DnaJ homolog subfamily A member 1

Overview
NameDnaJ homolog subfamily A member 1
Smed IDSMED30032797
Length (bp)1625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ homolog subfamily A member 1 (SMED30032797) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ homolog subfamily A member 1 (SMED30032797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ homolog subfamily A member 1 (SMED30032797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ homolog subfamily A member 1 (SMED30032797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032797SMESG000012107.1 dd_Smed_v4_147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032797SMESG000012107.1 Contig42619newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032797SMESG000012107.1 Contig42619uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032797SMESG000003437.1 Contig3495GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032797SMESG000012107.1 Contig3495GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 402.134 bits (1032), Expect = 7.710e-136
Identity = 228/411 (55.47%), Postives = 300/411 (72.99%), Query Frame = 1
Query:   40 KMVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            KMVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR +YD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G+++HI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV+REKK++EVH++KGM DGQ+I F GEGDQEP LEPGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD+R LV+ +K GEVIK+ + R + +EGMP +K P E G LIIQF V+FPE  +L ++KL +L ++LPP Q     D++   E   L  + PN  N      +  H +AY+ D++G   G    VQC +
Sbjct:   29 KMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVE---LKEFCPNEQN------WRQHREAYEEDEDGPQAG----VQCQT 425          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Match: DNAJA1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:HGNC Symbol;Acc:HGNC:5229])

HSP 1 Score: 400.593 bits (1028), Expect = 1.182e-135
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL+DAKKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 400.208 bits (1027), Expect = 1.406e-135
Identity = 227/410 (55.37%), Postives = 299/410 (72.93%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR +YD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G+++HI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV+REKK++EVH++KGM DGQ+I F GEGDQEP LEPGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD+R LV+ +K GEVIK+ + R + +EGMP +K P E G LIIQF V+FPE  +L ++KL +L ++LPP Q     D++   E   L  + PN  N      +  H +AY+ D++G   G    VQC +
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVE---LKEFCPNEQN------WRQHREAYEEDEDGPQAG----VQCQT 396          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 400.208 bits (1027), Expect = 1.406e-135
Identity = 227/410 (55.37%), Postives = 299/410 (72.93%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR +YD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G+++HI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV+REKK++EVH++KGM DGQ+I F GEGDQEP LEPGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD+R LV+ +K GEVIK+ + R + +EGMP +K P E G LIIQF V+FPE  +L ++KL +L ++LPP Q     D++   E   L  + PN  N      +  H +AY+ D++G   G    VQC +
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVE---LKEFCPNEQN------WRQHREAYEEDEDGPQAG----VQCQT 396          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Match: DNAJA2 (DnaJ heat shock protein family (Hsp40) member A2 [Source:HGNC Symbol;Acc:HGNC:14884])

HSP 1 Score: 362.073 bits (928), Expect = 2.330e-120
Identity = 213/413 (51.57%), Postives = 278/413 (67.31%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGG-----DSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P  SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL++ +KR++YD  GEQ L+EG G     D  F +        F G       G R+G+D++H L V+L++LY G T KL + KNV+C  CSG+GGK GAVQKC+ CRG GV + IRQL PGMVQQMQ+ C  C GE EVINE+DRCK+CEG+KV++E K+LEVH+DKGM  GQ+I F+GE DQ PG+EPGDI ++L+EK H VF R   DL  T K+ LV++LCGF+ T   LD R +VV+  PG+VI+    R +  EGMP+++NPFE G L I+F+V FPE+ ++  DKLS+L  +L PS+   P + + + EE  L  +D    +  GQ R   +  + +       PG    VQCA
Sbjct:    4 VADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLL-PSRPEVP-NIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPG----VQCA 410          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 285.419 bits (729), Expect = 4.357e-91
Identity = 184/384 (47.92%), Postives = 249/384 (64.84%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLE-PGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDR 1191
            MVKET YYD+LGV P+ S+ ELKKAYRK+ALK+HPDKNPD  ++FK+ISQA+EVL+D KKRQIYD+GGE+AL+ GGG     +        F G GG   RG R+ K  +H L VTLD LYKG T+KL I +   C  C G GG EG+ ++C+ CRG G++V + ++GP MVQQMQ+ C +C GE     E+DRCK+C G+K V+E +++EV I  GM DG++  F G+GD+  G+E PGD  +VL+E  H  F RK  +LI    +DL ++LCGF RTI+TLD RT+     PGEVI + + + + NEGMP  +   + G L++QF+V FP D+  P D   KL  +LP  +    +D  +DAE   L   DP  +     +R
Sbjct:    1 MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGGEEALQGGGGGGEGFHNPFDVFDMFFGGGGRGGRGERRVKPTVHNLRVTLDTLYKGVTKKLKISRTATCKGCKGLGGNEGSAKECSDCRGRGIKVRVIRMGP-MVQQMQSHCDSCNGEGSTFLEKDRCKKCNGKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFP-DKINP-DAAKKLADLLPGKR-EEIID--EDAEVVELTELDPQASRRNFAER 378          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 285.419 bits (729), Expect = 4.357e-91
Identity = 184/384 (47.92%), Postives = 249/384 (64.84%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLE-PGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDR 1191
            MVKET YYD+LGV P+ S+ ELKKAYRK+ALK+HPDKNPD  ++FK+ISQA+EVL+D KKRQIYD+GGE+AL+ GGG     +        F G GG   RG R+ K  +H L VTLD LYKG T+KL I +   C  C G GG EG+ ++C+ CRG G++V + ++GP MVQQMQ+ C +C GE     E+DRCK+C G+K V+E +++EV I  GM DG++  F G+GD+  G+E PGD  +VL+E  H  F RK  +LI    +DL ++LCGF RTI+TLD RT+     PGEVI + + + + NEGMP  +   + G L++QF+V FP D+  P D   KL  +LP  +    +D  +DAE   L   DP  +     +R
Sbjct:    1 MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGGEEALQGGGGGGEGFHNPFDVFDMFFGGGGRGGRGERRVKPTVHNLRVTLDTLYKGVTKKLKISRTATCKGCKGLGGNEGSAKECSDCRGRGIKVRVIRMGP-MVQQMQSHCDSCNGEGSTFLEKDRCKKCNGKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFP-DKINP-DAAKKLADLLPGKR-EEIID--EDAEVVELTELDPQASRRNFAER 378          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Match: dnj-19 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O16303])

HSP 1 Score: 206.838 bits (525), Expect = 1.421e-60
Identity = 129/306 (42.16%), Postives = 173/306 (56.54%), Query Frame = 1
Query:  367 VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQ-EPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDK-LSKLRSILPPSQF--ATPLDNLKDAEECVLHPYD-PNMANSKGQDRYHGHHQAYDSDDE--GGMPGGAQRVQ 1263
             +H LNVTL+ELY G T KL + K  +C  C G GGK+G   KC  CRG GV+  ++Q+GPGM+QQMQ  C  CKG    +   D+CK C G+K     K+LEVH+  GM    +I F G+GDQ +P  EPGD+ IV+++K H++F R   DL  T KL L ++LCG+   I  LD   LV+ +K G+VIK    R +  +GMP  K P   G L ++FEV FP++ FL  +K  + L+S  P S+    TP      A E  L  YD    +  +G D Y+      DSD+E  GG  G   R Q
Sbjct:  142 TVHPLNVTLEELYVGKTSKLKLSKKALCKTCEGSGGKKGEKYKCDACRGRGVKTIVQQIGPGMLQQMQVHCDACKGSGGKVPAGDKCKGCHGEKYENVSKILEVHVLPGMKHNDKITFKGDGDQSDPDGEPGDVVIVIQQKDHDIFKRDGDDLHMTKKLSLNEALCGYNFLIKHLDGHPLVLSSKQGDVIKPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPKEHFLDDEKAYAVLKSCFPTSKVVNVTPA-----AAEVSLMEYDEKKYSRGRGGDAYN-----EDSDEEQHGGHHGQGVRCQ 437          

HSP 2 Score: 62.003 bits (149), Expect = 5.235e-10
Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   52 ETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGG 246
            +T  Y  L V P+ S+ ++KK+Y KLA +YHPDKNPD GDKFKEIS A+EVL+  +KR++YD  G
Sbjct:   11 DTTLYTTLNVRPDASQADIKKSYFKLAKEYHPDKNPDHGDKFKEISFAYEVLSSPEKRRLYDARG 75          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Match: dnj-19 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O16303])

HSP 1 Score: 206.838 bits (525), Expect = 1.421e-60
Identity = 129/306 (42.16%), Postives = 173/306 (56.54%), Query Frame = 1
Query:  367 VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQ-EPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDK-LSKLRSILPPSQF--ATPLDNLKDAEECVLHPYD-PNMANSKGQDRYHGHHQAYDSDDE--GGMPGGAQRVQ 1263
             +H LNVTL+ELY G T KL + K  +C  C G GGK+G   KC  CRG GV+  ++Q+GPGM+QQMQ  C  CKG    +   D+CK C G+K     K+LEVH+  GM    +I F G+GDQ +P  EPGD+ IV+++K H++F R   DL  T KL L ++LCG+   I  LD   LV+ +K G+VIK    R +  +GMP  K P   G L ++FEV FP++ FL  +K  + L+S  P S+    TP      A E  L  YD    +  +G D Y+      DSD+E  GG  G   R Q
Sbjct:  142 TVHPLNVTLEELYVGKTSKLKLSKKALCKTCEGSGGKKGEKYKCDACRGRGVKTIVQQIGPGMLQQMQVHCDACKGSGGKVPAGDKCKGCHGEKYENVSKILEVHVLPGMKHNDKITFKGDGDQSDPDGEPGDVVIVIQQKDHDIFKRDGDDLHMTKKLSLNEALCGYNFLIKHLDGHPLVLSSKQGDVIKPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPKEHFLDDEKAYAVLKSCFPTSKVVNVTPA-----AAEVSLMEYDEKKYSRGRGGDAYN-----EDSDEEQHGGHHGQGVRCQ 437          

HSP 2 Score: 62.003 bits (149), Expect = 5.235e-10
Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   52 ETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGG 246
            +T  Y  L V P+ S+ ++KK+Y KLA +YHPDKNPD GDKFKEIS A+EVL+  +KR++YD  G
Sbjct:   11 DTTLYTTLNVRPDASQADIKKSYFKLAKEYHPDKNPDHGDKFKEISFAYEVLSSPEKRRLYDARG 75          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Match: dnj-20 (DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;Acc:Q8MPX3])

HSP 1 Score: 114.005 bits (284), Expect = 1.745e-27
Identity = 121/341 (35.48%), Postives = 177/341 (51.91%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPD---AGDKFKEISQAFEVLADAKKRQIYDEGGEQAL-KEGGGDSGFHN--XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLE--PGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVE----TKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQF 1047
            +Y ILGV  N +  ++KKAYRKLA + HPD+N D   A +KF+++S A+EVL+D +KR +YD  GE+ + K GGG  G H+       D F GG G G   G  KG DV   L VTL+E+Y G+  ++  +K  +  + SG        ++C  CR    E+   Q+G G  Q  Q                  C  C   K+V+E KVLEV ++ G  +G Q  F GEG  EP +E  PGD+   +  + H  F RK  DL   + + L D+L GF+  I  LD   + V+    T PG  ++       ++EGMP  ++  + G L++ F+V FP+ + 
Sbjct:   25 FYKILGVAKNANANQIKKAYRKLAKELHPDRNQDDEMANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKMGGGGGGGHDPFSSFFGDFFGGGGGHGGEEGTPKGADVTIDLFVTLEEVYNGHFVEIK-RKKAVYKQTSG-------TRQCN-CRH---EMRTEQMGQGRFQMFQVKV---------------CDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEG--EPHIEGDPGDLKFKIRIQKHPRFERKGDDLYTNVTISLQDALNGFEMEIQHLDGHIVKVQRDKVTWPGARLRK------KDEGMPSLEDNNKKGMLVVTFDVEFPKTEL 330          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Match: Droj2 (gene:FBgn0038145 transcript:FBtr0082751)

HSP 1 Score: 391.349 bits (1004), Expect = 2.704e-132
Identity = 229/415 (55.18%), Postives = 285/415 (68.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG-FHN---XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+DA KRQ+YDEGGE A+K+GG DSG F N     + F     G  GG  R  R+GKDV+HQ++V L+ELY G TRKL +QKNVICDKC GRGGK+G+++KC  CRG GVE  ++Q+ PG++Q ++  CR C G  E I E+DRCK C G+K VRE+KVLEVHI+KGM DGQ+I F+GEGD EP  +PGDI I+L+EK H+ F     DL+  M L LV++LCGF+R + TLD R L+V T+PGEVI++   + +  EGMP  KNP E G LIIQFEV+FPE   +    +  L+  LPP   A  +D   DAE+ VL  +DP       Q R      AYD DD GG   G +  QC S+
Sbjct:    1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPP---APEVDIPIDAEQTVLEDFDPK------QRRQQHQRMAYDEDD-GGYQDGPRVQQCTSS 403          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Match: Droj2 (gene:FBgn0038145 transcript:FBtr0082754)

HSP 1 Score: 391.349 bits (1004), Expect = 2.704e-132
Identity = 229/415 (55.18%), Postives = 285/415 (68.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG-FHN---XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+DA KRQ+YDEGGE A+K+GG DSG F N     + F     G  GG  R  R+GKDV+HQ++V L+ELY G TRKL +QKNVICDKC GRGGK+G+++KC  CRG GVE  ++Q+ PG++Q ++  CR C G  E I E+DRCK C G+K VRE+KVLEVHI+KGM DGQ+I F+GEGD EP  +PGDI I+L+EK H+ F     DL+  M L LV++LCGF+R + TLD R L+V T+PGEVI++   + +  EGMP  KNP E G LIIQFEV+FPE   +    +  L+  LPP   A  +D   DAE+ VL  +DP       Q R      AYD DD GG   G +  QC S+
Sbjct:    1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPP---APEVDIPIDAEQTVLEDFDPK------QRRQQHQRMAYDEDD-GGYQDGPRVQQCTSS 403          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Match: Droj2 (gene:FBgn0038145 transcript:FBtr0082752)

