), Expect = 5.118e-80
Identity = 128/258 (49.61%), Postives = 184/258 (71.32%), Query Frame = 3
Query: 2385 YQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 3155
            Y++G ++G GNF+ V+E  +++TG+ +A KII K++ K KE +I+ E+ IL+  +HPNIV L E+ ++P++++LV E +K GDLF AI  + K+ E  ++ M+ ++  A+ Y+HS  IVHRDIKPENLL    ++G  +LKL DFGLA  +  PLY +CGTPTYVAPEI++E GYG++VD+WA+G+I YILLCGFPPFRS E +Q  LFE I   +F++  PYWD +S  +K LI  ML V   +R+T    L HPW+
Sbjct:  386 YKVGRTLGDGNFAVVRECVERSTGREYALKIISKEKCKGKEHMIQSEVAILRRVKHPNIVLLVEEIDSPSELYLVMELVKGGDLFYAITSSNKYTERDASCMLFNLANAIKYLHSLNIVHRDIKPENLLVFEHQDGSKSLKLGDFGLATIVNGPLYAVCGTPTYVAPEIVAETGYGLKVDVWAAGIITYILLCGFPPFRSSEDDQEALFEQILKCQFDFPTPYWDNVSDAAKTLITKMLEVSVDQRYTAAQVLDHPWV 643          

HSP 2 Score: 98.9821 bits (245), Expect = 1.256e-20
Identity = 75/275 (27.27%), Postives = 119/275 (43.27%), Query Frame = 3
Query:  198 RKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFI--PTGVRRIYDRNG-GQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIG------DKDPNLNQEEVR 995
            +K K++ F  NG+R F G + +I+  R+  L+ LL DLT+  S+ +  P GVR IY  +G  ++  +D L     Y+C   E  K  DY                        NP  +   A +  S + P F   N+                               P   E+    +P+++TI+R+G+KP    +ILLNK ++ S+E +++DI+DA         ++R+Y +DGK +    DFF     F A G        D NL++ E R
Sbjct:   49 KKAKKIRFYRNGDRYFKGIVYAISSERFGSLDALLADLTRCLSDNVNLPQGVRTIYTIDGVTKIASMDQLVEGESYVCASIEPFKKLDYTKNV--------------------NPN-WSLGAKTAASVRDPPFLCSNK----------------------------AGSPETRESKDFIRPKLVTIVRSGVKPRKAVRILLNKKTAHSFEQVMTDITDAI--KLDSGVVKRLYTVDGKMVTCLQDFFGEDDIFFACGPEKFRYQDDFNLDENECR 272          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 2023.82 bits (5242), Expect = 0.000e+0
Identity = 1042/1052 (99.05%), Postives = 1046/1052 (99.43%), Query Frame = 3
Query:  126 MSSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDRNGGQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEHTSPGYPNNDSRKPGPFEMAPEESSARILTPKMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNKIPLSNKKFREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNAXXXXXXXXXXXXXXDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEPGHHKYNIAFEVNLLDTDEEKTVKHSNPSLESAKQSLKEPNIGXXXXXXXXXXXXXXXEIPKKLSLAGLIGPRSETVNLFMKGKSFQKPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS 3281
            MSSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDRNG QVQDIDDLEHRNIYICCGQESLKTYDYDTKYFEL+HKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSS DASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEE+TSPGYPNNDSRKPGPFEMAPEESSARILT KMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNK+PLSNK FREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNANQNVNPYNKKVKKPDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEP HHKYNIAFEVNLLDTDEEKTVK SNPSLESAKQSLKEPNIGKSISDLKVKKDSLKSEIPKKLSLAGLIGPRSETVNLFMKGKSF+KPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS
Sbjct:    1 MSSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDRNGWQVQDIDDLEHRNIYICCGQESLKTYDYDTKYFELLHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSRDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEYTSPGYPNNDSRKPGPFEMAPEESSARILTSKMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNKMPLSNKIFREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNANQNVNPYNKKVKKPDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEPSHHKYNIAFEVNLLDTDEEKTVKRSNPSLESAKQSLKEPNIGKSISDLKVKKDSLKSEIPKKLSLAGLIGPRSETVNLFMKGKSFKKPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS 1052          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 1774.99 bits (4596), Expect = 0.000e+0
