retinal homeobox protein Rx

Overview
Nameretinal homeobox protein Rx (CAQ05992.1)
Smed IDSMED30032786
Length (bp)911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of retinal homeobox protein Rx (SMED30032786) t-SNE clustered cells

Violin plots show distribution of expression levels for retinal homeobox protein Rx (SMED30032786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of retinal homeobox protein Rx (SMED30032786) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for retinal homeobox protein Rx (SMED30032786) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032786SMESG000033843.1 SmedASXL_000084SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032786SMESG000033843.1 dd_Smed_v6_56683_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032786SMESG000033843.1 dd_Smed_v6_75180_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Match: RAX (retina and anterior neural fold homeobox [Source:HGNC Symbol;Acc:HGNC:18662])

HSP 1 Score: 142.895 bits (359), Expect = 1.916e-39
Identity = 68/100 (68.00%), Postives = 77/100 (77.00%), Query Frame = 3
Query:  159 CPKDSSEQSPAISEADETESSPDRLS---NCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            CPK+  E  P+        +   +LS      KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA K++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:  102 CPKEPGEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 201          
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Match: RAX2 (retina and anterior neural fold homeobox 2 [Source:HGNC Symbol;Acc:HGNC:18286])

HSP 1 Score: 133.65 bits (335), Expect = 1.124e-37
Identity = 58/69 (84.06%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
             KKHRRNRTTFTTYQLH+LERAFE SHYPDVYSREELA K+ LPEVRVQVWFQNRRAKWRRQE++E+ +
Sbjct:   24 KKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGS 92          
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Match: RAX2 (retina and anterior neural fold homeobox 2 [Source:HGNC Symbol;Acc:HGNC:18286])

HSP 1 Score: 133.65 bits (335), Expect = 1.124e-37
Identity = 58/69 (84.06%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
             KKHRRNRTTFTTYQLH+LERAFE SHYPDVYSREELA K+ LPEVRVQVWFQNRRAKWRRQE++E+ +
Sbjct:   24 KKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGS 92          
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Match: ARX (aristaless related homeobox [Source:HGNC Symbol;Acc:HGNC:18060])

HSP 1 Score: 116.316 bits (290), Expect = 1.434e-28
Identity = 49/70 (70.00%), Postives = 59/70 (84.29%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANH 452
             +K RR RTTFT+YQL ELERAF+K+HYPDV++REELAM++ L E RVQVWFQNRRAKWR++EK  A  H
Sbjct:  325 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTH 394          
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Match: ALX4 (ALX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:450])

HSP 1 Score: 110.923 bits (276), Expect = 4.559e-27
Identity = 49/71 (69.01%), Postives = 59/71 (83.10%), Query Frame = 3
Query:  225 DRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            D  SN  KK RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+  L E RVQVWFQNRRAKWR++E+ 
Sbjct:  206 DSESNKGKK-RRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF 275          
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Match: ceh-8 (Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Prot;Acc:Q94398])

HSP 1 Score: 118.627 bits (296), Expect = 2.055e-31
Identity = 54/82 (65.85%), Postives = 66/82 (80.49%), Query Frame = 3
Query:  240 CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEA-ANHTHNLQEVFPN 482
             +KK RRNRTTFTT+QLH LE AF+K+HYPDVY+RE LA K+ LPEVRVQVWFQNRRAK+RRQEK +      H+L++  P+
Sbjct:   56 ADKKQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQEKQDCQGEEKHSLKDTMPS 137          
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Match: ceh-8 (Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Prot;Acc:Q94398])

HSP 1 Score: 117.857 bits (294), Expect = 3.839e-31
Identity = 54/82 (65.85%), Postives = 66/82 (80.49%), Query Frame = 3
Query:  240 CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEA-ANHTHNLQEVFPN 482
             +KK RRNRTTFTT+QLH LE AF+K+HYPDVY+RE LA K+ LPEVRVQVWFQNRRAK+RRQEK +      H+L++  P+
Sbjct:   54 ADKKQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQEKQDCQGEEKHSLKDTMPS 135          
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Match: ceh-17 (C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrEMBL;Acc:G5EC89])

HSP 1 Score: 103.605 bits (257), Expect = 4.756e-26
Identity = 45/64 (70.31%), Postives = 56/64 (87.50%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            +K RR RTTFT+ QL ELER+F ++HYPD+Y+REE+AM+I L E RVQVWFQNRRAK+R+QEKI
Sbjct:  147 RKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKI 210          
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Match: vab-3 (MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71])

HSP 1 Score: 103.605 bits (257), Expect = 1.117e-25
Identity = 53/132 (40.15%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  111 NREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSG 506
             R  S  ++   +GK  P +  +Q P     D+  +   R+    +K +RNRT+FT  Q+  LE+ FE++HYPDV++RE LA KI LPE R+QVWF NRRAKWRR+EK+     +  +     N   + T G
Sbjct:   17 TRRASTIRKTARVGKFSPYE--DQKPPTEPEDDAAA---RM-RLKRKLQRNRTSFTQVQIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWRREEKMRNKRSSGTMDSSLSNGTPTPTPG 142          
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Match: alr-1 (AristaLess (Drosophila homeodomain) Related [Source:UniProtKB/TrEMBL;Acc:Q21836])