HSP 1 Score: 391.349 bits (1004), Expect = 2.704e-132
Identity = 229/415 (55.18%), Postives = 285/415 (68.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG-FHN---XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+DA KRQ+YDEGGE A+K+GG DSG F N     + F     G  GG  R  R+GKDV+HQ++V L+ELY G TRKL +QKNVICDKC GRGGK+G+++KC  CRG GVE  ++Q+ PG++Q ++  CR C G  E I E+DRCK C G+K VRE+KVLEVHI+KGM DGQ+I F+GEGD EP  +PGDI I+L+EK H+ F     DL+  M L LV++LCGF+R + TLD R L+V T+PGEVI++   + +  EGMP  KNP E G LIIQFEV+FPE   +    +  L+  LPP   A  +D   DAE+ VL  +DP       Q R      AYD DD GG   G +  QC S+
Sbjct:    1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPP---APEVDIPIDAEQTVLEDFDPK------QRRQQHQRMAYDEDD-GGYQDGPRVQQCTSS 403          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Match: Droj2 (gene:FBgn0038145 transcript:FBtr0082753)

HSP 1 Score: 391.349 bits (1004), Expect = 2.704e-132
Identity = 229/415 (55.18%), Postives = 285/415 (68.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG-FHN---XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+DA KRQ+YDEGGE A+K+GG DSG F N     + F     G  GG  R  R+GKDV+HQ++V L+ELY G TRKL +QKNVICDKC GRGGK+G+++KC  CRG GVE  ++Q+ PG++Q ++  CR C G  E I E+DRCK C G+K VRE+KVLEVHI+KGM DGQ+I F+GEGD EP  +PGDI I+L+EK H+ F     DL+  M L LV++LCGF+R + TLD R L+V T+PGEVI++   + +  EGMP  KNP E G LIIQFEV+FPE   +    +  L+  LPP   A  +D   DAE+ VL  +DP       Q R      AYD DD GG   G +  QC S+
Sbjct:    1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPP---APEVDIPIDAEQTVLEDFDPK------QRRQQHQRMAYDEDD-GGYQDGPRVQQCTSS 403          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Match: Droj2 (gene:FBgn0038145 transcript:FBtr0082755)

HSP 1 Score: 391.349 bits (1004), Expect = 2.704e-132
Identity = 229/415 (55.18%), Postives = 285/415 (68.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG-FHN---XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+DA KRQ+YDEGGE A+K+GG DSG F N     + F     G  GG  R  R+GKDV+HQ++V L+ELY G TRKL +QKNVICDKC GRGGK+G+++KC  CRG GVE  ++Q+ PG++Q ++  CR C G  E I E+DRCK C G+K VRE+KVLEVHI+KGM DGQ+I F+GEGD EP  +PGDI I+L+EK H+ F     DL+  M L LV++LCGF+R + TLD R L+V T+PGEVI++   + +  EGMP  KNP E G LIIQFEV+FPE   +    +  L+  LPP   A  +D   DAE+ VL  +DP       Q R      AYD DD GG   G +  QC S+
Sbjct:    1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPE--VINPSVVPTLKQCLPP---APEVDIPIDAEQTVLEDFDPK------QRRQQHQRMAYDEDD-GGYQDGPRVQQCTSS 403          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 395.971 bits (1016), Expect = 5.721e-134
Identity = 222/411 (54.01%), Postives = 295/411 (71.78%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET +YD+LGV P+ S +ELKKAYRKLALKYHPDKNP  G+KFK+ISQA+EVL+DAKKR++YD GGE+A+KEGG      +   +        GGGR    R+GK+V+HQL V+L++LY G TRKLA+QKNVICDKC GRGG++G ++ C  CRG+GV+V +  L PGMVQQ+ T C  C+G+ + +  RDRCK C G+K++R+KK+LEVHIDKGM DGQ+I F GEGDQEPGL+PGDI IVL+++ H ++TR+  DLI +M+L LV+SLCGF++ I TLDSRTL++ + PGE+IK  + + + NEGMP H+ PFE GKLII F VVFPE+ FLP++KL +L   LP  Q     D++ D     L+ Y    A+ +  D  H  H  +  ++E   P G   VQC ++
Sbjct:    1 MVKETGFYDMLGVKPSASPEELKKAYRKLALKYHPDKNPTEGEKFKQISQAYEVLSDAKKREVYDRGGEKAIKEGGNGG---SCSPMDIFDLFFGGGGRMHRERRGKNVVHQLTVSLEDLYNGTTRKLALQKNVICDKCEGRGGRKGVIEVCPLCRGVGVQVRLHHLAPGMVQQISTVCEGCQGQGQRLGHRDRCKTCTGRKILRQKKILEVHIDKGMKDGQKIVFHGEGDQEPGLKPGDIIIVLDQRAHPLYTRQGDDLIVSMELQLVESLCGFQKPIKTLDSRTLLITSHPGELIKPGDKKCVMNEGMPMHRRPFEKGKLIIHFNVVFPEENFLPLNKLKELERFLPNKQENMESDSMDDD----LYIY----ADLEDCDLSHERHHYHYIEEEDFYPSGG--VQCQTS 398          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2a [Source:ZFIN;Acc:ZDB-GENE-040426-2884])

HSP 1 Score: 362.073 bits (928), Expect = 1.374e-120
Identity = 216/416 (51.92%), Postives = 283/416 (68.03%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGG------DSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P+ SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL + +KR +YD  GEQ L+EGG       D   H        F GG G  R+ G R+G+D++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKCT CRG G+ + IRQLGPGMVQQMQ+ C  C GE EVI+E+DRCK+CEG+KV++E K+LEVH+DKGM  GQ+I F GE DQ PG+EPGDI +VL+EK H  + R+  DL  T K+ LV++LCGF  T+  LD R +VV+   G++I+    R +  EGMP+++NPFE G L I+F+V FP++ +L  +KL +L  +LP    A  +    D EE  L  +D + ++S G  R     +AY+  SD+EGG  G    VQCA
Sbjct:    4 VADTKLYDILGVSPSASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLTNPEKRDMYDRYGEQGLREGGCGGGGMDDIFSHIFGGGLFGFMGGQGRSRNGGRRRGEDMVHPLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKSGAVQKCTACRGRGMRIMIRQLGPGMVQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQKITFGGEADQSPGVEPGDIVLVLQEKEHETYRREGNDLHMTHKIGLVEALCGFHFTLKHLDGRQIVVKYPAGKIIEPGSVRVVRGEGMPQYRNPFEKGDLFIKFDVQFPDNNWLSPEKLKELEDLLPTRADAPVISG--DVEEVDLQEFDMSQSSSGGHRR-----EAYNDSSDEEGGHHGPG--VQCA 410          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Match: dnaja2b (DnaJ heat shock protein family (Hsp40) member A2b [Source:ZFIN;Acc:ZDB-GENE-030131-2884])

HSP 1 Score: 342.813 bits (878), Expect = 4.770e-113
Identity = 211/416 (50.72%), Postives = 274/416 (65.87%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDE------GGEQALKEGGGDSGFH-NXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAY-DSDDEGGMPGGAQRVQCA 1269
            V +TK YD+LGV P+ SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL + +K+ +YD               G  D   H     +F    G     R+ G R+G+D+IH L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKC+TCRG G+ + IRQL PGMVQQMQ+ C  C GE EVI+E+DRCK C+G+KV +E KVLEVH+DKGM  GQ+I FSGE DQ P  EPGDI +VL+EK H  F R   DL    K+ LV++LCGF+  +T LD R LV++  PG+VI+    R +  EGMP+++NPFE G L I+F+V FPE+ ++  +KLS+L  +L PS+   P+ +  D EE  L  +D +  +S G  R     +AY DS DE G P G   VQCA
Sbjct:    4 VADTKLYDLLGVSPSASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLTNPEKKDLYDRYGEQGLREGGGGGAGMEDIFSHIFGGGLFGFMGGQSSKSRNGGRRRGEDMIHPLKVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKTGAVQKCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGEVIHEKDRCKECDGRKVCKEVKVLEVHVDKGMKHGQKITFSGEADQSPNTEPGDIILVLQEKDHEEFRRDGNDLHIGHKIGLVEALCGFQFMLTHLDGRHLVIKYPPGKVIEPGSIRVVRGEGMPQYRNPFEKGDLFIKFDVQFPENGWISTEKLSELEDLL-PSRTEVPVIS-ADTEEVDLQDFDMSQGSSGGHRR-----EAYNDSSDEEGGPHGPG-VQCA 411          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2a [Source:ZFIN;Acc:ZDB-GENE-040426-2884])

HSP 1 Score: 300.056 bits (767), Expect = 2.909e-97
Identity = 152/303 (50.17%), Postives = 207/303 (68.32%), Query Frame = 1
Query:  367 VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            ++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKCT CRG G+ + IRQLGPGMVQQMQ+ C  C GE EVI+E+DRCK+CEG+KV++E K+LEVH+DKGM  GQ+I F GE DQ PG+EPGDI +VL+EK H  + R+  DL  T K+ LV++LCGF  T+  LD R +VV+   G++I+    R +  EGMP+++NPFE G L I+F+V FP++ +L  +KL +L  +LP    A  +    D EE  L  +D + ++S G  R     +AY+  SD+EGG  G    VQCA
Sbjct:   53 MVHPLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKSGAVQKCTACRGRGMRIMIRQLGPGMVQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQKITFGGEADQSPGVEPGDIVLVLQEKEHETYRREGNDLHMTHKIGLVEALCGFHFTLKHLDGRQIVVKYPAGKIIEPGSVRVVRGEGMPQYRNPFEKGDLFIKFDVQFPDNNWLSPEKLKELEDLLPTRADAPVISG--DVEEVDLQEFDMSQSSSGGHRR-----EAYNDSSDEEGGHHGPG--VQCA 346          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Match: CABZ01080568.1 (pep chromosome:GRCz11:25:34662358:34670413:-1 gene:ENSDARG00000051762.6 transcript:ENSDART00000073440.6 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01080568.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.529e-91
Identity = 183/397 (46.10%), Postives = 249/397 (62.72%), Query Frame = 1
Query:   40 KMVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDE 1230
            +MV+ET YYD LGV P+ S  E+KKAYRKLALKYHPDKNP+ G+KFK ISQA++VL+DAKKR++YD+GGEQA+KEGG   G      +        GGGR +  RKGK+++HQL VTL+ELY G+TRKLA+QKNVIC KC G             C   G  +H+  L  G V+ ++       G          C +  G  V     VL +    GM DGQ+I F+GEGDQEPGLEPGD+ I+L+ K H VF RK  +L+  MK+ LV++LCGFK+TI+TLD+R+L++ + PG+VIK  + + + NEGMP ++ PFE G LII+FE+ FP+D +LP   L  L  +LP  +     D++++ + C          + + Q R +   +AY  DDE
Sbjct:    1 EMVRETGYYDQLGVKPDASLDEIKKAYRKLALKYHPDKNPNEGEKFKLISQAYDVLSDAKKRELYDQGGEQAIKEGGMAGG---DSPMDIFNMFFGGGGRMQRERKGKNLVHQLGVTLEELYNGSTRKLALQKNVICQKCDG------------VCNNDGKSIHVGLLRLGFVEIVRQVSLKSSGLD--------CAKISG--VSFFSSVLIMLSIAGMKDGQKITFNGEGDQEPGLEPGDVTIILDLKEHPVFQRKDNNLLMKMKIRLVEALCGFKKTISTLDNRSLLIHSPPGQVIKPNDLKCVHNEGMPVYREPFEKGLLIIRFEIEFPDDHWLPEHMLPDLERLLPVREHIMLTDDMEEVDLC--------QVDFESQQRRNHSAEAYHEDDE 364          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Match: dnaja4.1 (DnaJ heat shock protein family (Hsp40) member A4 [Source:NCBI gene;Acc:780309])

HSP 1 Score: 392.119 bits (1006), Expect = 2.276e-132
Identity = 230/411 (55.96%), Postives = 299/411 (72.75%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD LGV PN +  E+KKAYRKLALKYHPDKNP  G+KFK ISQA+EVL+D KKR +YD+GGEQA+KEGG   G +    +        GGGR    ++GK+V+HQL V+L++LY G +RKLA+QKNVIC KC G GGK+GAV+KCTTC+G GV+V ++Q+GPGMVQQ+Q+ C  C GE E IN++DRCK+C G+KVVREKK+LEVHI+KGM DGQ+I FSGEGDQEPGLEPGD+ IVL++K H+V+ R++ DLI  M + LV++LCGFK+ I T+D R L V + PGEVIK   ++ + NEGMP  ++PFE G LIIQFEV FP++ +LP++KL  L ++LPP +     D   DAE   L  +     + + Q+R H   +AY  D+    PGG   VQC ++
Sbjct:    1 MVKETAYYDTLGVKPNATPDEIKKAYRKLALKYHPDKNPKEGEKFKLISQAYEVLSDPKKRDLYDQGGEQAIKEGGMGGG-NFSSPMDIFDMFFGGGGRMNREKRGKNVVHQLAVSLNDLYNGTSRKLALQKNVICSKCEGYGGKKGAVEKCTTCKGRGVQVRVQQIGPGMVQQIQSMCSDCHGEGERINQKDRCKQCSGKKVVREKKILEVHINKGMKDGQKIMFSGEGDQEPGLEPGDVVIVLDQKEHDVYQRQQNDLIMKMNITLVEALCGFKKPIETMDGRILQVTSFPGEVIKYGHFKCIRNEGMPLQRDPFEKGLLIIQFEVAFPDNHWLPVEKLPLLEALLPPREEEMITD---DAEVVELVEF-----SEQEQNRKH-RGEAYQEDER---PGGG--VQCQTS 396          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Match: mdfic (MyoD family inhibitor domain containing [Source:Xenbase;Acc:XB-GENE-494590])