Identity = 924/933 (99.04%), Postives = 927/933 (99.36%), Query Frame = 3
Query:  483 KGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYXXXXXXXXXXXXXXXXXXXMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEHTSPGYPNNDSRKPGPFEMAPEESSARILTPKMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNKIPLSNKKFREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNAXXXXXXXXXXXXXXDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEPGHHKYNIAFEVNLLDTDEEKTVKHSNPSLESAKQSLKEPNIGXXXXXXXXXXXXXXXEIPKKLSLAGLIGPRSETVNLFMKGKSFQKPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS 3281
            K HLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSS DASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEE+TSPGYPNNDSRKPGPFEMAPEESSARILT KMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNK+PLSNK FREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNANQNVNPYNKKVKKPDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEP HHKYNIAFEVNLLDTDEEKTVK SNPSLESAKQSLKEPNIGKSISDLKVKKDSLKSEIPKKLSLAGLIGPRSETVNLFMKGKSF+KPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS
Sbjct:   22 KRHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNYEKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSRDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEYTSPGYPNNDSRKPGPFEMAPEESSARILTSKMRAQIFGLERIRAGLEEREKARFLMAKKLDQRNPSKLSPNKYSFNNNPGNKMPLSNKIFREKYKYSPYLESMDGYRNNKENFQLSKIPKSQRSKKPLDFVDNNANQNVNPYNKKVKKPDSDRNQMRNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLPDIRVSLPTLTEENADSSNKNDQKPLDLVEPSHHKYNIAFEVNLLDTDEEKTVKRSNPSLESAKQSLKEPNIGKSISDLKVKKDSLKSEIPKKLSLAGLIGPRSETVNLFMKGKSFKKPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKNTS 954          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Match: SMESG000060309.1 (SMESG000060309.1)

HSP 1 Score: 293.123 bits (749), Expect = 2.729e-85
Identity = 128/269 (47.58%), Postives = 193/269 (71.75%), Query Frame = 3
Query: 2373 FEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIK-NGLINLKLSDFGLAVEIK-EPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWIITLGNS 3173
            F   Y++G  IG G+++ V+E    ATG+  A K+ DKKRL +  D++++E+ I ++C HPNI +L   +ET  +VF+V E +K GDLFD+I  NI+F E  +++++ D+  AL Y+HS+ +VHRDIKPEN+L S   +G I++KL+DFGLA  ++    +++CGTPTY+APEIL E+GYG EVD WA GVI YIL+ GFPPFR+P+R QTEL++FI  G ++Y   +W+ IS E++ LI+++L+  P +R+T  D +C  W++TLG +
Sbjct:  426 FLSKYRMGKKIGEGHYAVVREGSHLATGREVAIKVYDKKRLTNAMDMVDDEVEIQRACNHPNIARLYAAYETEAEVFMVMELVKGGDLFDSIVRNIRFSEETASMIIHDLASALYYLHSRNVVHRDIKPENILISEDIHGRISIKLTDFGLATILRGNQAHLVCGTPTYIAPEILEEKGYGTEVDNWALGVILYILISGFPPFRTPDRQQTELYDFITKGVYDYPLEFWENISMEARFLIDHLLVTHPRERYTARDVICDSWVLTLGGT 694          

HSP 2 Score: 53.5286 bits (127), Expect = 1.001e-6
Identity = 24/101 (23.76%), Postives = 61/101 (60.40%), Query Frame = 3
Query:  723 SKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAEL-FPN 1022
            S  +++T++R G  P +  + L+ + + ++  D+L++IS +   +   + + +++N+ G+EI    D F++   F+A+G +   L+++ V+ I+ ++ +PN