HSP 1 Score: 102.834 bits (255), Expect = 6.779e-25
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 3
Query:  219 SPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPN 482
            SPD   N  +K RR RTTF+ +QL ELE+ F ++HYPDV++REELA ++ L E RVQVWFQNRRAK+R+QE+  + +H +      PN
Sbjct:  108 SPD--DNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQER-SSTHHPYQAPMSIPN 192          
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Match: Rx (gene:FBgn0020617 transcript:FBtr0342783)

HSP 1 Score: 149.443 bits (376), Expect = 5.684e-40
Identity = 89/167 (53.29%), Postives = 108/167 (64.67%), Query Frame = 3
Query:  168 DSSEQSPAISEADETESSPDRLSNC-NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEA--ANHTHNLQEVFPNVGKSLTSGLFPSNPY--PFLNMSLPSVESTSFFYHQNGMLNPMSMV-NNLGFNNFTSIN 650
            +SSEQ   I+   + E   D   NC  KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK E+     TH  Q   P+      SGL P +P+  P L  +LP   S     + + +  P+S+   NL  ++  ++ 
Sbjct:  533 NSSEQGEKITSGSDDEGQDD---NCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQ--LPHRLGCGASGL-PVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMG 693          
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Match: al (gene:FBgn0000061 transcript:FBtr0078053)

HSP 1 Score: 119.398 bits (298), Expect = 1.284e-30
Identity = 58/121 (47.93%), Postives = 77/121 (63.64%), Query Frame = 3
Query:  195 SEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVG---KSLTSGLFPSNPYPFLNMSL 548
            S+ +  E +P R      K RR RTTFT++QL ELE+AF ++HYPDV++REELAMKI L E R+QVWFQNRRAKWR+QEK+   +H +N     P      +++     P NP+  L   L
Sbjct:   72 SDCEADEYAPKR------KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYN--PYLPGGAATMQTVVGAALPPNPFTHLGFQL 184          
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Match: Pph13 (gene:FBgn0023489 transcript:FBtr0078070)

HSP 1 Score: 110.923 bits (276), Expect = 1.003e-27
Identity = 47/64 (73.44%), Postives = 55/64 (85.94%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            +K RR RTTF T QL ELERAF+++HYPDV+ REELA++I L E RVQVWFQNRRAKWR+QEKI
Sbjct:    8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71          
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Match: hbn (gene:FBgn0008636 transcript:FBtr0071556)

HSP 1 Score: 109.768 bits (273), Expect = 4.760e-27
Identity = 46/64 (71.88%), Postives = 58/64 (90.62%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            +K RR+RTTFTT+QLH+LERAFEK+ YPDV++RE+LAM++ L E RVQVWFQNRRAKWR++EK 
Sbjct:  151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKF 214          
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Match: Drgx (gene:FBgn0085369 transcript:FBtr0302391)

HSP 1 Score: 106.686 bits (265), Expect = 1.659e-25
Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIE 440
            +K RRNRTTFT  QL ELE AF ++HYPDV++RE+LAMKI+L E RVQVWFQNRRAKWR+ E+++
Sbjct:   50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLK 114          
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Match: rx1 (retinal homeobox gene 1 [Source:NCBI gene;Acc:30472])

HSP 1 Score: 146.362 bits (368), Expect = 3.162e-41
Identity = 89/168 (52.98%), Postives = 107/168 (63.69%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCP-KDSSEQSPAISEAD-----------------ETES-SPDRLSN--CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            +ID ILG  +DQ SL+  N    +V +++          +++R    G   P +D SEQ P   +AD                 E++S SPD        KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEKI+A+ 
Sbjct:   38 SIDVILGFNKDQDSLL--NPGANAVAHKVGGESLGEPGKLDQRVQPYGHLPPLRDGSEQ-PTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSADGEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDAST 202          
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Match: rx1 (retinal homeobox gene 1 [Source:NCBI gene;Acc:30472])

HSP 1 Score: 146.362 bits (368), Expect = 3.162e-41
Identity = 89/168 (52.98%), Postives = 107/168 (63.69%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCP-KDSSEQSPAISEAD-----------------ETES-SPDRLSN--CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            +ID ILG  +DQ SL+  N    +V +++          +++R    G   P +D SEQ P   +AD                 E++S SPD        KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEKI+A+ 
Sbjct:   38 SIDVILGFNKDQDSLL--NPGANAVAHKVGGESLGEPGKLDQRVQPYGHLPPLRDGSEQ-PTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSADGEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDAST 202          
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Match: rx3 (retinal homeobox gene 3 [Source:NCBI gene;Acc:30474])