HSP 1 Score: 380.563 bits (976), Expect = 1.155e-127
Identity = 218/414 (52.66%), Postives = 283/414 (68.36%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG----FHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P  SE +LKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL++ +KR++YD  GEQ L+EG G SG    F +        F G       G R+G+D++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKC+ CRG GV V IRQL PGMVQQMQ+ C  C GE EVINE+DRCK+CEG+KVV+E K++EVH+DKGM  GQ+I FSGE DQ PG+EPGDI +VL+EK H VF R   DL  T ++ LV++LCGF+ T   LD+R +VV+  PG+VI+    R +  EGMP+++NPFE G L I+F+V+FPE+ ++  DKL++L  +LP    A  +    + EE  L  +D    +S GQ R     +AY+  SDDE    G    VQCA
Sbjct:    4 VADTKLYDILGVAPGASENDLKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGSGMDDIFSHIFGGGLFGFMGGQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSSCNGQGGKTGAVQKCSACRGRGVRVMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVVKEVKIIEVHVDKGMKHGQRITFSGEADQAPGVEPGDIVLVLQEKEHEVFQRDGNDLHMTHRIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGSVRVVRGEGMPQYRNPFEKGDLFIKFDVIFPENNWINPDKLTELEDLLPSRPEAPAVSG--ETEEVDLQEFDNTRGSSGGQRR-----EAYNDSSDDESSHHGPG--VQCA 408          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Match: prnp (prion protein [Source:Xenbase;Acc:XB-GENE-952814])

HSP 1 Score: 376.711 bits (966), Expect = 2.996e-126
Identity = 223/411 (54.26%), Postives = 300/411 (72.99%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MV ET YYDILGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL+D+KKR +YD+GGEQA+KEGG   G      +        GGGR +  R+GK+V+HQL+V+L++LY G TRKLA+QKN ICDKC GRGGK+GAV+ C  CRG G+++ I QLGPGMVQQ+Q+ C  C+G+ E IN +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I FSGEGDQEPGLE GDI IVL++K H+VFTR+  DLI  M+++LV++LCGF++ I TLDSRT+++ + PG+++K+ + + + NEGMP ++ P++ G+LI+QF+V FP    +  DKL  L  +LP  +    ++  +D E+  L  +DP+      Q R H + +AY  DD+   P     VQC ++
Sbjct:    1 MVVETAYYDILGVKPNSTPDELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDSKKRDLYDKGGEQAIKEGGMGGGGF-ASPMDIFDMFFGGGGRMQRERRGKNVVHQLSVSLEDLYNGATRKLAVQKNTICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQLGPGMVQQIQSVCPECQGQGERINPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFSGEGDQEPGLEAGDIIIVLDQKDHSVFTRRNEDLIIHMEIELVEALCGFQKPIVTLDSRTIIITSHPGQIVKHGDVKCVLNEGMPIYRRPYDKGRLIVQFQVNFPASNSISPDKLPLLEKLLPARK---EIEETEDMEQAELMDFDPSQ-----QRRRHFNGEAYHDDDDDDHPRSG--VQCQTS 400          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Match: dnaja4.2 (DnaJ (Hsp40) homolog, subfamily A, member 4, gene 2 [Source:NCBI gene;Acc:549744])

HSP 1 Score: 349.747 bits (896), Expect = 9.238e-116
Identity = 204/413 (49.39%), Postives = 284/413 (68.77%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQAL--KEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV P+ S +E+++A+R+LALKYHPDKNP AG+KFK+IS+A+E+L D+ KR++YD GGE AL     G  S F +P+DIF++FFGG      +  RKGK V H L V+L++LY G TRKL++QKN IC KC G G K+G++ KC  C+G G+EVH+    PG++ Q+QT C  C G+ E I  RDRC+ C G+K++REKK+L VHIDKGM  GQ+I F  EGDQ PGL+PGDI IVL++K H VF RK  DL+  M++ L D+LCG +++I TLD RTL+V ++PGEVIK  + + +  EGMP ++N +E G LIIQF++ FPE  +L  + L++L+ + P  +   P+   +D EE  L  Y+P         +  G  +AY+ D+   +P   QRVQC ++
Sbjct:    4 MVKETGYYDLLGVRPSASSEEIRRAFRRLALKYHPDKNPSAGEKFKQISKAYEILHDSHKRELYDRGGEDALTGNSTGCRSAFDSPLDIFNLFFGGSTRVHHQAERKGKSVAHHLPVSLEDLYNGATRKLSLQKNAICAKCKGSGAKQGSITKCPKCQGCGIEVHLLTHIPGVMSQIQTPCSECNGKGECIRLRDRCQVCSGRKIIREKKILTVHIDKGMKSGQKIIFHEEGDQAPGLQPGDIIIVLDQKSHPVFQRKGHDLVMKMEIQLADALCGCRQSIKTLDGRTLLVTSQPGEVIKPGDIKCIPKEGMPIYRNLYEKGSLIIQFQIHFPESGWLNGEHLTQLQGLFPSRE--EPIIT-EDMEEVSLAEYNPYE-----DQKQRGRQEAYEEDE--AVP--LQRVQCQTS 404          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Match: dnaja4.2 (DnaJ (Hsp40) homolog, subfamily A, member 4, gene 2 [Source:NCBI gene;Acc:549744])

HSP 1 Score: 349.747 bits (896), Expect = 1.052e-115
Identity = 204/413 (49.39%), Postives = 284/413 (68.77%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQAL--KEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV P+ S +E+++A+R+LALKYHPDKNP AG+KFK+IS+A+E+L D+ KR++YD GGE AL     G  S F +P+DIF++FFGG      +  RKGK V H L V+L++LY G TRKL++QKN IC KC G G K+G++ KC  C+G G+EVH+    PG++ Q+QT C  C G+ E I  RDRC+ C G+K++REKK+L VHIDKGM  GQ+I F  EGDQ PGL+PGDI IVL++K H VF RK  DL+  M++ L D+LCG +++I TLD RTL+V ++PGEVIK  + + +  EGMP ++N +E G LIIQF++ FPE  +L  + L++L+ + P  +   P+   +D EE  L  Y+P         +  G  +AY+ D+   +P   QRVQC ++
Sbjct:    8 MVKETGYYDLLGVRPSASSEEIRRAFRRLALKYHPDKNPSAGEKFKQISKAYEILHDSHKRELYDRGGEDALTGNSTGCRSAFDSPLDIFNLFFGGSTRVHHQAERKGKSVAHHLPVSLEDLYNGATRKLSLQKNAICAKCKGSGAKQGSITKCPKCQGCGIEVHLLTHIPGVMSQIQTPCSECNGKGECIRLRDRCQVCSGRKIIREKKILTVHIDKGMKSGQKIIFHEEGDQAPGLQPGDIIIVLDQKSHPVFQRKGHDLVMKMEIQLADALCGCRQSIKTLDGRTLLVTSQPGEVIKPGDIKCIPKEGMPIYRNLYEKGSLIIQFQIHFPESGWLNGEHLTQLQGLFPSRE--EPIIT-EDMEEVSLAEYNPYE-----DQKQRGRQEAYEEDE--AVP--LQRVQCQTS 408          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Match: Dnaja4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:MGI Symbol;Acc:MGI:1927638])

HSP 1 Score: 400.593 bits (1028), Expect = 7.121e-136
Identity = 229/410 (55.85%), Postives = 297/410 (72.44%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR IYD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G++VHI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV REKK++EVH++KGM DGQ+I F GEGDQEP L+PGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD R LV+ +K GEVIK+ + + + NEGMP +K P E G +IIQF VVFPE Q+L  +KL +L ++LPP Q     D++   E   L  ++PN      +  +  H +AY+ DDE    G    VQC +
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNVICEKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHGEGDQEPELDPGDVIIVLDQKDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLVISSKSGEVIKHGDLKCIRNEGMPIYKAPLEKGVMIIQFLVVFPEKQWLSQEKLPQLEALLPPRQKVRITDDMDQVE---LKEFNPN------EQSWRQHREAYEEDDEEPRAG----VQCQT 396          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Match: Dnaja4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:MGI Symbol;Acc:MGI:1927638])

HSP 1 Score: 400.593 bits (1028), Expect = 7.121e-136
Identity = 229/410 (55.85%), Postives = 297/410 (72.44%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR IYD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G++VHI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV REKK++EVH++KGM DGQ+I F GEGDQEP L+PGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD R LV+ +K GEVIK+ + + + NEGMP +K P E G +IIQF VVFPE Q+L  +KL +L ++LPP Q     D++   E   L  ++PN      +  +  H +AY+ DDE    G    VQC +
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNVICEKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHGEGDQEPELDPGDVIIVLDQKDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLVISSKSGEVIKHGDLKCIRNEGMPIYKAPLEKGVMIIQFLVVFPEKQWLSQEKLPQLEALLPPRQKVRITDDMDQVE---LKEFNPN------EQSWRQHREAYEEDDEEPRAG----VQCQT 396          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Match: Dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:MGI Symbol;Acc:MGI:1270129])

HSP 1 Score: 400.593 bits (1028), Expect = 8.112e-136
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVLAD+KKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Match: Dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:MGI Symbol;Acc:MGI:1270129])

HSP 1 Score: 400.593 bits (1028), Expect = 8.112e-136
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVLAD+KKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Match: Dnaja2 (DnaJ heat shock protein family (Hsp40) member A2 [Source:MGI Symbol;Acc:MGI:1931882])

HSP 1 Score: 363.229 bits (931), Expect = 5.599e-121
Identity = 213/413 (51.57%), Postives = 279/413 (67.55%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGG-----DSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P  SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL++ +KR++YD  GEQ L+EG G     D  F +        F G       G R+G+D++H L V+L++LY G T KL + KNV+C  CSG+GGK GAVQKC+ CRG GV + IRQL PGMVQQMQ+ C  C GE EVINE+DRCK+CEG+KV++E K+LEVH+DKGM  GQ+I F+GE DQ PG+EPGDI ++L+EK H VF R   DL  T K+ LV++LCGF+ T   LD+R +VV+  PG+VI+    R +  EGMP+++NPFE G L I+F+V FPE+ ++  DKLS+L  +L PS+   P + + + EE  L  +D    +  GQ R   +  + +       PG    VQCA
Sbjct:    4 VADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLL-PSRPEVP-NVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPG----VQCA 410          
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q5NVI9|DNJA1_PONAB (DnaJ homolog subfamily A member 1 OS=Pongo abelii OX=9601 GN=DNAJA1 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.975e-135
Identity = 229/411 (55.72%), Postives = 303/411 (73.72%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL+DAKKR++YD+GGEQA+KE              D+F    GGGR +  R+GK+V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKE---GGAGGGFGSPMDIFDMFFGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 396          
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Match: sp|Q9JMC3|DNJA4_MOUSE (DnaJ homolog subfamily A member 4 OS=Mus musculus OX=10090 GN=Dnaja4 PE=1 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.981e-135
Identity = 229/410 (55.85%), Postives = 297/410 (72.44%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET+YYDILGV P+ S +E+KKAYRKLALKYHPDKNPD G+KFK ISQA+EVL+D KKR IYD+GGEQA+KEGG  S       +        GGGR    R+GK+V+HQL+VTL++LY G T+KLA+QKNVIC+KC G GGK+G+V+KC  C+G G++VHI+Q+GPGMVQQ+QT C  CKG+ E IN +DRC+ C G KV REKK++EVH++KGM DGQ+I F GEGDQEP L+PGD+ IVL++K H+VF R+  DLI  MK+ L ++LCGFK+TI TLD R LV+ +K GEVIK+ + + + NEGMP +K P E G +IIQF VVFPE Q+L  +KL +L ++LPP Q     D++   E   L  ++PN      +  +  H +AY+ DDE    G    VQC +
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGS-PSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNVICEKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHGEGDQEPELDPGDVIIVLDQKDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLVISSKSGEVIKHGDLKCIRNEGMPIYKAPLEKGVMIIQFLVVFPEKQWLSQEKLPQLEALLPPRQKVRITDDMDQVE---LKEFNPN------EQSWRQHREAYEEDDEEPRAG----VQCQT 396          
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Match: sp|P63036|DNJA1_RAT (DnaJ homolog subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Dnaja1 PE=1 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 5.674e-135
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVLAD+KKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Match: sp|P63037|DNJA1_MOUSE (DnaJ homolog subfamily A member 1 OS=Mus musculus OX=10090 GN=Dnaja1 PE=1 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 5.674e-135
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVLAD+KKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Match: sp|P31689|DNJA1_HUMAN (DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2)