Sbjct:   91 SGSKMITVVRAGPPPRAIIRALIKRANHKNMADVLTEISQSLVQSSYKERVTKLFNLLGEEILDAKDLFKAEDVFIAVGKE--GLSRKIVKEILEDIYYPN 189          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 286.189 bits (731), Expect = 5.207e-81
Identity = 134/240 (55.83%), Postives = 177/240 (73.75%), Query Frame = 3
Query: 2331 IVPVLAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKP 3047
            ++  L +QL + +   + +++   +G GNF+ VK A  + T   +A KIIDK R+  KE +IE EI I+K C H NIVKL+E++ET  +VFLV E +K GDLFDAI +N+KF E  +A M+ D+  AL Y+HS+ IVHRD+KPENL+    K+G I LKL+DFGLA+EIK+ +Y +CGTPTYVAPEILSE+GY +EVD+WA GVI YILLCGFPPFRS  RNQ ELF+ I++G FE+I P
Sbjct:  728 VMGKLCRQLSSSDIIYQRFEVTKMLGDGNFAVVKLALHRKTKTEYALKIIDKSRMMGKESMIENEIWIMKLCNHDNIVKLKEEYETREEVFLVMELVKNGDLFDAITQNVKFSEPVAAKMVADMANALFYLHSRRIVHRDLKPENLMVLRHKDGSITLKLADFGLAMEIKKLIYTVCGTPTYVAPEILSEKGYSLEVDLWALGVITYILLCGFPPFRSSNRNQEELFQIIQSGNFEFISP 967          

HSP 2 Score: 88.1965 bits (217), Expect = 2.142e-17
Identity = 74/286 (25.87%), Postives = 133/286 (46.50%), Query Frame = 3
Query:  714 NMKSKPRILTIIRTG-IKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNW--KGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNY------------EKMSDHSADDSRLVKDNKTKFNNMEMTLPRTD---------EDHLYSS----PDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEHTSPGYPNNDSRKPGPFEMAPEESSARILTPKMRAQIFGLERIRAGLEEREKARFLMAKKL 1487
            N + KP+++T++R    K   F +ILLNK S QSYE LLSDI  +   +   K + I RI+N+ GKEI+   DFFR+  +F+A+GD +  L  +++++I+ +L+P++            +K+ +  A D +   +     +   M++ + D         +DH ++S     D+S   +   P +S    S+R  ++  +  +PN +                          N +      ++    S A  ++ +   Q    +RIR   EEREKAR  + ++L
Sbjct:  130 NQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNE-TLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQ--------------------------NTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQL 388          
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 285.034 bits (728), Expect = 1.644e-80
Identity = 134/236 (56.78%), Postives = 175/236 (74.15%), Query Frame = 3
Query: 2343 LAQQLETDEDFEKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLC-SIKNGLINLKLSDFGLAVEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKP 3047
            L +QL + +   + +++   +G GNF+ VK A  + T   +A KIIDK R+  KE +IE EI I+K C H NIVKL+E++ET  +VFLV E +K GDLFDAI +N+KF E  +A M+ D+  AL Y+HS+ IVHRD+KPENL+    K+G I LKL+DFGLA+EIK+ +Y +CGTPTYVAPEILSE+GY +EVD+WA GVI YILLCGFPPFRS  RNQ ELF+ I++G FE+I P
Sbjct:  742 LCRQLSSSDIIYQRFEVTKMLGDGNFAVVKLALHRKTKTEYALKIIDKSRMMGKESMIENEIWIMKLCNHDNIVKLKEEYETREEVFLVMELVKNGDLFDAITQNVKFSEPVAAKMVADMANALFYLHSRRIVHRDLKPENLMVLRHKDGSITLKLADFGLAMEIKKLIYTVCGTPTYVAPEILSEKGYSLEVDLWALGVITYILLCGFPPFRSSNRNQEELFQIIQSGNFEFISP 977          

HSP 2 Score: 88.1965 bits (217), Expect = 2.307e-17
Identity = 74/286 (25.87%), Postives = 133/286 (46.50%), Query Frame = 3
Query:  714 NMKSKPRILTIIRTG-IKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNW--KGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNY------------EKMSDHSADDSRLVKDNKTKFNNMEMTLPRTD---------EDHLYSS----PDASYRKTDVHPNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEHTSPGYPNNDSRKPGPFEMAPEESSARILTPKMRAQIFGLERIRAGLEEREKARFLMAKKL 1487