HSP 1 Score: 143.665 bits (361), Expect = 1.518e-40
Identity = 79/120 (65.83%), Postives = 90/120 (75.00%), Query Frame = 3
Query:  183 SPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQE----VFPNVGK-SLTSGLFPSNPY 527
            SP + +AD  + S D   N  KKHRRNRTTFTT+QLHELERAFEKSHYPDVYSREELA+K++LPEVRVQVWFQNRRAKWRRQEK+E +  +  LQE      P  G  SL SGL P  P+
Sbjct:   85 SPDLPDADGGKLSDDE--NPKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVS--SIKLQESSMLSIPRSGPLSLGSGL-PLEPW 199          
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Match: rx2 (retinal homeobox gene 2 [Source:NCBI gene;Acc:30473])

HSP 1 Score: 144.05 bits (362), Expect = 2.981e-40
Identity = 93/207 (44.93%), Postives = 116/207 (56.04%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEM--------CDNYQNREI-----------------SVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN--------HTHNLQEVFPNVGKSLTSGLFPSNPY 527
            +ID ILG  +DQ  L+     H+  E+++         D Y + +I                 S +K D  LG  R   +S  +SP I + D+ +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++            + N   + PNVG    S   P +P+
Sbjct:   38 SIDVILGFSKDQDPLLEPIGTHKVDEDQLEEQEKQVNSDPYSHLQIPDQTQQQQSVYHDTGLFSTDKCDADLGDPRSNVESDSRSPDIPDEDQPK----------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDTGTMKLHDSPIRSFNRPPMAPNVGP--MSNSLPLDPW 232          
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Match: rx2 (retinal homeobox gene 2 [Source:NCBI gene;Acc:30473])

HSP 1 Score: 144.05 bits (362), Expect = 2.981e-40
Identity = 93/207 (44.93%), Postives = 116/207 (56.04%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEM--------CDNYQNREI-----------------SVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN--------HTHNLQEVFPNVGKSLTSGLFPSNPY 527
            +ID ILG  +DQ  L+     H+  E+++         D Y + +I                 S +K D  LG  R   +S  +SP I + D+ +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++            + N   + PNVG    S   P +P+
Sbjct:   38 SIDVILGFSKDQDPLLEPIGTHKVDEDQLEEQEKQVNSDPYSHLQIPDQTQQQQSVYHDTGLFSTDKCDADLGDPRSNVESDSRSPDIPDEDQPK----------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDTGTMKLHDSPIRSFNRPPMAPNVGP--MSNSLPLDPW 232          
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Match: lrrc17 (leucine rich repeat containing 17 [Source:Xenbase;Acc:XB-GENE-1010987])

HSP 1 Score: 146.362 bits (368), Expect = 3.513e-42
Identity = 83/186 (44.62%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  165 KDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFP-SNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPM-TLSYGLFNEFSNFL 716
            +D S  +P   E ++ E          KKHRRNRTTFTTYQLHELERAFE+SHYPDVYSREELAMK+SLPEVRVQVWFQNRRAKWRRQEK+E ++   +   +       + +G+ P SN  P        +  T+  +     + P S      + + T +N  PP  P+  LS   +     F+
Sbjct:   14 EDGSTPTPGTPEGEDNELP-------KKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLPEVRVQVWFQNRRAKWRRQEKLETSSSKLHDSPLLSFSRSPMATGVGPLSNTLPLEPWLTSPIPGTTTVHSMPAFMAP-SQALQPTYQSHTFLNSGPPMTPIQPLSGAPYQCMGGFM 191          
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Match: ENSXETT00000028778.1 (retina and anterior neural fold homeobox [Source:NCBI gene;Acc:100038124])

HSP 1 Score: 140.584 bits (353), Expect = 7.864e-39
Identity = 62/68 (91.18%), Postives = 66/68 (97.06%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK+E  +
Sbjct:  129 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVTS 196          
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Match: ARX (aristaless related homeobox [Source:NCBI gene;Acc:100486727])

HSP 1 Score: 117.857 bits (294), Expect = 3.098e-29
Identity = 58/106 (54.72%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPN-------VGKSLTSGLFPSNPYPFLN 539
             +K RR RTTFT+YQL ELERAF+K+HYPDV++REELAM++ L E RVQVWFQNRRAKWR++EK  A  H   L   FP        +G  L +  FP + +P L+
Sbjct:  298 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHAPGLP--FPGPLSASHPLGPYLDASPFPPH-HPALD 400          
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Match: ENSXETT00000045475.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234894:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045475.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.457e-28
Identity = 69/185 (37.30%), Postives = 93/185 (50.27%), Query Frame = 3
Query:   81 VENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNN 635
            V NEMCD  +             GK+         P   ++   ESS     +  +K RR RTTF+  QL ELE AF KSHYPDV++RE+LAM++ L E RVQVWFQNRRAKWR++EK E            P        GL+     P  + +  +V  ++ F    G+LNP+   ++L   N
Sbjct:   17 VANEMCDEDRT------------GKKI-------EPVAKQSCALESSA---PSGKRKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEMLGGISGFPMSHP-------LGLYLDGNSPLTDSAWKTVPLSTVFL---GVLNPLMTTSSLLMEN 169          
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Match: olfm3 (olfactomedin 3 [Source:Xenbase;Acc:XB-GENE-960616])