HSP 1 Score: 400.593 bits (1028), Expect = 5.674e-135
Identity = 237/411 (57.66%), Postives = 309/411 (75.18%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET YYD+LGV PN +++ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL+DAKKR++YD+GGEQA+KEGG   GF +PMDIFDMFFGG G  +     K   V+HQL+VTL++LY G TRKLA+QKNVICDKC GRGGK+GAV+ C  CRG G+++ I Q+GPGMVQQ+Q+ C  C+G  E I+ +DRCK C G+K+VREKK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL++K H VFTR+  DL   M + LV++LCGF++ I+TLD+RT+V+ + PG+++K+ + + + NEGMP ++ P+E G+LII+F+V FPE+ FL  DKLS L  +LP  +     D +   E   L  +DPN      + R H + +AY+ DDE    GG   VQC ++
Sbjct:    1 MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKN--VVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQVE---LVDFDPNQ-----ERRRHYNGEAYE-DDEHHPRGG---VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Match: G8IIK6 (Heat shock protein 40 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 377/411 (91.73%), Postives = 396/411 (96.35%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKETKYYDILGV+PNVSEQELKKAYRKLALKYHPDKNPDAGDKFKEISQAFEVLAD KKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGR+RGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKC+GRGGKEGAVQKC +CRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCK+CEGQKV REKKVLEVHIDKGM+DGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIY MKLDL+DSLCGFKRTITTLD R LV+ETKPGEVIKNLEYRA+ENEGMPK+K+PFE G+LII F+VVFPE+ FLP DKL+KLRSILPPSQF++ LDN+ +AEECVLHPYDPNMANSKGQDRYH  HQ YDSDDEGGMPGGAQRVQCASN
Sbjct:    1 MVKETKYYDILGVNPNVSEQELKKAYRKLALKYHPDKNPDAGDKFKEISQAFEVLADPKKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGRNRGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCNGRGGKEGAVQKCGSCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKKCEGQKVAREKKVLEVHIDKGMTDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYNMKLDLIDSLCGFKRTITTLDGRVLVIETKPGEVIKNLEYRAIENEGMPKYKSPFERGRLIIAFDVVFPENNFLPTDKLNKLRSILPPSQFSSQLDNINEAEECVLHPYDPNMANSKGQDRYHERHQVYDSDDEGGMPGGAQRVQCASN 411          
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Match: A0A4S2M681 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002397 PE=3 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 5.657e-157
Identity = 254/413 (61.50%), Postives = 326/413 (78.93%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGD-SGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNL-KDAEECVLHPYDPNMANSKGQDRYHGHH-QAYDSDDEGGMPGGAQRVQCAS 1272
            MV+ETKYYD+LGVHPN + +E+KKAYRKLAL++HPDK+ D G+KFKEISQAFEV++D KKR+IYDEGGEQA+KEGG + SGFHNPMDIF+MFFGG G  R     K    ++QL+V L+ELY G  RKL+I +N IC KC GRGGK GAVQ+C TCRG GV+ HIRQLG G VQQ+Q+TC  C+GERE+I+ +D CK CEG+KVVREKKV+EV IDKGM+DG+ IKF+GEGD+EPGLEPGD+ IV++E+ H+ F R++ DLIYTM L L ++LCGF RTI TLD+RTLV+ +KPGEV  + +YRA+E EGMP++K+PFE G+LI++F+V+FP + FLP +KL++LR +LPP      +D++ +DAEE VLHP+DP     +   ++HG   +AYD DD     GG  RVQCAS
Sbjct:    1 MVRETKYYDVLGVHPNATPEEIKKAYRKLALQHHPDKSKDNGEKFKEISQAFEVISDPKKRRIYDEGGEQAIKEGGAEGSGFHNPMDIFEMFFGGGGRSRGPRRGKD--AVYQLSVKLEELYNGCVRKLSITRNSICSKCDGRGGKSGAVQQCRTCRGTGVQTHIRQLGIGYVQQIQSTCSVCRGEREIIDPKDCCKTCEGKKVVREKKVIEVPIDKGMADGESIKFAGEGDREPGLEPGDVIIVIDEQAHDRFVRRRTDLIYTMSLTLNEALCGFTRTIDTLDNRTLVLTSKPGEVFTSSDYRAIEGEGMPRYKSPFEKGRLIVRFQVIFPPNNFLPTNKLNQLRELLPP---PVHIDDIPQDAEEVVLHPFDP----ERDTQQHHGRRAEAYDDDD--ATEGGNPRVQCAS 402          
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Match: H2KPA7 (DnaJ homolog subfamily A member 1 OS=Clonorchis sinensis OX=79923 GN=DNAJA1 PE=3 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 5.657e-157
Identity = 254/413 (61.50%), Postives = 326/413 (78.93%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGD-SGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNL-KDAEECVLHPYDPNMANSKGQDRYHGHH-QAYDSDDEGGMPGGAQRVQCAS 1272
            MV+ETKYYD+LGVHPN + +E+KKAYRKLAL++HPDK+ D G+KFKEISQAFEV++D KKR+IYDEGGEQA+KEGG + SGFHNPMDIF+MFFGG G  R     K    ++QL+V L+ELY G  RKL+I +N IC KC GRGGK GAVQ+C TCRG GV+ HIRQLG G VQQ+Q+TC  C+GERE+I+ +D CK CEG+KVVREKKV+EV IDKGM+DG+ IKF+GEGD+EPGLEPGD+ IV++E+ H+ F R++ DLIYTM L L ++LCGF RTI TLD+RTLV+ +KPGEV  + +YRA+E EGMP++K+PFE G+LI++F+V+FP + FLP +KL++LR +LPP      +D++ +DAEE VLHP+DP     +   ++HG   +AYD DD     GG  RVQCAS
Sbjct:    1 MVRETKYYDVLGVHPNATPEEIKKAYRKLALQHHPDKSKDNGEKFKEISQAFEVISDPKKRRIYDEGGEQAIKEGGAEGSGFHNPMDIFEMFFGGGGRSRGPRRGKD--AVYQLSVKLEELYNGCVRKLSITRNSICSKCDGRGGKSGAVQQCRTCRGTGVQTHIRQLGIGYVQQIQSTCSVCRGEREIIDPKDCCKTCEGKKVVREKKVIEVPIDKGMADGESIKFAGEGDREPGLEPGDVIIVIDEQAHDRFVRRRTDLIYTMSLTLNEALCGFTRTIDTLDNRTLVLTSKPGEVFTSSDYRAIEGEGMPRYKSPFEKGRLIVRFQVIFPPNNFLPTNKLNQLRELLPP---PVHIDDIPQDAEEVVLHPFDP----ERDTQQHHGRRAEAYDDDD--ATEGGNPRVQCAS 402          
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Match: A0A074ZVL8 (DnaJ domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_03526 PE=3 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 1.076e-156
Identity = 254/413 (61.50%), Postives = 326/413 (78.93%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGD-SGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNL-KDAEECVLHPYDPNMANSKGQDRYHGHH-QAYDSDDEGGMPGGAQRVQCAS 1272
            MV+ETKYYD+LGVHPN + +E+KKAYRKLAL++HPDK+ D G+KFKEISQAFEV++D KKR+IYDEGGEQA+KEGG + SGFHNPMDIF+MFFGG G  R     K    ++QL+V L+ELY G  RKL+I +N IC KC GRGGK GAVQ+C TCRG GV+ HIRQLG G VQQ+Q+TC  C+GERE+I+ +D CK CEG+KVVREKKV+EV IDKGM+DG+ IKF+GEGD+EPGLEPGD+ IV++E+ H+ F R++ DLIYTM L L ++LCGF RTI TLD+RTLV+ +KPGEV  + +YRA+E EGMP++K+PFE G+LI++F+V+FP + FLP +KL++LR +LPP      +D++ +DAEE VLHP+DP     +   ++HG   +AYD DD     GG  RVQCAS
Sbjct:    1 MVRETKYYDVLGVHPNATPEEIKKAYRKLALQHHPDKSKDNGEKFKEISQAFEVISDPKKRRIYDEGGEQAIKEGGAEGSGFHNPMDIFEMFFGGGGRSRGPRRGKD--AVYQLSVKLEELYNGCVRKLSITRNSICSKCDGRGGKSGAVQQCRTCRGTGVQTHIRQLGIGYVQQIQSTCSVCRGEREIIDPKDCCKTCEGKKVVREKKVIEVPIDKGMADGESIKFAGEGDREPGLEPGDVIIVIDEQAHDRFVRRRTDLIYTMPLTLNEALCGFTRTIDTLDNRTLVLTSKPGEVFTSSDYRAIEGEGMPRYKSPFEKGRLIVRFQVIFPPNNFLPTNKLNQLRELLPP---PVHIDDIPQDAEEVVLHPFDP----ERDTQQHHGRRAEAYDDDD--ATEGGNPRVQCAS 402          
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Match: A0A267FJQ0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009083g1 PE=3 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 3.302e-156
Identity = 263/423 (62.17%), Postives = 316/423 (74.70%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYH--------GHHQA----YDSDDEGGMPGGAQRVQCASN 1275
            MVKETK+YD+LGV PN SEQELKKAYRKLALKYHPDKNP+AGDKFKEI+ AFEVL+D KKR+IYDEGGEQALKEG    GF     +        GGGRSRGPR+GKDV+HQL VTL+ELY G TRKLA+QKNV+CDKC GRGGK GAVQ C+ CRG G+EVH+RQL PGMVQQ+QT CR C+G+ EVIN +DRCK+CEG+KV REKK+LEV+IDKGM DGQQI+F+GEGDQ+P LEPGDI IVLEE+ H  F R+  DLI  + ++L +SL GFKR I TLD R+L++E++PGEVI++  Y+ +E+EGMP +KNPFE G+LII F V FP   FL   +L +LR +LPP Q     D   DAEE V+  +DP M   + +D           G  +A     DSDDE G  GG QRVQCAS+
Sbjct:    1 MVKETKFYDLLGVTPNASEQELKKAYRKLALKYHPDKNPEAGDKFKEIAMAFEVLSDPKKRKIYDEGGEQALKEGTPGEGFSFHNPMDIFDMFFGGGGRSRGPRRGKDVVHQLGVTLEELYNGATRKLAVQKNVVCDKCEGRGGKAGAVQACSNCRGSGMEVHLRQLAPGMVQQIQTVCRNCQGQGEVINAKDRCKKCEGRKVNREKKILEVNIDKGMKDGQQIRFTGEGDQDPELEPGDIVIVLEEREHETFIRRSRDLILKLTINLNESLTGFKRVIGTLDQRSLLIESRPGEVIRHGSYKTVEHEGMPTYKNPFEKGRLIIHFTVEFPPTGFLSEKELKQLRKLLPPGQEVIVPD---DAEETVMTEFDPEMDARQQRDERMRSQFGGRGGFMRAAAGGADSDDEDG-AGGGQRVQCASS 419          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:NCBI gene;Acc:103041445])

HSP 1 Score: 393.275 bits (1009), Expect = 5.226e-133
Identity = 225/397 (56.68%), Postives = 301/397 (75.82%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGG-GDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDR-YHGHHQAYDSDD 1227
            MV+ET YYDILGV P  S  E+KKAYRKLALKYHPDKNP+ G+KFK ISQA+EVLAD KKR +YD+GGEQA+KEGG G   F +PMDIF+MFFGG GGGR +  R+GK+V+HQL VTL+E+Y G+TRKL +QKNV+C+KC G GGK+G ++KC+ C+G GV++ ++Q+GPGM+QQ+Q+ C  C+G+ E  + +DRCK C GQKV R+KK+LEVHIDKGM DGQ+I F GEGDQEP LEPGD+ IVLE+K H VF R++ +LI  M++ LV++LCGFK+TI TLD+RTL++ + PG+VIK  + + ++NEGMP +++P+E G LIIQFEV FP++ +LP +    L   LP        D+++D + C +        +++ Q R Y G  +AYD DD
Sbjct:    1 MVRETGYYDILGVSPKASADEIKKAYRKLALKYHPDKNPNEGEKFKLISQAYEVLADPKKRDLYDQGGEQAIKEGGMGGGDFSSPMDIFNMFFGGGGGGRGQRERRGKNVVHQLGVTLEEMYNGSTRKLGLQKNVVCEKCDGYGGKKGTLEKCSNCKGKGVQIKVQQIGPGMIQQIQSMCSECQGQGEKFSAKDRCKNCNGQKVERKKKILEVHIDKGMKDGQKITFHGEGDQEPDLEPGDVIIVLEQKEHPVFQRQEENLIMKMQIKLVEALCGFKKTIRTLDNRTLIISSPPGQVIKPNDVKCIQNEGMPLYRDPYEKGLLIIQFEVEFPDNHWLPDNMFPALEQFLPRRDDVMITDDMEDVDLCEV--------DTESQRRKYSG--EAYDEDD 387          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 368.237 bits (944), Expect = 2.527e-123
Identity = 219/412 (53.16%), Postives = 289/412 (70.15%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXX-XXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKET +YD+LGV PN S  ELKKAYRKLALKYHPDKNP  G+KFK+ISQA+EVL+DAKKR++YD GGE+A+KEGG  SG        D+F    GG  R +  RK K+V+HQL V+L+ELY G T+KLA+QKNVIC+KC      EGA++ C +CRG GV+V + QL PGMVQQ+ T C  C G+ + ++ RDRCK C G+K++R+KK+LEVHIDKGM D Q+I F GEGDQEPGLEPGDI IVL ++ H VFTR   DLI TM L LV+SLCGF++ +  LD+R L++ + PGE+I+  + + + NEGMP ++ PFE G+LII F VVFPE  FLP+DKL +L    P ++  +  D+++D         D ++++ + Q     HH  Y  ++E   PGG   VQC ++
Sbjct:    1 MVKETGFYDLLGVKPNASPDELKKAYRKLALKYHPDKNPTEGEKFKQISQAYEVLSDAKKREVYDRGGEKAIKEGGNGSGGGGFGSPLDIFNMFFGGGSRMQRERKVKNVVHQLTVSLEELYNGATKKLAVQKNVICEKC------EGAMEVCPSCRGTGVQVRLHQLVPGMVQQISTICGGCHGQGQRLSHRDRCKACAGRKILRQKKILEVHIDKGMKDEQKIVFHGEGDQEPGLEPGDIIIVLNQREHPVFTRHDEDLIMTMDLQLVESLCGFEKPVNALDNRVLLIRSHPGELIRPGDKKCVLNEGMPIYRRPFEKGRLIIHFNVVFPEANFLPVDKLKQLEQYFPDTREKSESDSMEDDLYIYADLEDCDLSHRRRQ-----HH--YIEEEEDFHPGGG--VQCQTS 397          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Match: dnaja2b (DnaJ heat shock protein family (Hsp40) member A2b [Source:ZFIN;Acc:ZDB-GENE-030131-2884])