            N + KP+++T++R    K   F +ILLNK S QSYE LLSDI  +   +   K + I RI+N+ GKEI+   DFFR+  +F+A+GD +  L  +++++I+ +L+P++            +K+ +  A D +   +     +   M++ + D         +DH ++S     D+S   +   P +S    S+R  ++  +  +PN +                          N +      ++    S A  ++ +   Q    +RIR   EEREKAR  + ++L
Sbjct:  156 NQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNE-TLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQ--------------------------NTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQL 414          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCLK31.417e-10255.40doublecortin like kinase 3 [Source:HGNC Symbol;Acc... [more]
DCLK31.211e-10055.40doublecortin like kinase 3 [Source:HGNC Symbol;Acc... [more]
DCLK23.227e-8553.88doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK23.858e-8553.88doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK22.326e-8453.88doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-14.973e-6642.86Calcium/calmodulin-dependent protein kinase type 1... [more]
unc-431.136e-6142.05Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.136e-6142.05Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.136e-6142.05Calcium/calmodulin-dependent protein kinase type I... [more]
F32D8.11.158e-6139.03pep chromosome:WBcel235:V:10880837:10883399:1 gene... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG175288.086e-8249.45gene:FBgn0261387 transcript:FBtr0111274[more]
CG175288.086e-8249.45gene:FBgn0261387 transcript:FBtr0111277[more]
CaMKI3.923e-7244.83gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI2.397e-6842.95gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI2.397e-6842.95gene:FBgn0016126 transcript:FBtr0089065[more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dclk2a6.969e-8949.01doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a7.665e-8949.01doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a7.687e-8949.01doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a7.687e-8949.01doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a1.215e-8849.01doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovch12.090e-9355.09ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526][more]
arhgap243.794e-8447.55Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap248.297e-8448.39Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.204e-8350.39Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.262e-8350.39Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dclk35.309e-10357.25doublecortin-like kinase 3 [Source:MGI Symbol;Acc:... [more]
Dclk22.782e-8553.88doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
Dclk21.055e-8453.88doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
Dclk21.066e-8453.88doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
Dclk11.444e-8450.00doublecortin-like kinase 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BWQ5|DCLK3_MOUSE3.714e-10257.25Serine/threonine-protein kinase DCLK3 OS=Mus muscu... [more]
sp|Q9C098|DCLK3_HUMAN6.804e-10255.40Serine/threonine-protein kinase DCLK3 OS=Homo sapi... [more]
sp|Q5MPA9|DCLK2_RAT2.114e-8453.49Serine/threonine-protein kinase DCLK2 OS=Rattus no... [more]
sp|D2I3C6|DCLK2_AILME3.791e-8453.88Serine/threonine-protein kinase DCLK2 OS=Ailuropod... [more]
sp|O08875|DCLK1_RAT4.122e-8448.72Serine/threonine-protein kinase DCLK1 OS=Rattus no... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1S2X41.606e-11051.42Serine/threonine-protein kinase DCLK3 OS=Crassostr... [more]