HSP 1 Score: 110.538 bits (275), Expect = 3.215e-27
Identity = 52/78 (66.67%), Postives = 63/78 (80.77%), Query Frame = 3
Query:  204 DETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            D+TES     SN  KK RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+  L E RVQVWFQNRRAKWR++E+ 
Sbjct:  170 DKTESE----SNKGKK-RRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF 242          
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Match: Rax (retina and anterior neural fold homeobox [Source:MGI Symbol;Acc:MGI:109632])

HSP 1 Score: 140.969 bits (354), Expect = 4.989e-39
Identity = 67/100 (67.00%), Postives = 77/100 (77.00%), Query Frame = 3
Query:  150 GKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            G+  P       PA  ++  +E  P +     KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA K++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:  107 GEARPSPGLSVGPAAGDSKLSEEEPPK-----KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 201          
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 115.546 bits (288), Expect = 1.798e-28
Identity = 49/70 (70.00%), Postives = 59/70 (84.29%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANH 452
             +K RR RTTFT+YQL ELERAF+K+HYPDV++REELAM++ L E RVQVWFQNRRAKWR++EK  A  H
Sbjct:  327 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTH 396          
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 115.546 bits (288), Expect = 1.798e-28
Identity = 49/70 (70.00%), Postives = 59/70 (84.29%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANH 452
             +K RR RTTFT+YQL ELERAF+K+HYPDV++REELAM++ L E RVQVWFQNRRAKWR++EK  A  H
Sbjct:  327 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTH 396          
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Match: Alx4 (aristaless-like homeobox 4 [Source:MGI Symbol;Acc:MGI:108359])

HSP 1 Score: 110.923 bits (276), Expect = 8.479e-28
Identity = 53/97 (54.64%), Postives = 71/97 (73.20%), Query Frame = 3
Query:  150 GKRCPKD-SSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            G + P+D +S + P+  E  ++ES+         K RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+  L E RVQVWFQNRRAKWR++E+ 
Sbjct:  174 GAKGPQDRASAEIPSPLEKTDSESN-------KGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF 263          
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Match: Alx4 (aristaless-like homeobox 4 [Source:MGI Symbol;Acc:MGI:108359])