HSP 1 Score: 345.895 bits (886), Expect = 2.628e-114
Identity = 209/416 (50.24%), Postives = 275/416 (66.11%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDE------GGEQALKEGGGDSGFH-NXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAY-DSDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P  +E ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL + +K+ +YD               G  D   H     +F    G     R+ G ++G+D++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKCTTCRG G+ + IRQL PGMVQQMQT C  C GE EVI+ERDRCK+CEG+KV++E KVLEVH+DKGM  GQ+I FSGE DQ P  EPGDI +VL+EK H VF R   DL  +  + LV++LCGF+ T+T LD R L+++   G+VI+    R +  EGMP+++NPFE G L I+F+V FP++ ++  +KL++L  +L PS+   P+ +  D EE  L  +D +  +S    R     +AY DS DE G P G   VQCA
Sbjct:    4 VVDTKLYDILGVSPTATENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLTNPEKKDLYDRYGEQGLREGGGGGAGMEDIFSHIFGGGLFGFMGGQSSRSRNGGRKRGEDMVHPLKVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKTGAVQKCTTCRGRGMRIMIRQLAPGMVQQMQTVCSDCSGEGEVISERDRCKQCEGRKVIKEMKVLEVHVDKGMKHGQKITFSGEADQSPNTEPGDIILVLQEKEHEVFRRDGNDLHMSQTIGLVEALCGFQLTLTHLDGRHLLIKYPAGKVIEPGSTRVVRGEGMPQYRNPFEKGDLYIKFDVRFPDNGWISTEKLTELEDLL-PSREEVPVIS-ADTEEVDLQEFDMSQGSSGSHRR-----EAYNDSSDEEGGPHGPG-VQCA 411          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2 [Source:NCBI gene;Acc:103044841])

HSP 1 Score: 342.813 bits (878), Expect = 3.439e-113
Identity = 213/416 (51.20%), Postives = 285/416 (68.51%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGG------DSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P+ SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL++ +K+++YD  GEQ L+EGGG      D   H        F GG    R+ G R+G+D++H L V+L+++Y G T KL + KNV+C  C+G+GGK GAVQKCTTCRG G+ + IRQL PGMVQQMQ+ C  C GE EVI+E+DRCK+CEG+KVV+E K+LEVH+DKGM  GQ+I F GE DQ PG EPGDI +VL+EK H  + R   DL  T K+ LV++LCGF+ T+  LD R +VV+   G+VI+    + +  EGMP+++NPFE G L I+F+V FP++ ++  +KL++L  +LP    + P     + EE  L  +D + ++S G  R     +AY+  SD+EGG  G    VQCA
Sbjct:    4 VVDTKLYDILGVSPSASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKKELYDRYGEQGLREGGGGGPGMDDIFSHIFGGGLFGFMGGQSRSRNGGRRRGEDMVHPLKVSLEDVYNGKTTKLQLSKNVLCSTCNGQGGKSGAVQKCTTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVVKEVKILEVHVDKGMKHGQKITFGGEADQAPGTEPGDIVLVLQEKEHETYKRDGHDLHMTHKIGLVEALCGFQFTLKHLDGRQIVVKYPAGKVIEPGSVKVVRGEGMPQYRNPFEKGDLFIKFDVQFPDNNWISPEKLAELEDLLP--MRSDPPVVTGETEEVDLQDFDMSQSSSGGHRR-----EAYNDSSDEEGGHHGPG--VQCA 410          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Match: dnajb11 (DnaJ heat shock protein family (Hsp40) member B11 [Source:NCBI gene;Acc:103041146])

HSP 1 Score: 141.739 bits (356), Expect = 4.025e-37
Identity = 127/359 (35.38%), Postives = 184/359 (51.25%), Query Frame = 1
Query:    1 LEKRCCIWLKTL*KMVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPD---AGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG---FHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVE----TKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQF 1047
            L   CC+ L  +  ++    +Y ILGV  + S +++KKAYRKLAL+ HPD+NPD   A DKF ++  A+EVL+D +KR+ YD  GE+ LKEG   S    F +    F   FGG    + R   +G D+I  L VTL+E+Y GN  ++   K +          KE   ++   CR    E+   QLGPG  Q  Q          EV+     C  C   K+V E++ LEV I++G+ D  +  F GEG+     EPGD+   ++   H +F R+  DL   + + LV++L GF+  IT LD   + +     TKPG  +        + EG+P   N    G LII F+V FP++Q 
Sbjct:    8 LSSICCLLLYLVATVLAGRDFYKILGVSKSASIKDIKKAYRKLALQLHPDRNPDDPSAQDKFADLGAAYEVLSDEEKRKQYDAYGEEGLKEGHHSSHGDIFSSFFGDFGFMFGGNRQQQDRNIPRGNDIILDLEVTLEEVYSGNFVEVVRNKPI---------AKEAPGKRKCNCRQ---EMRTTQLGPGRFQMTQ----------EVV-----CDECPNIKLVNEERTLEVEIEQGVRDEMEYPFIGEGEPHIDGEPGDLRFRIKVLKHPLFERRGDDLYTNVTISLVEALVGFEMQITHLDGHKVHIARDKITKPGSRLWK------KGEGLPNFDNNNIRGSLIITFDVDFPKEQL 333          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 379.022 bits (972), Expect = 3.600e-128
Identity = 219/408 (53.68%), Postives = 285/408 (69.85%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHH--QAYDSDDEG------GMP 1242
            MVKET YYD LGV+PN + +ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL D KKR++YD GGEQALK G  +SG      +        GG R    R+GK+ +HQL+V L+E+Y G+TRKLA+QKNV+C KC GRGG++GAV++C  CRG G+ + I+Q+G GMVQQ+Q+ C  C G  E IN R RC+ C G+K+VREKK+LEVHI KGM DGQ+I F GEGDQ+P LEPG I IVL++K H VF R++ DL+  M+++LV++LCGF+R+I TLD+RT+++ +  GEVIK  + + + NEGMP +++PFE G+LIIQF V FP   FLP  KL +L ++LP  +     D   D E  VL   DP         RYH H+  Q Y  DD+       GMP
Sbjct:    1 MVKETAYYDTLGVNPNATHEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLLDPKKRELYDMGGEQALKGGSSNSGNGFSSPMDIFDLFFNGGTRMHRERRGKNAVHQLSVGLEEMYNGSTRKLALQKNVLCAKCEGRGGRKGAVERCVPCRGTGMYLQIQQIGLGMVQQIQSVCPECHGHGERINPRHRCRYCNGRKIVREKKILEVHISKGMKDGQKITFYGEGDQDPDLEPGHIIIVLDQKEHPVFHRREDDLVMKMEIELVEALCGFQRSIKTLDNRTILITSHQGEVIKEGDVKCILNEGMPLYRDPFEKGRLIIQFSVKFPLAGFLPAHKLPQLEALLPRRERYVQSD---DTEVVVLTELDP------AHGRYHSHYAGQVYMEDDDADYHQPRGMP 399          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 265.003 bits (676), Expect = 1.220e-84
Identity = 165/334 (49.40%), Postives = 218/334 (65.27%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGG----KEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKV--LEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEV 1026
            MVKET YYD+LGV PN +  ELKKAYRKLALKYHPDKNP+ G+KFK+ISQA+EVL+DAKKR++YD GGEQA+KEGG          +        GGG  +   KGK+V+HQ++V+L++LY G TRKL++QKNVICDKC G       K      C      G  V     G G+       C  C  + + ++ +     C  Q +    K+  L ++  KGM+D Q+I F GEGDQEPGL+PGD+ IVL++K H+VF RK  DL+  M++ L ++LCGF+R I TLD+RT+V+ + PGEVIK    + + NEGMP H+NPFE G+LII F+V
Sbjct:    1 MVKETAYYDLLGVKPNSTADELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDRGGEQAIKEGGAGGSGGFSSPMDIFNMFFGGGGSMQRETKGKNVVHQISVSLEDLYNGATRKLSMQKNVICDKCEGESNFLVTKPFNQNWCPRGVMTGYSVRCCVFGGGVFVFCAGHC-FCLSQVKTVSPKQHVGWCCQQFIPASVKIYLLAINSAKGMTDNQKISFYGEGDQEPGLDPGDVIIVLDQKEHDVFRRKGQDLLMEMEISLTEALCGFRRPIKTLDNRTIVITSHPGEVIKYDAIKCVLNEGMPFHRNPFEKGRLIIHFKV 333          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 182.57 bits (462), Expect = 4.416e-55
Identity = 100/195 (51.28%), Postives = 133/195 (68.21%), Query Frame = 1
Query:  691 GMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            GM DGQ+I+F GEGDQEPGLEPGD+ IVLE+K H VF R+  DLI  M+++LV++LCGF+R I+TLD R +V+ + PGEVIK+ E + + NEGMP  +NPFE G+LIIQF+VVFP   FLPI  L++L ++LPP Q A       D EE +L   DP       + RY   ++AY  ++EG  P  +  VQC S+
Sbjct:    1 GMKDGQKIQFGGEGDQEPGLEPGDVIIVLEQKEHPVFHRQGQDLIREMEIELVEALCGFQRPISTLDDRVIVITSHPGEVIKHGEVKCILNEGMPILRNPFEKGRLIIQFKVVFPPSGFLPIHGLAQLEALLPPRQEAL---ITGDMEEAMLIDIDP----VSEERRY--KNEAYQEEEEGHGPRRSG-VQCQSS 185          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2a [Source:ZFIN;Acc:ZDB-GENE-040426-2884])

HSP 1 Score: 169.859 bits (429), Expect = 1.696e-47
Identity = 148/430 (34.42%), Postives = 209/430 (48.60%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGG----DSGFHNXXXXXXXXXXXXXXXXXXXXXXXXX------VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDK-----GMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPH----NVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYD-PNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +T+ Y++LGV P  +E +LKKAYRKLA +YHPDKNPDAGDKFKEIS A+EVL++ +KR +YD  GE+ L+EGGG    D  F +            GGG   G            ++H L V+L++LY+     ++  KN   + C  R G  G +  C  C        I    P   + +   C  C+      N    C  C       E++V  +H+ K     GM+    I+F GEG + P  E   + ++     H     VF R   DL    K+ L ++LCG + T+  LD R ++V   PG VI+    R +  EGMP ++NPFE G L I+F+V FP+  ++   +  +L   L P +   P     + EE  LH  +        G     G  +AY+  SDDEGG   G   VQCA
Sbjct:    4 VADTRLYELLGVSPTANEGDLKKAYRKLAKEYHPDKNPDAGDKFKEISFAYEVLSNPEKRDLYDRHGEKGLREGGGGPGMDDIFSHIFGGGLFGGFMGGGGGRGGHPGAGRRRRGEDMMHPLKVSLEDLYRATWALVSCAKNTAVEVCLWRVGASGRICLCHNCSEANSRAGISHAVPSSQEWLAALCNECR------NRSAPCP-CRASPRTAERRVRFIHLQKRAVHAGMAHTHMIRFKGEGPRGPCNERIFLLVLTTTTMHCRHTKVFQRDGNDLHMMKKIGLAEALCGVRFTLAHLDGRQILVTYPPGNVIQPGCIRGIVGEGMPHYRNPFEKGNLYIKFDVEFPDKNWID-GEKLELLEKLLPERPTLPRPTSGEFEEVDLHELEATRGGAGGGAGGPGGRREAYEDGSDDEGGYQQGPG-VQCA 424          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Match: dnajb11 (DnaJ heat shock protein family (Hsp40) member B11 [Source:ZFIN;Acc:ZDB-GENE-031113-9])

HSP 1 Score: 112.849 bits (281), Expect = 4.130e-28
Identity = 104/310 (33.55%), Postives = 149/310 (48.06%), Query Frame = 1
Query:  199 EVLADAKKRQIYDEGGEQALKEGG----GDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGE------GDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVV----ETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSIL 1086
            +VL++ +KR+ YD  GE+ LKEGG     D+  H   D    FFGG    + R   +G DV+ +L VTL+E+Y GN  ++   K V   + SG+       ++C  CR    E+   QLGPG  Q  Q T                C  C   K+V E++ LEV I+ G+ DG +  F GE      G+     EPGD+   ++   H VF R+  DL   + + LVD+L GF+  I  LD   + +     T PG  I+  E      EG+P   N    G LII F+V FP+ + L I +   L+ +L
Sbjct:    1 QVLSNEEKRKTYDRHGEEGLKEGGHGSHADAFSHFFGDFGFEFFGGGSRQQDRNIPRGSDVVMELEVTLEEVYSGNFVEVVRNKPV-AKQTSGK-------RRCN-CRQ---EMRTTQLGPGRFQMTQETV---------------CDECPNVKLVNEERTLEVEIEPGVRDGMEYPFLGEDPFTTLGEPHIDGEPGDLRFRIKVLKHPVFERRGDDLYTNITISLVDALVGFEMDIIHLDGHKVKIVRDKVTWPGARIRKKE------EGLPNFDNNHHRGSLIITFDVDFPKGE-LTIQQKDDLKELL 276          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 288.886 bits (738), Expect = 3.870e-93
Identity = 183/417 (43.88%), Postives = 253/417 (60.67%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNP--DAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXX-----XXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKETK+YDILGV    ++ E+KKAYRK ALKYHPDKNP  +A +KFKE S A+E+L+D +KR IYD+ GE  L   GG  GF      F         G          ++GKD+ H+++ +L+ELYKG T KLA+ K ++C +C GRGGK+GAV+KCT+C G G++   RQ+GP M+Q+ QT C  C G  ++I+ +DRCK C G+KV  E+K+LEVH++ GM DGQ+I F GE DQ P + PGD+  ++ E+PH  F R   DL+Y  ++DL+ ++ G +  +  +    L V   PGEVI     + +E +GMP  K    +G LII+F + FPE+ F   + L KL  ILPP +    +      +ECVL  +DP   N     R   +   YDSD+E     G + VQCAS
Sbjct:    1 MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYG-GYGNLIIKFTIKFPENHFTSEENLKKLEEILPP-RIVPAIPKKATVDECVLADFDPAKYNRTRASRGGAN---YDSDEE---EQGGEGVQCAS 408          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 132.88 bits (333), Expect = 9.409e-35
Identity = 114/346 (32.95%), Postives = 181/346 (52.31%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNP---DAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG--------FHN-----XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEK-PHNVFTRKKADLIY-TMKLDLVDSLC-GFKRTITTLDSRTLVVETKPGE-VIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPE 1038
            YY IL +  + +E+E+K AYR+L+ KYHPDKN    +A  KF E+ +A++VL+D +K++IYD+ G  A+K GGG  G        FH+              G  GG   R  ++G  +  Q  ++L + Y G++ +  +  N  CD C G G  +G + +C  C+G GV + + ++G  M QQ+Q  C  C G  ++I  ++ CK C G+KV ++ K   V +  G          GE ++ P  + GD+ I  +EK   N+  R++ D +Y T  L   ++L  G++RTI  LD    V  ++P   V+ N E   ++  GMPK    +  G L I + VV P+
Sbjct:   24 YYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKLAQCPDCQGRGVIIQVLRMGI-MTQQIQQMCGRCGGTGQII--KNECKTCHGKKVTKKNKFFHVDVPPGAPRNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGY--GDLYIDYVVVMPK 364          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Match: APJ1 (Chaperone with a role in SUMO-mediated protein degradation; member of the DnaJ-like family; conserved across eukaryotes; overexpression interferes with propagation of the [Psi+] prion; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; forms nuclear foci upon DNA replication stress [Source:SGD;Acc:S000005021])