A0A210QQR81.823e-10757.91Serine/threonine-protein kinase DCLK3 OS=Mizuhopec... [more]
F6SUL18.748e-10758.96Protein kinase domain-containing protein OS=Ciona ... [more]
R7TC903.104e-10557.71Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8IN065.824e-10455.56Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039497.11.060e-8752.24pep primary_assembly:Astyanax_mexicanus-2.0:15:881... [more]
ENSAMXT00000043405.11.132e-8752.24pep primary_assembly:Astyanax_mexicanus-2.0:15:881... [more]
dclk2a1.227e-8745.94doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
dclk2a1.231e-8751.11doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
dclk2a1.720e-8752.33doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010548.13.121e-9148.62pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
ENSPMAT00000008748.11.267e-6241.13pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000003135.12.495e-5740.08pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
phkg1b1.017e-5639.45phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
stk331.604e-5536.01serine/threonine kinase 33 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK14.450e-5640.89Calmodulin-dependent protein kinase; may play a ro... [more]
DUN12.990e-5535.44Cell-cycle checkpoint S/T protein kinase; required... [more]
CMK22.406e-4935.62Calmodulin-dependent protein kinase; may play a ro... [more]
KCC42.074e-4636.33Protein kinase of the bud neck involved in the sep... [more]
GIN42.030e-4537.97Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424328.644e-10052.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444886.444e-9956.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362534.198e-6845.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498982.875e-5839.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445943.241e-5842.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dclk32.219e-8546.62doublecortin like kinase 3 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000003850.22.501e-8553.49serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
ENSORLT00000031333.12.501e-8553.49serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
dclk1a1.282e-8050.38serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
dclk1b5.118e-8049.61serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
back to top
BLAST of Serine/threonine-protein kinase DCLK3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072629.10.000e+099.05SMESG000072629.1[more]
SMESG000072629.10.000e+099.04SMESG000072629.1[more]
SMESG000060309.12.729e-8547.58SMESG000060309.1[more]
SMESG000078466.15.207e-8155.83SMESG000078466.1[more]
SMESG000078466.11.644e-8056.78SMESG000078466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032800 ID=SMED30032800|Name=Serine/threonine-protein kinase DCLK3|organism=Schmidtea mediterranea sexual|type=transcript|length=3366bp
ATTTGCATCGTTAATTATAAATCTCGCTTTTGTTTTATTACATCAATTAT
ATTACCTTCAACCAGTGAAACAATTTAACGGTCTGCTATTTTCACTTTGA
CTAGAATCAAAATATACGGTTCACTATGTCCAGTTATATCAAGTACAATC
CGTCTCAGAGCTTCAGAGACATTACTGACGACTATTATCAAGAACTGAGG
AAGCCGAAGCGAGTTCTTTTTATCGTGAATGGAAATAGAACATTTTCTGG
GAAATTGCTATCTATAACCCCGAACCGCTATTTCATACTTAATGACCTTT
TGGATGATTTGACAAAGTACTTCAGCAACTTTATCCCAACCGGGGTGAGG