HSP 1 Score: 112.079 bits (279), Expect = 9.048e-28
Identity = 53/97 (54.64%), Postives = 71/97 (73.20%), Query Frame = 3
Query:  150 GKRCPKD-SSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            G + P+D +S + P+  E  ++ES+         K RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+  L E RVQVWFQNRRAKWR++E+ 
Sbjct:  174 GAKGPQDRASAEIPSPLEKTDSESN-------KGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERF 263          
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Match: sp|O97039|RX_DUGJA (Retinal homeobox protein Rax (Fragment) OS=Dugesia japonica OX=6161 GN=RAX PE=2 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 4.403e-179
Identity = 237/263 (90.11%), Postives = 254/263 (96.58%), Query Frame = 3
Query:   12 NIDDILGIQDQKSLMINNYQHQSV-ENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 797
            NIDDILGI DQKSLM+NNYQHQSV ENE+CD+YQ ++ISVN R+LL+ KRCPKDSSEQSPAISEADETESSPD+LSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTS LFP+NPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGF+NF+S+NLEPPK+PMTL YGLFNEFSNFLS RSSSKDLNSN+KTCSIR++DN+N E
Sbjct:    6 NIDDILGIPDQKSLMLNNYQHQSVVENEICDSYQKKDISVNNRELLMVKRCPKDSSEQSPAISEADETESSPDQLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSSLFPANPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFSNFSSLNLEPPKIPMTLPYGLFNEFSNFLSTRSSSKDLNSNSKTCSIRTADNLNTE 268          
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Match: sp|Q9PVX0|RX2_CHICK (Retinal homeobox protein Rx2 OS=Gallus gallus OX=9031 GN=RX2 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.213e-41
Identity = 69/97 (71.13%), Postives = 77/97 (79.38%), Query Frame = 3
Query:  159 CPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            CP  +S + PA    D  +  P       KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:   94 CPGSASPELPA---GDGGDGKPSDEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 187          
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Match: sp|Q9PVY0|RX1_CHICK (Retinal homeobox protein Rx1 OS=Gallus gallus OX=9031 GN=RX1 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.374e-41
Identity = 74/109 (67.89%), Postives = 86/109 (78.90%), Query Frame = 3
Query:  126 VNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            +NK +  LG+ R P DS    PA +E ++ +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK+EA++
Sbjct:    3 LNKCEGDLGELRKPGDSEGTPPAAAEEEQPK----------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMEASS 101          
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Match: sp|O42357|RX2_DANRE (Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.114e-40
Identity = 93/207 (44.93%), Postives = 118/207 (57.00%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEM--------CDNYQNREI-----------------SVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN--------HTHNLQEVFPNVGKSLTSGLFPSNPY 527
            +ID ILG  +DQ  L+  + +H+  E+++         D Y + +I                 S +K D  LG  R   +S  +SP I + D+ +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++            + N   + PNVG    S   P +P+
Sbjct:   38 SIDVILGFSKDQDPLLEPSGRHKVDEDQLEEQEKQVNADPYSHLQIPDQTQQQQSVYHDTGLFSTDKCDADLGDPRSNVESDSRSPDIPDEDQPK----------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDTGTMKLHDSPIRSFNRPPMAPNVGP--MSNSLPLDPW 232          
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Match: sp|O42356|RX1_DANRE (Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 2.313e-40
Identity = 89/168 (52.98%), Postives = 107/168 (63.69%), Query Frame = 3
Query:   12 NIDDILGI-QDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCP-KDSSEQSPAISEAD-----------------ETES-SPDRLSN--CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            +ID ILG  +DQ SL+  N    +V +++          +++R    G   P +D SEQ P   +AD                 E++S SPD        KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEKI+A+ 
Sbjct:   38 SIDVILGFNKDQDSLL--NPGDNAVAHKVGGESLGEPGKLDQRVQPYGHLPPLRDGSEQ-PTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSADGEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDAST 202          
BLAST of retinal homeobox protein Rx vs. TrEMBL
Match: B7ZG60 (Retinal homeobox protein Rx OS=Schmidtea mediterranea OX=79327 GN=Rx PE=2 SV=1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 261/263 (99.24%), Postives = 261/263 (99.24%), Query Frame = 3
Query:   12 NIDDILGIQDQKSLMINNYQHQSVEN-EMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 797
            NIDDILGIQDQKSLMINNYQHQSVE  EMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE
Sbjct:   10 NIDDILGIQDQKSLMINNYQHQSVEEYEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 272          
BLAST of retinal homeobox protein Rx vs. TrEMBL
Match: B7ZG59 (Retinal homeobox protein Rx OS=Dugesia japonica OX=6161 GN=Rx PE=2 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 9.743e-177
Identity = 237/263 (90.11%), Postives = 254/263 (96.58%), Query Frame = 3
Query:   12 NIDDILGIQDQKSLMINNYQHQSV-ENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 797
            NIDDILGI DQKSLM+NNYQHQSV ENE+CD+YQ ++ISVN R+LL+ KRCPKDSSEQSPAISEADETESSPD+LSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTS LFP+NPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGF+NF+S+NLEPPK+PMTL YGLFNEFSNFLS RSSSKDLNSN+KTCSIR++DN+N E
Sbjct:   10 NIDDILGIPDQKSLMLNNYQHQSVVENEICDSYQKKDISVNNRELLMVKRCPKDSSEQSPAISEADETESSPDQLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSSLFPANPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFSNFSSLNLEPPKIPMTLPYGLFNEFSNFLSTRSSSKDLNSNSKTCSIRTADNLNTE 272          
BLAST of retinal homeobox protein Rx vs. TrEMBL
Match: H6V048 (RX (Fragment) OS=Schmidtea polychroa OX=50054 GN=Rx PE=2 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 5.770e-144
Identity = 198/199 (99.50%), Postives = 199/199 (100.00%), Query Frame = 3
Query:  138 DLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSS 734
            DLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLP+VESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSS
Sbjct:    1 DLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPNVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSS 199          
BLAST of retinal homeobox protein Rx vs. TrEMBL
Match: A0A0B6VNG0 (Retinal homeobox protein (Fragment) OS=Lottia gigantea OX=225164 GN=LgiRx PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.134e-41
Identity = 88/179 (49.16%), Postives = 110/179 (61.45%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGL----FPSNPY---PFLN-------MSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKD 740
            KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA+KI+LPEVRVQVWFQNRRAKWRRQEK+E    + N     P+VGKSL++ +     P +P+   P +N       +S P   S +  +   G+       +   +++F      PP  P+T     F    N L+A+S   D
Sbjct:   14 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAIKINLPEVRVQVWFQNRRAKWRRQEKLEGGKCSDNYS--LPSVGKSLSTSIGGTGLPIDPWLTPPIVNAVNLSASLSAPGTASMAAAFQ--GLPQGFPSQSVTSYSSFF-----PPGFPITSQANAFAGVFNPLTAQSCQND 183          
BLAST of retinal homeobox protein Rx vs. TrEMBL
Match: V4ACH7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_161249 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 7.042e-41
Identity = 88/179 (49.16%), Postives = 110/179 (61.45%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGL----FPSNPY---PFLN-------MSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKD 740
            KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA+KI+LPEVRVQVWFQNRRAKWRRQEK+E    + N     P+VGKSL++ +     P +P+   P +N       +S P   S +  +   G+       +   +++F      PP  P+T     F    N L+A+S   D
Sbjct:   41 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAIKINLPEVRVQVWFQNRRAKWRRQEKLEGGKCSDNYS--LPSVGKSLSTSIGGTGLPIDPWLTPPIVNAVNLSASLSAPGTASMAAAFQ--GLPQGFPSQSVTSYSSFF-----PPGFPITSQANAFAGVFNPLTAQSCQND 210          
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Match: rx2 (retinal homeobox protein Rx2-like [Source:NCBI gene;Acc:103040507])