HSP 1 Score: 130.183 bits (326), Expect = 6.142e-33
Identity = 86/260 (33.08%), Postives = 136/260 (52.31%), Query Frame = 1
Query:  367 VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCT--TCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLE--------PGDICI-VLEEKPHNVFTRKKADLI-YTMKLDLVDSLCGFKRTITTLDSRTLV-VETKPGEVIKNLEYRALENEGMPKHKNPFE--HGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQF 1101
            + H L  TL ELY G T KL + +  IC  C G GG    ++KCT  TC+G G++   R++GP +VQ    TC  C G    +  +D C++C+G   ++E+K+L+V +  G    Q I  +GEGD+    +        PGD+ I +L  K  N      ++LI    K+D + SLCG    I    S  L+ ++  PGE++K   ++ +E+ GMPK  N      G L ++F+V +PE   L  +   K+++IL   ++
Sbjct:  179 IKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGG----LKKCTCKTCKGQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPER--LEPENAKKIQNILANDKY 431          

HSP 2 Score: 46.595 bits (109), Expect = 8.555e-6
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKN---PDAGDKFKEISQAFEVLADAKKRQIYDEGG 246
            M + T  YD L V    S  E+KKAYR  ALKYHPDKN    ++  KF+EI QA+E+L D + R +YD+ G
Sbjct:    1 MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYDQYG 71          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Match: XDJ1 (Chaperone with a role in facilitating mitochondrial protein import; ascomycete-specific member of the DnaJ-like family, closely related to Ydj1p; predicted to be C-terminally prenylated; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000004080])

HSP 1 Score: 125.561 bits (314), Expect = 1.145e-31
Identity = 113/391 (28.90%), Postives = 180/391 (46.04%), Query Frame = 1
Query:   58 KYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDK------FKEISQAFEVLADAKKRQIYD-EGGEQALKEGGGDSGFHNXXXXXXXXXXXXX-------------XXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAV------QKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVI----NERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQE-PGLEPGDICIVLEEKPHN-----VFTRK-----KADLIYTMKLDLVDSLCGFKRTIT-TLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEH-GKLIIQFEVVFPEDQFL-PIDKLSKLRSILPPSQ 1098
            + YD+LGV  + + QE+K AYRKLALK+HPDK  D   K      FKEI+ A+E+L+D +K+  YD  G +      GG +GF +   +                                KD+   +++TL +LY G   K  +++ VIC KC G G K           +C +C G G +  +++ GPG+V      C  C G+ +      N ++ C  C G  ++ +K+++ V++  G      I   G  D+E      GD+   L EK  N     +F +        DL  ++ + L ++L GF++ +T T D R L +  KPG V++  +   + NEG P   NP    G L +   + FP D +     +L  +++ LP S 
Sbjct:    9 RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSS 399          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Match: MDJ1 (Co-chaperone that stimulates HSP70 protein Ssc1p ATPase activity; involved in protein folding/refolding in the mitochodrial matrix; required for proteolysis of misfolded proteins; member of the HSP40 (DnaJ) family of chaperones [Source:SGD;Acc:S000001878])

HSP 1 Score: 83.5741 bits (205), Expect = 1.430e-17
Identity = 64/242 (26.45%), Postives = 110/242 (45.45%), Query Frame = 1
Query:  367 VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQ-KCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKV-VREKKVLEVHIDKGMSDGQQIKFSGEGD-----------QEPGLEPGDICIVLE-EKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFL 1050
            ++H+++   D ++     +L       C  CSG G K    +  C+TC G G  VHIR    G   QM +TC TC GE  +   +D C +C G+ V V   K + V +  G+ DG  ++  G+G                L  GDI + +  +K  N   + K D+ Y  ++ +  +  G   TI T++ + + ++  PG     +   ++ N G+PK       G + +Q+++V  + Q L
Sbjct:  204 IVHKVSFK-DAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTCHGTGTTVHIRG---GF--QMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQYNQV--ISIPNMGVPKTSTI--RGDMKVQYKIVVKKPQSL 435          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Match: EDO43334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ26])

HSP 1 Score: 411.379 bits (1056), Expect = 1.931e-140
Identity = 239/410 (58.29%), Postives = 297/410 (72.44%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MVKET YYDIL V P  +  E+KK+YRKLALKYHPDKNPD GD+FK+ISQA+EVL+D KKR+IYDEGGE A+K GG   GFH+PMDIFDMFFG          R    ++HQL VTL+ELY G TR+LA+QKNVIC KC GRGGKEG V+ C TC G G+ V I ++ PGMVQQ+QT CR C G+ E I E+DRCK C G+KVVRE+K+LEVHIDKGM DGQ+  FSGEGDQ+PG+EPGDI IVL+E+ H VF R+ ADLI  M++DLV+SLCGF++TITTLD RTL+V +KPG VIK  + +++E+EGMP H+NPF  G+L+IQF+V FPE+  L    + KL  +LPP       D   + E+ +L   DP       + +Y G+  AYD DDE  +P G   VQC +
Sbjct:    1 MVKETAYYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGDRFKQISQAYEVLSDEKKRKIYDEGGEDAIKGGGEGGGFHSPMDIFDMFFGTGRAAHQGERRGKD-MVHQLRVTLEELYNGATRQLALQKNVICSKCDGRGGKEGCVESCQTCHGSGMYVRINRIAPGMVQQIQTVCRDCGGKGEKIPEKDRCKNCHGKKVVRERKILEVHIDKGMKDGQKRTFSGEGDQDPGIEPGDIVIVLDEQEHPVFRRRGADLIIQMEIDLVESLCGFQKTITTLDKRTLLVTSKPGNVIKPGDMKSIEDEGMPHHRNPFHKGRLLIQFDVKFPENGVLNPKNMDKLEKLLPPRPEIIIPD---ETEDVILEKIDPEENRRNRRAQYMGN--AYDEDDEDQVPRGG--VQCQT 402          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Match: EDO36691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHV1])

HSP 1 Score: 333.183 bits (853), Expect = 7.654e-110
Identity = 190/412 (46.12%), Postives = 269/412 (65.29%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSG----FHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCA 1269
            + +T+ YD+LGV  N S+ ++KKAYRKLA + HPDKNPD G+KFK+I+ A+E+L+D +KR++YD  GE+ L+EG G         + +        G G G     R+G+D+ H L VTL +LY G T KL + KNVIC  C G GGK GA++ C  C+G GV+V I+ +GPGMVQQMQ+ C  C GE EVIN +DRCK+C+G+KVV+E K+LEVH+DKGMSDGQ+I F GEGDQEP +EPGD+ +V+++K H++F+R+  DL  T  + L ++LCGF   +  LD R L++    G +I+    R +  EGMP +++PF+ G L I+F++ FP + FLP +KL +L + LP  +  TP     + EE  +   DPN   S GQ    G  +AYD+D +     G  ++QCA
Sbjct:    1 MADTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELYDRYGEKGLREGAGGGAGFEDILSHIFGGGSMPFGGGMGGRSRRRRGEDLFHPLKVTLADLYNGKTTKLQLSKNVICTTCKGAGGKPGAMRPCAGCKGRGVKVTIKPIGPGMVQQMQSMCHDCSGEGEVINPKDRCKKCQGKKVVKESKILEVHVDKGMSDGQKITFRGEGDQEPNVEPGDVILVIQQKDHDLFSRQGMDLFMTKTVTLAEALCGFHMVVKHLDGRDLLIRYHAGNIIEPGCIRGIVGEGMPAYRHPFDKGNLYIKFDIEFPPNGFLPEEKLKQLETFLP--KRPTPPKVNDEMEEVDMEDLDPNY--SPGQ----GRREAYDADSDEEETTGGPKMQCA 404          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Match: EDO46721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPE1])

HSP 1 Score: 144.05 bits (362), Expect = 1.700e-38
Identity = 127/363 (34.99%), Postives = 186/363 (51.24%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAG--DKFKEISQAFEVLADAKKRQIYDEGGEQALK-----EGGGDS-GFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKE------GAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTR-KKADLIYTMKLDLVDSLCGFKRTIT----TLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPP 1092
            YYDILGV  + S+QELKKAY+K A KYHPDKN D G  +KFKEI++A+EVL+D +KR+I+D+ GE+ LK      G GD+ GF  P       F G            +D        +D  ++GN      Q NV       R          G   +C   +   VE   ++L   + + +  T +  K  + V+N      R E       +K+L V++ KG   G +I F  EGDQ+PG  P DI   +++K H  FTR    +++YT+K+ L D+L G+   IT    TLD R  VV     +++K    + ++ EG+P  K P +   +++ FEVVFP  +  P + +  LR+ILPP
Sbjct:    5 YYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIFDQYGEEGLKGGVPPPGAGDADGFQMPEGFTYFQFHGDPRATFSRVFGDEDPFKDF---MDTAFRGNMPFGFSQSNVTSGPSYSRQRSSSYEDIPGFFSQCQRMQDPPVE---KELFVSLEKLLTGTTKKLKIIKRVLNSIGHGTRSE-------EKILTVNVKKGWKAGTRITFPKEGDQKPGRIPADIVFTIKDKKHEHFTRDNDNNILYTVKISLRDALTGYSSNITVPVPTLDHR--VVNVPLNDIVKPGSKKRIKGEGLPLPKIPGQRMDMLVTFEVVFPS-RLAPAN-VDALRNILPP 350          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Match: EDO44765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW4])

HSP 1 Score: 125.176 bits (313), Expect = 1.175e-31
Identity = 119/339 (35.10%), Postives = 164/339 (48.38%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKN---PDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGG----GDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGN---TRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVE----TKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFP 1035
            +Y ILGV  + S+ ++K+AYRKLA+K HPDKN   P A +KF +I  A+EVLAD  +R+IYD+ GE+ LK  G     D            F G  G   S+   +G D+   L VTL+ELY GN     +L  +   I              +KC  CR    E+   QLGPG  Q               ++  + C  C     V ++K+LEV +++GM   Q+  F  EG+     EPGD+   + E  H  FTRK  DL   + + L D+L GF+  I  LD   + V     T PG  IK       + EGMP ++N  + G L I F+V FP
Sbjct:   26 FYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRKIYDQRGEEGLKNAGHRDHSDPFSSFFGGFGFHFDGHNGHSHSQQVPRGSDLTVDLEVTLEELYNGNFIEVMRLKPETKTIP-----------GTRKCN-CRQ---EMRTVQLGPGRFQ---------------MSPEEICDECPAVTYVNKEKILEVEVEQGMKHEQEYPFVSEGEPHIDGEPGDLKFKIIELRHKRFTRKGKDLYANVTITLNDALSGFEMDIPHLDKHKVHVVREKITWPGARIKK------KGEGMPSYENNHDRGDLYITFDVEFP 328          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Match: EDO38685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC61])

HSP 1 Score: 119.013 bits (297), Expect = 5.624e-30
Identity = 100/329 (30.40%), Postives = 156/329 (47.42%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKN--PDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIH-QLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEG-AVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFP 1035
            YYDILG+  + ++ ++KK YRKL+LKYHPDKN  P A  KF++ ++A++VL+D KKR IY++ GE+ LK G                         +         H   N    E + GN     +  +   D   G GG  G   +K        + + + ++  G V++M+ + R    +    N RD              K+L +++ +G     +I F  EGDQ P   P DI  ++++KPH +F R   +LIY   + L  +L G    + TLD R + +     +++K    + +  EGMP  KNP + G LIIQF + FP
Sbjct:    5 YYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQFGEEGLKSG----------------------VPEKDAWTQGYTFHGDANRVFREFFGGNNPFSELFDS--YDPDIGFGGIHGRGRRKQDPPIERELYLTLEEVFKGCVKKMKISRRVMNEDGHTSNIRD--------------KILTINVKRGWRASTKITFPKEGDQGPNNIPADIVFIVKDKPHPIFKRDNDNLIYIATVPLGKALTGCVVDVPTLDGRLISIPV--NDIVKPEYQKVVPEEGMPISKNPDKRGDLIIQFNIEFP 293          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Match: DNAJA4 (dnaJ homolog subfamily A member 4 [Source:NCBI gene;Acc:101166714])