AGGATTTATGATAGAAATGGTGGGCAAGTTCAAGATATCGACGATTTGGA
ACATCGCAATATTTATATTTGCTGCGGACAAGAATCTCTGAAGACCTACG
ACTACGACACCAAATATTTTGAATTAATTCATAAAGGTCACCTTCACAAC
CATAATTCACATATCAAATTCTATTACAATCCTCAGGAATATTTTGATAA
TGCCGATTCTACTATTTCGCCTCAGACTCCTTTGTTTTACCGAGGAAATC
GGCTGTACCCGATTAGTTCTACCCCGAATACGTCAAGCAGTAATAAACCA
AGTCCAAGATCTCCTATGAATCGTCTGGAAGAGAGAACCTACAAACCTCC
TATAGCCGAAACGAATATGAAGAGCAAACCTCGAATTTTAACAATTATTC
GGACTGGGATAAAGCCTTATTCATTTTTTAAAATTTTACTAAATAAAACA
AGTTCCCAATCTTATGAAGATCTTCTTTCGGATATTTCTGATGCCTTTGG
TTCAAATTGGAAAGGAAAATCAATACAAAGAATCTACAACATCGACGGAA
AAGAGATTCAACAAACCTCGGACTTCTTTCGTTCAGGAAAATATTTCGTT
GCTATTGGTGACAAAGATCCCAATTTAAATCAAGAAGAAGTCCGAAATAT
TGTTGCGGAATTATTTCCAAATTACGAGAAAATGAGTGACCACAGCGCCG
ATGATAGCAGATTAGTTAAAGACAACAAAACGAAATTTAATAACATGGAA
ATGACTCTCCCGCGGACAGATGAGGATCATTTGTATAGTTCCCCGGACGC
GTCATACAGGAAAACTGATGTCCACCCAAACATGTCAAATCACAATGTCT
CTATTCGACCGAATCACAAAAGCACTCGGGATCAGATACCAAATAAAAAG
AGAAACGGAAAAAAACCATACCAACAACTTCTTGCACCTTATTATTCAGA
AGAACATACAAGTCCTGGTTATCCAAACAATGATTCCAGAAAACCCGGAC
CGTTTGAAATGGCTCCTGAAGAATCTTCTGCAAGGATTTTAACACCAAAA
ATGAGAGCTCAAATTTTTGGGTTGGAAAGAATACGTGCTGGATTAGAAGA
AAGAGAAAAGGCTAGATTTTTGATGGCAAAGAAGCTTGATCAAAGAAATC
CTTCAAAACTTTCTCCGAACAAATATTCATTTAATAATAATCCCGGTAAT
AAAATTCCTCTTTCAAACAAAAAATTTCGTGAGAAATACAAATATTCTCC
CTATCTTGAGTCAATGGATGGATATCGTAATAATAAAGAAAACTTTCAAC
TATCGAAAATTCCCAAATCACAAAGAAGTAAGAAACCTTTGGATTTCGTG
GATAATAACGCGAATCAGAATGTAAATCCCTACAACAAAAAGGTCAAGAA
ACCCGATTCCGACAGAAATCAAATGCGAAATCAGAAAAACAATCAAGTAT
TACTAAACAATAGGAATACAGATACCCAAGATAAGAAAAAACAACCATGG
GAAAGGATCCCACCGATAAATTTGGGCCGGTTCACCCCAAGAAATGATTT
TAATGAAAACTTTCACCAACTACCAGATATTAGGGTATCCCTGCCTACGT
TAACGGAAGAAAATGCGGATAGCAGCAACAAAAATGACCAAAAACCTTTA
GACTTAGTTGAACCAGGTCATCACAAATATAATATTGCTTTTGAAGTAAA
CTTACTGGATACCGACGAAGAGAAAACTGTAAAACATTCCAATCCTTCAT
TGGAAAGTGCTAAGCAGTCGCTCAAAGAACCAAATATTGGTAAAAGTATT
TCTGATTTAAAAGTAAAGAAAGACTCATTAAAATCAGAAATTCCAAAAAA
GCTATCTTTAGCCGGTTTAATTGGTCCTAGAAGCGAAACGGTGAACCTTT
TCATGAAAGGCAAGTCATTCCAAAAGCCAACTAGGACTAAGAAACAGAGC
TCGGTTCTTCAGAATCCCTTGTCCCAACGAATTGTTCCAGTACTTGCTCA
ACAATTGGAAACAGATGAAGATTTTGAAAAATATTATCAACTTGGGAACT
CAATCGGTAGTGGAAACTTTTCAGAAGTCAAAGAAGCGAAGAAAAAAGCC
ACCGGAAAACCATTTGCAGCAAAGATTATAGATAAGAAAAGATTAAAAGA
CAAAGAAGATCTAATCGAGGAAGAAATTCGAATTCTCAAAAGCTGTGAAC
ATCCCAACATCGTGAAACTGGAAGAGCAATTTGAGACTCCAAATAAAGTA
TTTTTGGTTCAAGAGTACATCAAAGAAGGCGACCTCTTTGATGCAATCTG
TGAAAACATAAAATTCCCCGAATCTCAGTCAGCGGTTATGATGAGAGACA
TTTTTAGGGCTCTTCTATACATTCATTCGAAAGGAATAGTCCACAGAGAT
ATCAAACCTGAAAATCTTTTATGCAGCATCAAAAACGGACTAATAAATCT
AAAGTTATCAGACTTTGGATTGGCAGTTGAAATCAAAGAGCCTCTGTATG
TCATTTGCGGAACTCCAACTTATGTAGCTCCAGAAATTCTAAGTGAACAA
GGTTATGGAATCGAAGTGGACATTTGGGCTTCCGGCGTGATCTGTTATAT
CTTACTTTGTGGCTTCCCTCCATTCAGAAGTCCCGAGCGGAATCAAACTG
AGTTATTTGAATTTATCAAAGCCGGAGAATTCGAGTATATAAAACCTTAT
TGGGATGAAATTTCTCCAGAATCAAAAGACCTTATAAACAATATGCTTAT
CGTGGATCCTCTGAAAAGGTTTACTGTTCTCGATTGTCTTTGCCACCCTT
GGATCATAACCCTCGGTAACAGCATCAGGTTTAGCAAGCCAATAAAGGAT
GTTGTAACCGAAACTCGGGTTGAGTTACAAATGGAAACCGCAATTTTCAA
ATCCAATAATACCATTTCTAAAAATACTTCATAATTGTGATGTTTAAAAT
AATAAATATTTATTTTTTAAATTTCATTAAAATCTGCTCTGGATCCAAAC
TGTTCGATGCATAGAG
back to top

protein sequence of SMED30032800-orf-1

>SMED30032800-orf-1 ID=SMED30032800-orf-1|Name=SMED30032800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1053bp