HSP 1 Score: 145.591 bits (366), Expect = 7.154e-41
Identity = 78/143 (54.55%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   21 DILGIQDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            D LG Q  K +  + Y H      + DN Q  + + +   L    +C  D S+      E+D     P       KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++ ++
Sbjct:   67 DDLGEQ-GKHVTSDPYAHLP---SLSDNSQ--QPTFHDTGLFSSDKCDGDLSDLHRGGVESDSRSPEPPEEDQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDTSS 203          
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Match: rx1 (retinal homeobox protein Rx1-like [Source:NCBI gene;Acc:103032969])

HSP 1 Score: 142.895 bits (359), Expect = 6.653e-40
Identity = 75/113 (66.37%), Postives = 86/113 (76.11%), Query Frame = 3
Query:  111 NREISVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            + EI  NK +  LG+ R   DS  +SP   + DE +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++A+
Sbjct:  104 DTEIFSNKCESELGEVRKVSDSDRKSP--EQGDEEQP--------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDAS 206          
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Match: rx1 (retinal homeobox protein Rx1-like [Source:NCBI gene;Acc:103032969])

HSP 1 Score: 142.895 bits (359), Expect = 6.653e-40
Identity = 75/113 (66.37%), Postives = 86/113 (76.11%), Query Frame = 3
Query:  111 NREISVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            + EI  NK +  LG+ R   DS  +SP   + DE +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++A+
Sbjct:  104 DTEIFSNKCESELGEVRKVSDSDRKSP--EQGDEEQP--------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDAS 206          
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Match: rx1 (retinal homeobox protein Rx1-like [Source:NCBI gene;Acc:103032969])

HSP 1 Score: 142.895 bits (359), Expect = 6.653e-40
Identity = 75/113 (66.37%), Postives = 86/113 (76.11%), Query Frame = 3
Query:  111 NREISVNKRDLLLGK-RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            + EI  NK +  LG+ R   DS  +SP   + DE +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++A+
Sbjct:  104 DTEIFSNKCESELGEVRKVSDSDRKSP--EQGDEEQP--------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDAS 206          
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Match: rx3 (retinal homeobox gene 3 [Source:NCBI gene;Acc:30474])

HSP 1 Score: 132.494 bits (332), Expect = 1.763e-37
Identity = 58/69 (84.06%), Postives = 67/69 (97.10%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            + KHRRNRTTFTT+QLHELERAFE+SHYPDVYSREELA+K++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:   22 DAKHRRNRTTFTTFQLHELERAFERSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 90          
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 6.783e-20
Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  243 NKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWR 422
            N+K RR RTTFT  QL  LE  F K+ YPD++ REE+A+KI+LPE RVQVWF+NRRAK R
Sbjct:    3 NRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 85.8853 bits (211), Expect = 1.903e-19
Identity = 37/60 (61.67%), Postives = 48/60 (80.00%), Query Frame = 3
Query:  255 RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEK 434
            RR+RT FT  QL  LE+ F+K+HYPDV  RE LAM  +LPE RVQVWF+NRRAK+R++++
Sbjct:   44 RRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQR 103          
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 73.9442 bits (180), Expect = 6.690e-17
Identity = 38/84 (45.24%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQ-----EKIEAANHTHNLQEVFPN 482
            KK R+ RT F+ +QL +LER+FE+  Y  V  R ELA  +SL + +V+ W+QNRR KW+RQ     E +  A     LQ +FPN
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAVGLEFLAEAGTYGALQRLFPN 86          
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 74.3294 bits (181), Expect = 9.334e-17
Identity = 38/84 (45.24%), Postives = 52/84 (61.90%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQ-----EKIEAANHTHNLQEVFPN 482
            KK R+ RT F+ +QL +LER+FE+  Y  V  R ELA  +SL + +V+ W+QNRR KW+RQ     E +  A     LQ +FPN
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAVGLEFLAEAGTYGALQRLFPN 86          
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 65.4698 bits (158), Expect = 1.149e-12
Identity = 32/57 (56.14%), Postives = 41/57 (71.93%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAK 416
            +K RR RTTFT  QL +LE  F K+ YPD++ REE+A+KI+LPE RVQ+ F   R K
Sbjct:   36 RKQRRERTTFTRAQL-DLESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK 91          
BLAST of retinal homeobox protein Rx vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 50.0618 bits (118), Expect = 2.062e-7
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = 3
Query:  252 HRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQE 431
             R  RT      L  L+R FE +  P +  R++++  I +PE  V++WFQNRRAK R+++
Sbjct:   77 QRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQ 136          
BLAST of retinal homeobox protein Rx vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 47.7506 bits (112), Expect = 8.520e-7
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  255 RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFP 479
            RR R   ++ +L  L+  FEK   P    R ELA    + E  VQ+WFQN+R   +RQ +I  +  T  +Q V P
Sbjct:  177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQ-RIATSKSTTIIQTVSP 250          
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Match: EDO42147 (Predicted protein; Retinal homeobox [Source:UniProtKB/TrEMBL;Acc:A7S2G8])