HSP 1 Score: 394.045 bits (1011), Expect = 2.079e-133
Identity = 217/410 (52.93%), Postives = 298/410 (72.68%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCAS 1272
            MV ET +YD+LGV P  S  E+KKAYRKLALKYHPDKNP+ G+KFK ISQA+EVL+D KKR +YD GGEQA+KEGG   G      +        GGGR +  RKGK+V+HQL+V+L+E+Y G+TRKL +QKNVIC+KC G GGK+GA++KC  C+G GV+V ++Q+GPGM+QQ+Q+ C  C+G+ E  N +DRCK C G KV R+KK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGD+ IVL++K H VF R+  DL+  M L LV++LCGF++TI TLD+RTL++ T+PGEVIK+ +++ ++NEGMP +++P+E G+LIIQF+V FP+  +LP   + +L  +LPP +     D++++ + C       ++A    Q +Y    +AY+ D++   P G   VQC +
Sbjct:    1 MVHETAFYDLLGVSPKASADEIKKAYRKLALKYHPDKNPNEGEKFKLISQAYEVLSDPKKRDLYDHGGEQAIKEGGMSGG---SSPMDIFNMFFGGGGRMQRERKGKNVVHQLSVSLEEMYNGSTRKLGLQKNVICEKCDGYGGKKGALEKCANCKGRGVQVKVQQIGPGMIQQIQSMCPDCQGQGEKFNSKDRCKNCNGHKVERQKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDVIIVLDQKDHPVFQRQDNDLVMRMNLKLVEALCGFRKTIQTLDNRTLIISTQPGEVIKHNDFKCIQNEGMPLYRDPYEKGQLIIQFQVEFPDKHWLPEHLMFQLERLLPPREDVMITDDMEEVDLC-------DVAVQSHQKQY--SREAYEEDEDA--PRGG--VQCQT 394          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Match: dnaja1 (dnaJ homolog subfamily A member 1 [Source:NCBI gene;Acc:101162427])

HSP 1 Score: 362.073 bits (928), Expect = 1.049e-120
Identity = 197/352 (55.97%), Postives = 259/352 (73.58%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXX---XXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILP 1089
            MVKE  +YD LGV  N +  ELKKAYRKLALKYHPDKNP  G+KFK+ISQA+EVL+D +KR+IYD GGE+ALKEGG   G         M           R +  RKGK+++HQ+ V+L+ELY G TRKLA+QKN IC++C GRG ++GA Q C +C G G++V + QL PGMVQQ+ T C +C+G+ + I+ +DRCK C G+K++R+KK+LEVHIDKGM DGQ+I F GEGDQEPGLEPGDI IVL+ + H++FTR+ +DL+ +M+L LV++LCGFKR + TLD+RTL V + PGE+IK  + + + NEGMP ++ PFE G L+I F VVFP   FLP ++L  L+  LP
Sbjct:    1 MVKEMGFYDTLGVQANATLDELKKAYRKLALKYHPDKNPTEGEKFKQISQAYEVLSDPQKREIYDRGGEKALKEGGTGGGGGGGGFASPMDIFDFFFGGGSRMQRERKGKNMVHQITVSLEELYNGATRKLAVQKNCICERCEGRGSRKGAAQVCMSCHGTGMQVRVHQLLPGMVQQVSTVCSSCQGQGQRISHKDRCKACGGRKILRQKKILEVHIDKGMKDGQKIVFHGEGDQEPGLEPGDIIIVLDLREHSLFTRRGSDLVMSMELQLVEALCGFKRPVQTLDNRTLFVTSHPGELIKPEDTKCILNEGMPIYRRPFEKGLLVIHFSVVFPPANFLPKNRLKDLKRYLP 352          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Match: dnaja2b (dnaJ homolog subfamily A member 2-like [Source:NCBI gene;Acc:101175395])

HSP 1 Score: 347.436 bits (890), Expect = 6.344e-115
Identity = 211/416 (50.72%), Postives = 278/416 (66.83%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDE------GGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P+ SE ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL + +K+++YD               G  D   H        F GG   GR+ G R+G D+IH L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKC  CRG G+ + IRQL PGMVQQMQ+ C  C GE EVINE+DRCK+CEGQKV ++ K+LEVH+DKGM  GQ+I FSGE DQ PG+EPGDI +VL+EK H  F R+ +DL    ++ LV++LCGF+ T+T LD R L+++  PG+VI+    R ++ EGMP+++NPFE G L I+F+V FPE+ ++  DKL+ L  +L P++   P+    DAEE  L  ++ +     G  R     +AY+  SD+EGG  G    VQCA
Sbjct:    4 VADTKLYDILGVSPSASENELKKAYRKLAKEYHPDKNPEAGDKFKEISFAYEVLTNPEKKELYDRYGEQGLREGGGGGPGMEDIFSHIFGGGLFGFMGGQSRGRNGGKRRGDDMIHPLKVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKAGAVQKCVACRGRGMRIMIRQLAPGMVQQMQSVCTDCSGEGEVINEKDRCKKCEGQKVCKDTKLLEVHVDKGMKHGQKITFSGEADQAPGVEPGDIVLVLQEKEHEDFRREGSDLHMVHRIGLVEALCGFQMTVTHLDGRQLLIKYPPGKVIEPGCIRVVKGEGMPQYRNPFEKGDLYIKFDVQFPENNWISPDKLNDLECLL-PARADDPI-IAADAEEVDLTEFERSQGFGSGARR-----EAYNDSSDEEGGHHGPG--VQCA 410          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2 [Source:NCBI gene;Acc:101173536])

HSP 1 Score: 346.28 bits (887), Expect = 1.733e-114
Identity = 207/417 (49.64%), Postives = 282/417 (67.63%), Query Frame = 1
Query:   46 VKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDE-----GGEQALKEGGGDSGFHN--XXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            V +TK YDILGV P+ +E ELKKAYRKLA +YHPDKNP+AGDKFKEIS A+EVL++ +K+++YD        E      G D  F +     +F    G     R+ G R+G+D++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKC+TCRG G+ + IRQL PGMVQQMQ+ C  C GE EVI+E+DRCK+CEG+KVV+E K+LEVH+DKGM  GQ+I F GE DQ PG+EPGDI +VL+EK H  F R+K DL    K+ LV++LCGF+ T+  LD R +V++   G+VI+    R +  EGMP+++NPFE G L ++F+V FP++ ++  +KL++L  +L PS+   P+    D EE  L  YD + +++ G     G  +AY+  SDDE G  G    VQCA
Sbjct:    4 VVDTKLYDILGVSPSATENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKKELYDRYGEQGLREGGGGGPGMDDIFSHIFGGGLFGFMGGQGNRSRNGGRRRGEDMVHPLKVSLEDLYNGKTTKLQLSKNVLCSSCNGQGGKTGAVQKCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVVKEVKILEVHVDKGMKHGQKITFGGEADQAPGVEPGDIVLVLQEKEHETFKREKNDLFINHKIGLVEALCGFQFTLKHLDGRQIVIKYPAGKVIEPGSVRVVRGEGMPQYRNPFEKGDLYVKFDVQFPDNNWISPEKLTELEDML-PSRPEPPIIT-GDTEEVDLQDYDVSQSSTSG-----GRREAYNDSSDDESGHHGPG--VQCA 411          
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Match: dnaja2a (DnaJ heat shock protein family (Hsp40) member A2 [Source:NCBI gene;Acc:101173536])

HSP 1 Score: 302.753 bits (774), Expect = 6.217e-98
Identity = 174/375 (46.40%), Postives = 243/375 (64.80%), Query Frame = 1
Query:  172 KFKEISQAFEVLADAKKRQIYDE-----GGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXX--VIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYD--SDDEGGMPGGAQRVQCA 1269
            +FKEIS A+EVL++ +K+++YD        E      G D  F +        F G  G RSR   + +   ++H L V+L++LY G T KL + KNV+C  C+G+GGK GAVQKC+TCRG G+ + IRQL PGMVQQMQ+ C  C GE EVI+E+DRCK+CEG+KVV+E K+LEVH+DKGM  GQ+I F GE DQ PG+EPGDI +VL+EK H  F R+K DL    K+ LV++LCGF+ T+  LD R +V++   G+VI+    R +  EGMP+++NPFE G L ++F+V FP++ ++  +KL++L  +L PS+   P+    D EE  L  YD + +++ G     G  +AY+  SDDE G  G    VQCA
Sbjct:   23 QFKEISFAYEVLSNPEKKELYDRYGEQGLREGGGGGPGMDDIFSHIFGGGLFGFMGGQGNRSRNGGRRRGEDMVHPLKVSLEDLYNGKTTKLQLSKNVLCSSCNGQGGKTGAVQKCSTCRGRGMRIMIRQLAPGMVQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVVKEVKILEVHVDKGMKHGQKITFGGEADQAPGVEPGDIVLVLQEKEHETFKREKNDLFINHKIGLVEALCGFQFTLKHLDGRQIVIKYPAGKVIEPGSVRVVRGEGMPQYRNPFEKGDLYVKFDVQFPDNNWISPEKLTELEDML-PSRPEPPIIT-GDTEEVDLQDYDVSQSSTSG-----GRREAYNDSSDDESGHHGPG--VQCA 388          
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Match: SMESG000012107.1 (SMESG000012107.1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 411/411 (100.00%), Postives = 411/411 (100.00%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 1275
            MVKETKYYDILGVHPNVSEQELKKAYRKLALKYHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGRSRGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN
Sbjct:    1 MVKETKYYDILGVHPNVSEQELKKAYRKLALKYHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGRSRGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMPGGAQRVQCASN 411          
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Match: SMESG000004726.1 (SMESG000004726.1)

HSP 1 Score: 408.683 bits (1049), Expect = 4.772e-139
Identity = 245/419 (58.47%), Postives = 311/419 (74.22%), Query Frame = 1
Query:   43 MVKETKYYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXX-XXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPPSQF---ATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAY-----DSDDEGGMPGGAQRVQCAS 1272
            MVKETKYYDIL V PN +EQ+LKKAYRKLALKYHPDKNP  G+KFKEISQAFEVL+D+KKR+IYDE GE+ALKEG G   FHNPMDIFDMFFGG GG   +   ++GKD I  + VTL+ELY G T+ LA+ K +ICDKC GRGGKEGAV+ C TC+G G+E+HIRQ+GPGMVQQMQTTC  C+G+ E I ++D+CK+C G KVV   K  ++HI+KGM DGQ I+ SGEGDQE G+E GD+ ++L+EKPH V+ R K DL+ T+KLDLVDSLCGFKR + TLD+R ++V++ PGE+IK  ++R +E+EGMP++K+PFE G LII F+VVFP++ F+  DKL+ L+ ILP S +   A P     DAEEC + P+ P       Q + H    A+     D D+E     G QRV+C +
Sbjct:    1 MVKETKYYDILEVKPNATEQDLKKAYRKLALKYHPDKNPSGGEKFKEISQAFEVLSDSKKRKIYDEAGEEALKEGAG-GNFHNPMDIFDMFFGGFGGLNRQRGPKRGKDNIKPMPVTLEELYNGATKNLAVSKKIICDKCEGRGGKEGAVESCATCKGKGIEIHIRQIGPGMVQQMQTTCSKCQGKGETIKDKDKCKKCSGNKVVHVTKNYDIHIEKGMMDGQSIRMSGEGDQESGVETGDLVVLLQEKPHEVYKRMKNDLLTTVKLDLVDSLCGFKRVMKTLDNRHIIVQSSPGEIIKTNDFRKIESEGMPRYKSPFEKGSLIINFDVVFPDNNFINQDKLTALKEILPKSTYRIGAIP----PDAEECSMKPFIPEKTK---QSQSHDSRGAFRDVFPDFDEEMDGHEGTQRVECGN 411          
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Match: SMESG000077692.1 (SMESG000077692.1)

HSP 1 Score: 127.872 bits (320), Expect = 2.514e-32
Identity = 119/351 (33.90%), Postives = 175/351 (49.86%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKN---PDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKE--GGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVV----ETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSIL 1086
            +Y IL V  + +  ++KKAYR LA + HPDKN   P+A  +F++++ A+E L+D +KR+I+D  GE+ LK+  GGG S         D+FF   G  R +   +G DV+  L V+L+ELY GN  ++   K+V   K S  G      ++C  CR    E+   Q GPG               R  + +   C  C   + V E+K+LEV I+ GM DGQ   F  EG+     EPGD+   + +  H  F R+  DL   + + L+D+L GF   I  LD   + V     T PG  IK         EGMP ++N    G L I  +V FP+D+    ++   L+ +L
Sbjct:   22 FYKILNVPRSANSNQIKKAYRNLAKQLHPDKNKDDPNAESQFQDLNAAYEALSDPEKRKIFDARGEEGLKDSHGGGSSMDPFSSFFGDVFFDMGGSRRQKDIPRGGDVVMDLFVSLEELYNGNFVEVVRYKSV---KKSAHG-----TRRCN-CRH---EMKTIQTGPG---------------RFTMTQEQVCDECPNVRFVPEEKLLEVEIEPGMRDGQLYPFVAEGEPHIDGEPGDLKFRIRQSSHPRFERRGDDLYTNVTISLLDALQGFSMEIKHLDGHKVKVIREKVTWPGATIKK------SMEGMPNYENNHVKGSLYITIDVAFPKDKVYSEEEKEILKKLL 339          
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Match: SMESG000005055.1 (SMESG000005055.1)

HSP 1 Score: 116.701 bits (291), Expect = 1.083e-28
Identity = 103/329 (31.31%), Postives = 152/329 (46.20%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKNPDAG---DKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEG-AVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFP 1035
            YY+IL +  + +  E+ KAYRKL +KYHP KNP++    D+F  +S+A++VL+D +KR IYD+ GE  LK G   S   N        + G                     T  E Y  N        ++  D     GG  G  V+         + + + ++  G V++M+ T R    +    +  D              K+L V + KG  +G +I F  EGDQ P   P DI  VL+++PH  F R+K +LIY  K+DL  +L G    I  LD R L +      ++       ++ EGMP  +   E G LII+FE+VFP
Sbjct:    5 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEK-----------------TFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHD--------------KILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVT--NIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 300          
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Match: SMESG000076708.1 (SMESG000076708.1)