MSSYIKYNPSQSFRDITDDYYQELRKPKRVLFIVNGNRTFSGKLLSITPN
RYFILNDLLDDLTKYFSNFIPTGVRRIYDRNGGQVQDIDDLEHRNIYICC
GQESLKTYDYDTKYFELIHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQ
TPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKS
KPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSI
QRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFPNY
EKMSDHSADDSRLVKDNKTKFNNMEMTLPRTDEDHLYSSPDASYRKTDVH
PNMSNHNVSIRPNHKSTRDQIPNKKRNGKKPYQQLLAPYYSEEHTSPGYP
NNDSRKPGPFEMAPEESSARILTPKMRAQIFGLERIRAGLEEREKARFLM
AKKLDQRNPSKLSPNKYSFNNNPGNKIPLSNKKFREKYKYSPYLESMDGY
RNNKENFQLSKIPKSQRSKKPLDFVDNNANQNVNPYNKKVKKPDSDRNQM
RNQKNNQVLLNNRNTDTQDKKKQPWERIPPINLGRFTPRNDFNENFHQLP
DIRVSLPTLTEENADSSNKNDQKPLDLVEPGHHKYNIAFEVNLLDTDEEK
TVKHSNPSLESAKQSLKEPNIGKSISDLKVKKDSLKSEIPKKLSLAGLIG
PRSETVNLFMKGKSFQKPTRTKKQSSVLQNPLSQRIVPVLAQQLETDEDF
EKYYQLGNSIGSGNFSEVKEAKKKATGKPFAAKIIDKKRLKDKEDLIEEE
IRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPES
QSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA
VEIKEPLYVICGTPTYVAPEILSEQGYGIEVDIWASGVICYILLCGFPPF
RSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFT
VLDCLCHPWIITLGNSIRFSKPIKDVVTETRVELQMETAIFKSNNTISKN
TS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000421tail
PLANA:0003116parenchymal cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 23..111
e-value: 3.4E-11
score: 53.2
coord: 198..285
e-value: 3.7E-4
score: 26.8
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 221..279
e-value: 7.2E-9
score: 35.6
coord: 47..103
e-value: 1.1E-9
score: 38.3
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 28..111
score: 18.015
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 203..280
score: 13.937
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 754..1010
e-value: 2.1E-101
score: 352.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 754..1010
e-value: 1.1E-72
score: 244.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 754..1010
score: 49.559
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 194..281
e-value: 3.7E-21
score: 76.6
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 21..121
e-value: 6.9E-20
score: 72.8
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 22..118
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 200..281
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 745..1052
e-value: 1.8E-88
score: 298.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..179
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 550..564
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 510..583
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 522..538
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..381
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 394..414
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..366
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 716..1025
NoneNo IPR availablePANTHERPTHR24347:SF385SERINE/THREONINE-PROTEIN KINASE DCLK3coord: 716..1025
NoneNo IPR availableCDDcd01617DCXcoord: 28..101
e-value: 6.22414E-12
score: 59.936
NoneNo IPR availableCDDcd16111DCX_DCLK3coord: 201..278
e-value: 7.84882E-24
score: 94.4242
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 760..783
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 871..883
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 739..1025