HSP 1 Score: 134.806 bits (338), Expect = 6.367e-38
Identity = 73/123 (59.35%), Postives = 85/123 (69.11%), Query Frame = 3
Query:  138 DLLLGKRCPKDSSEQ--------SPAISEADETESSPDRLSN-----------CNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            D +LGK+ P    EQ        +P + E D+  S  D  SN             KK RRNRTTFTT+QLHELERAFEKSHYPDVY+REELA+KISLPEVRVQVWFQN+RAKWRR+EK+E A+
Sbjct:   29 DAILGKKEPARRPEQERKTINDSNPRLEE-DDINSDNDLSSNDGKSDEADGDSSKKKLRRNRTTFTTFQLHELERAFEKSHYPDVYTREELALKISLPEVRVQVWFQNKRAKWRREEKMEMAS 150          
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Match: EDO38926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH9])

HSP 1 Score: 109.383 bits (272), Expect = 3.975e-29
Identity = 48/80 (60.00%), Postives = 63/80 (78.75%), Query Frame = 3
Query:  198 EADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKI 437
            ++D  +S+P R      K RRNRTTFT YQL E+ER F+K+HYPDVY+RE+LA++ +L E RVQVWFQNRRAKWR++E+ 
Sbjct:    2 DSDSGDSAPKR------KKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRERF 75          
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Match: EDO42103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G7])

HSP 1 Score: 109.383 bits (272), Expect = 8.682e-29
Identity = 47/63 (74.60%), Postives = 58/63 (92.06%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEK 434
            +K RR+RTTFTTYQLH+LERAFEK+ YPDV++REELA+++ L E RVQVWFQNRRAKWR++EK
Sbjct:   18 RKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQNRRAKWRKREK 80          
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Match: EDO39160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY2])

HSP 1 Score: 102.064 bits (253), Expect = 2.889e-27
Identity = 45/62 (72.58%), Postives = 55/62 (88.71%), Query Frame = 3
Query:  249 KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEK 434
            K RR+RT FT YQL ELE+AF++SHYPDVY+RE L++KI LPE R+QVWFQNRRAKWR++EK
Sbjct:    4 KKRRHRTIFTNYQLEELEKAFKESHYPDVYARENLSLKIDLPEDRIQVWFQNRRAKWRKKEK 65          
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Match: EDO31796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWY2])

HSP 1 Score: 100.138 bits (248), Expect = 9.121e-27
Identity = 53/95 (55.79%), Postives = 65/95 (68.42%), Query Frame = 3
Query:  156 RCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIE 440
            R   D      A+   +E E    + S   +K RR RTTFT+YQL ELERAF K+HYPDV++RE LA+KI L E RVQVWFQNRRAKWR++EK +
Sbjct:    2 RNSDDEKSDEEAVDSNNELEG---KDSTAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQNRRAKWRKREKAQ 93          
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Match: rax (retina and anterior neural fold homeobox [Source:NCBI gene;Acc:100125459])

HSP 1 Score: 142.124 bits (357), Expect = 5.346e-40
Identity = 76/149 (51.01%), Postives = 97/149 (65.10%), Query Frame = 3
Query:   12 NIDDILGIQDQKSLMINNYQHQSVENEMCDNYQNREISV---NKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            +I+ ILG ++      +   H+S    + +    R  +V     +       C  DS ++   +S+ DET+          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA+K++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:   36 SIEAILGFKE------DTIFHKSASYNLTEKDAERSGAVAVMQTKKAPFPDSCAPDSPDRDGKLSD-DETQ---------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 168          
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Match: rx1 (retinal homeobox protein Rx1 [Source:NCBI gene;Acc:101165970])

HSP 1 Score: 140.969 bits (354), Expect = 4.194e-39
Identity = 72/126 (57.14%), Postives = 90/126 (71.43%), Query Frame = 3
Query:   69 QHQSVENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            QHQ  +  +  N  + E++  ++ + + +        +SPA S+ D  +          KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++A+
Sbjct:   99 QHQYHDTGLFANQSDEELAELRQSIQMDE-------GKSPASSKDDPPK----------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDAS 207          
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Match: rax (retina and anterior neural fold homeobox [Source:NCBI gene;Acc:100125459])

HSP 1 Score: 138.658 bits (348), Expect = 6.474e-39
Identity = 65/83 (78.31%), Postives = 72/83 (86.75%), Query Frame = 3
Query:  219 SPDRLSNCN------KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            SPDR    +      KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA+K++LPEVRVQVWFQNRRAKWRRQEK+E ++
Sbjct:   68 SPDRDGKLSDDETQKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSS 150          
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Match: rx2 (Rx2 transcription factor [Source:NCBI gene;Acc:100125458])