HSP 1 Score: 103.605 bits (257), Expect = 3.042e-24
Identity = 96/331 (29.00%), Postives = 154/331 (46.53%), Query Frame = 1
Query:   61 YYDILGVHPNVSEQEXXXXXXXXXXXXHPDKN---PDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNXXXXXXXXXXXXXXXXXXXXXXXXXVIHQLNV--TLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPE 1038
            YY IL +  N  + ++KKAYR  ALK HP KN   P A +KF  IS+A+EVL+D  KR +YD+          G+ G  N +    +  G    G +      K  I+         E Y      + +          G  G+   +Q  +  R + +   + ++  G +++++ +       R V+NE       +G       K+L V++  G  +G +I F  EGDQ P + P D+  +L+++ H+ F R +A+LIY+  + L D+L G    I TLD R L +     ++I     + +  EGMP    P   G L IQF++ FP+
Sbjct:    5 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQF---------GEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLS-------FGGLYGRSQMLQDPSIERDLNLT--LEEIYHGCIKKLKIS-------RRVMNE-------DGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPIT--DIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPK 301          
The following BLAST results are available for this feature:
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJA47.710e-13655.47DnaJ heat shock protein family (Hsp40) member A4 [... [more]
DNAJA11.182e-13557.66DnaJ heat shock protein family (Hsp40) member A1 [... [more]
DNAJA41.406e-13555.37DnaJ heat shock protein family (Hsp40) member A4 [... [more]
DNAJA41.406e-13555.37DnaJ heat shock protein family (Hsp40) member A4 [... [more]
DNAJA22.330e-12051.57DnaJ heat shock protein family (Hsp40) member A2 [... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-124.357e-9147.92DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-124.357e-9147.92DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-191.421e-6042.16DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-191.421e-6042.16DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-201.745e-2735.48DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Droj22.704e-13255.18gene:FBgn0038145 transcript:FBtr0082751[more]
Droj22.704e-13255.18gene:FBgn0038145 transcript:FBtr0082754[more]
Droj22.704e-13255.18gene:FBgn0038145 transcript:FBtr0082752[more]
Droj22.704e-13255.18gene:FBgn0038145 transcript:FBtr0082753[more]
Droj22.704e-13255.18gene:FBgn0038145 transcript:FBtr0082755[more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnaja15.721e-13454.01DnaJ heat shock protein family (Hsp40) member A1 [... [more]
dnaja2a1.374e-12051.92DnaJ heat shock protein family (Hsp40) member A2a ... [more]
dnaja2b4.770e-11350.72DnaJ heat shock protein family (Hsp40) member A2b ... [more]
dnaja2a2.909e-9750.17DnaJ heat shock protein family (Hsp40) member A2a ... [more]
CABZ01080568.11.529e-9146.10pep chromosome:GRCz11:25:34662358:34670413:-1 gene... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnaja4.12.276e-13255.96DnaJ heat shock protein family (Hsp40) member A4 [... [more]
mdfic1.155e-12752.66MyoD family inhibitor domain containing [Source:Xe... [more]
prnp2.996e-12654.26prion protein [Source:Xenbase;Acc:XB-GENE-952814][more]
dnaja4.29.238e-11649.39DnaJ (Hsp40) homolog, subfamily A, member 4, gene ... [more]
dnaja4.21.052e-11549.39DnaJ (Hsp40) homolog, subfamily A, member 4, gene ... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaja47.121e-13655.85DnaJ heat shock protein family (Hsp40) member A4 [... [more]
Dnaja47.121e-13655.85DnaJ heat shock protein family (Hsp40) member A4 [... [more]
Dnaja18.112e-13657.66DnaJ heat shock protein family (Hsp40) member A1 [... [more]
Dnaja18.112e-13657.66DnaJ heat shock protein family (Hsp40) member A1 [... [more]
Dnaja25.599e-12151.57DnaJ heat shock protein family (Hsp40) member A2 [... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5NVI9|DNJA1_PONAB4.975e-13555.72DnaJ homolog subfamily A member 1 OS=Pongo abelii ... [more]
sp|Q9JMC3|DNJA4_MOUSE4.981e-13555.85DnaJ homolog subfamily A member 4 OS=Mus musculus ... [more]
sp|P63036|DNJA1_RAT5.674e-13557.66DnaJ homolog subfamily A member 1 OS=Rattus norveg... [more]
sp|P63037|DNJA1_MOUSE5.674e-13557.66DnaJ homolog subfamily A member 1 OS=Mus musculus ... [more]
sp|P31689|DNJA1_HUMAN5.674e-13557.66DnaJ homolog subfamily A member 1 OS=Homo sapiens ... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G8IIK60.000e+091.73Heat shock protein 40 OS=Dugesia japonica OX=6161 ... [more]
A0A4S2M6815.657e-15761.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KPA75.657e-15761.50DnaJ homolog subfamily A member 1 OS=Clonorchis si... [more]
A0A074ZVL81.076e-15661.50DnaJ domain protein OS=Opisthorchis viverrini OX=6... [more]
A0A267FJQ03.302e-15662.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJA45.226e-13356.68DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja12.527e-12353.16DnaJ heat shock protein family (Hsp40) member A1 [... [more]
dnaja2b2.628e-11450.24DnaJ heat shock protein family (Hsp40) member A2b ... [more]
dnaja2a3.439e-11351.20DnaJ heat shock protein family (Hsp40) member A2 [... [more]
dnajb114.025e-3735.38DnaJ heat shock protein family (Hsp40) member B11 ... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJA43.600e-12853.68DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja11.220e-8449.40DnaJ heat shock protein family (Hsp40) member A1 [... [more]
DNAJA44.416e-5551.28DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja2a1.696e-4734.42DnaJ heat shock protein family (Hsp40) member A2a ... [more]
dnajb114.130e-2833.55DnaJ heat shock protein family (Hsp40) member B11 ... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YDJ13.870e-9343.88Type I HSP40 co-chaperone; involved in regulation ... [more]
SCJ19.409e-3532.95One of several homologs of bacterial chaperone Dna... [more]
APJ16.142e-3333.08Chaperone with a role in SUMO-mediated protein deg... [more]
XDJ11.145e-3128.90Chaperone with a role in facilitating mitochondria... [more]
MDJ11.430e-1726.45Co-chaperone that stimulates HSP70 protein Ssc1p A... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433341.931e-14058.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366917.654e-11046.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467211.700e-3834.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447651.175e-3135.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386855.624e-3030.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJA42.079e-13352.93dnaJ homolog subfamily A member 4 [Source:NCBI gen... [more]
dnaja11.049e-12055.97dnaJ homolog subfamily A member 1 [Source:NCBI gen... [more]
dnaja2b6.344e-11550.72dnaJ homolog subfamily A member 2-like [Source:NCB... [more]
dnaja2a1.733e-11449.64DnaJ heat shock protein family (Hsp40) member A2 [... [more]
dnaja2a6.217e-9846.40DnaJ heat shock protein family (Hsp40) member A2 [... [more]
back to top
BLAST of DnaJ homolog subfamily A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012107.10.000e+0100.00SMESG000012107.1[more]
SMESG000004726.14.772e-13958.47SMESG000004726.1[more]
SMESG000077692.12.514e-3233.90SMESG000077692.1[more]
SMESG000005055.11.083e-2831.31SMESG000005055.1[more]
SMESG000076708.13.042e-2429.00SMESG000076708.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032797 ID=SMED30032797|Name=DnaJ homolog subfamily A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1625bp
CTGGAAAAGCGCTGTTGCATTTGGTTAAAAACACTCTAGAAAATGGTTAA
AGAAACTAAATATTACGACATTCTTGGAGTTCATCCTAATGTCTCTGAAC
AAGAATTAAAAAAAGCTTATCGTAAGCTTGCTCTTAAATACCACCCAGAC
AAAAATCCAGATGCTGGTGATAAATTCAAGGAAATATCACAAGCTTTTGA
AGTTTTGGCTGATGCTAAAAAGCGCCAGATTTATGACGAAGGAGGAGAAC
AAGCTTTGAAAGAAGGTGGAGGTGATTCTGGATTTCATAATCCAATGGAT
ATATTTGATATGTTTTTTGGCGGTATGGGTGGAGGACGTTCACGAGGTCC
CCGTAAAGGAAAGGATGTTATTCATCAGTTAAATGTAACATTAGATGAAT
TGTACAAAGGAAACACTAGGAAATTAGCTATTCAGAAGAATGTCATCTGC
GATAAATGTAGTGGCAGGGGAGGAAAAGAGGGTGCGGTTCAGAAATGTAC
AACTTGTAGAGGAATGGGCGTTGAGGTTCATATACGTCAACTGGGACCAG
GAATGGTACAACAAATGCAGACTACTTGTAGAACTTGCAAAGGTGAACGT
GAGGTTATTAATGAAAGAGATCGTTGTAAAAGATGTGAAGGACAAAAAGT
TGTTCGTGAAAAGAAAGTCCTCGAAGTTCATATAGATAAAGGTATGTCCG
ATGGGCAGCAGATTAAATTTAGCGGTGAAGGAGATCAAGAACCGGGGTTA
GAACCTGGAGATATTTGTATAGTTCTCGAAGAAAAGCCACATAATGTCTT
TACTCGAAAAAAGGCAGATTTAATTTATACTATGAAATTAGATCTAGTGG
ATTCCCTGTGTGGGTTTAAACGGACTATTACAACATTAGATAGCCGTACA
TTAGTCGTTGAAACCAAACCAGGAGAAGTTATCAAAAATCTAGAATATAG
AGCTTTGGAAAATGAAGGAATGCCGAAACACAAAAACCCATTTGAACACG
GGAAGTTAATTATTCAATTCGAAGTTGTATTTCCCGAAGACCAATTCTTA
CCTATTGATAAATTGAGCAAATTGAGATCTATTCTACCACCGTCACAATT
CGCCACTCCATTGGACAATTTGAAAGATGCCGAGGAATGCGTTTTGCATC
CTTATGATCCTAACATGGCTAATAGCAAAGGCCAAGATAGATATCACGGT
CATCATCAGGCATATGACAGTGACGATGAAGGAGGTATGCCAGGAGGGGC
ACAACGAGTTCAATGTGCATCTAACTAATGTTTATTGGAAATATGGAGGA
ATTCTGATTCGGTTTTGTTATGTTGCTGAGTAGAATAAATGTTTAATAAA
ATAAATATTCAAATGCGAAATCAGTAATAAATTTCCAACTTGTTTTATTG
ATTTTTTATCTTATGTATATATTTACCTTGTGAACATTGTAATGTTGAGT
CATTTAATTAATAAACTTTACACTGTCGGATTGTTGATGATGCTCTTGTC
GTTTTCGCGGATGTTGACTATTTCTCACTAGTTGCTTGATATTGACTGGT
GGGATGAGGACATTTTCTTCTAAGTCCATTTTACTATAGAAAATGAAATT
AATGTTAAACTAAGACTTATTCCTT
back to top

protein sequence of SMED30032797-orf-1

>SMED30032797-orf-1 ID=SMED30032797-orf-1|Name=SMED30032797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MVKETKYYDILGVHPNVSEQELKKAYRKLALKYHPDKNPDAGDKFKEISQ
AFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGRS
RGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQ
KCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEG
QKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPH
NVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNL
EYRALENEGMPKHKNPFEHGKLIIQFEVVFPEDQFLPIDKLSKLRSILPP
SQFATPLDNLKDAEECVLHPYDPNMANSKGQDRYHGHHQAYDSDDEGGMP
GGAQRVQCASN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR036410HSP_DnaJ_Cys-rich_dom_sf
IPR008971HSP40/DnaJ_pept-bd
IPR001623DnaJ_domain
IPR001305HSP_DnaJ_Cys-rich_dom
IPR002939DnaJ_C
IPR018253DnaJ_domain_CS
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
GO:0031072heat shock protein binding
GO:0005524ATP binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0009408response to heat
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 8..26
score: 49.13
coord: 26..41
score: 65.18
coord: 60..79
score: 35.77
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 5..60
e-value: 1.1E-27
score: 108.0
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 6..65
e-value: 7.0E-25
score: 86.9
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 6..68
score: 22.533
IPR001623DnaJ domainCDDcd06257DnaJcoord: 7..57
e-value: 7.24879E-24
score: 91.4529
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 250..332
e-value: 5.0E-23
score: 83.2
NoneNo IPR availableGENE3DG3DSA:2.10.230.10coord: 138..202
e-value: 4.8E-22
score: 79.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..411
NoneNo IPR availablePANTHERPTHR43888:SF9DNAJ HOMOLOG SUBFAMILY A MEMBER 4coord: 1..408
NoneNo IPR availablePANTHERPTHR43888FAMILY NOT NAMEDcoord: 1..408
NoneNo IPR availableCDDcd10747DnaJ_Ccoord: 107..333
e-value: 4.23779E-43
score: 146.416
IPR002939Chaperone DnaJ, C-terminalPFAMPF01556DnaJ_Ccoord: 110..331
e-value: 2.4E-41
score: 141.7
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 2..100
e-value: 1.3E-30
score: 108.2
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 2..100
IPR001305Heat shock protein DnaJ, cysteine-rich domainPFAMPF00684DnaJ_CXXCXGXGcoord: 136..202
e-value: 8.3E-15
score: 54.9
IPR001305Heat shock protein DnaJ, cysteine-rich domainPROSITEPS51188ZF_CRcoord: 123..207
score: 24.338
IPR001305Heat shock protein DnaJ, cysteine-rich domainCDDcd10719DnaJ_zfcoord: 136..202
e-value: 4.14514E-20
score: 81.533
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 45..64
IPR036410Heat shock protein DnaJ, cysteine-rich domain superfamilySUPERFAMILYSSF57938DnaJ/Hsp40 cysteine-rich domaincoord: 133..205
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 108..250
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 252..332