HSP 1 Score: 139.813 bits (351), Expect = 7.877e-39
Identity = 72/123 (58.54%), Postives = 85/123 (69.11%), Query Frame = 3
Query:   90 EMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLS---NCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAAN 449
            E+ D+ Q+   S +   L    +C     E S    E D  + SP  +    +  KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELA K++LPEVRVQVWFQNRRAKWRRQEK++ + 
Sbjct:   86 ELGDSSQHH--SYHDSSLFSSDKC----EEMSNLTKEVDIADGSPKSIKEEEHGKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELATKVNLPEVRVQVWFQNRRAKWRRQEKMDTST 202          
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Match: rx1 (retinal homeobox protein Rx1 [Source:NCBI gene;Acc:101165970])

HSP 1 Score: 140.584 bits (353), Expect = 9.605e-39
Identity = 62/67 (92.54%), Postives = 67/67 (100.00%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMK++LPEVRVQVWFQNRRAKWRRQEK++A+
Sbjct:  166 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKMDAS 232          
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Match: SMESG000033843.1 (SMESG000033843.1)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 262/262 (100.00%), Postives = 262/262 (100.00%), Query Frame = 3
Query:   12 NIDDILGIQDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 797
            NIDDILGIQDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE
Sbjct:   10 NIDDILGIQDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLGKRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANHTHNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNPMSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSNNKTCSIRSSDNINGE 271          
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 108.227 bits (269), Expect = 1.083e-26
Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIE 440
            +K RRNRTTFT  QL ELE+AF+++HYPDV++REELA++ISL E RVQVWFQNRRAKWR+ E+ +
Sbjct:   35 RKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTERFQ 99          
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 107.842 bits (268), Expect = 1.092e-26
Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIE 440
            +K RRNRTTFT  QL ELE+AF+++HYPDV++REELA++ISL E RVQVWFQNRRAKWR+ E+ +
Sbjct:   28 RKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTERFQ 92          
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 108.612 bits (270), Expect = 1.738e-26
Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 3
Query:  246 KKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIE 440
            +K RRNRTTFT  QL ELE+AF+++HYPDV++REELA++ISL E RVQVWFQNRRAKWR+ E+ +
Sbjct:  139 RKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTERFQ 203          
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Match: SMESG000020038.1 (SMESG000020038.1)

HSP 1 Score: 106.686 bits (265), Expect = 4.711e-26
Identity = 48/90 (53.33%), Postives = 64/90 (71.11%), Query Frame = 3
Query:  216 SSPDRLSNCNK-------------KHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAA 446
            S+P+ + +C+K             K RRNRTTF++YQL E+ER F+K+HYPDVY+RE+LA +  L E RVQVWFQNRRAKWR++E   A+
Sbjct:   40 SAPEEIQSCSKSDNGSANSEEAKKKKRRNRTTFSSYQLDEMERIFQKTHYPDVYAREQLAFRTGLSEARVQVWFQNRRAKWRKKEWFRAS 129          
The following BLAST results are available for this feature:
BLAST of retinal homeobox protein Rx vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAX1.916e-3968.00retina and anterior neural fold homeobox [Source:H... [more]
RAX21.124e-3784.06retina and anterior neural fold homeobox 2 [Source... [more]
RAX21.124e-3784.06retina and anterior neural fold homeobox 2 [Source... [more]
ARX1.434e-2870.00aristaless related homeobox [Source:HGNC Symbol;Ac... [more]
ALX44.559e-2769.01ALX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:450][more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-82.055e-3165.85Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Pr... [more]
ceh-83.839e-3165.85Homeobox protein ceh-8 [Source:UniProtKB/Swiss-Pr... [more]
ceh-174.756e-2670.31C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrE... [more]
vab-31.117e-2540.15MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71][more]
alr-16.779e-2553.41AristaLess (Drosophila homeodomain) Related [Sour... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rx5.684e-4053.29gene:FBgn0020617 transcript:FBtr0342783[more]
al1.284e-3047.93gene:FBgn0000061 transcript:FBtr0078053[more]
Pph131.003e-2773.44gene:FBgn0023489 transcript:FBtr0078070[more]
hbn4.760e-2771.88gene:FBgn0008636 transcript:FBtr0071556[more]
Drgx1.659e-2569.23gene:FBgn0085369 transcript:FBtr0302391[more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rx13.162e-4152.98retinal homeobox gene 1 [Source:NCBI gene;Acc:3047... [more]
rx13.162e-4152.98retinal homeobox gene 1 [Source:NCBI gene;Acc:3047... [more]
rx31.518e-4065.83retinal homeobox gene 3 [Source:NCBI gene;Acc:3047... [more]
rx22.981e-4044.93retinal homeobox gene 2 [Source:NCBI gene;Acc:3047... [more]
rx22.981e-4044.93retinal homeobox gene 2 [Source:NCBI gene;Acc:3047... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc173.513e-4244.62leucine rich repeat containing 17 [Source:Xenbase;... [more]
ENSXETT00000028778.17.864e-3991.18retina and anterior neural fold homeobox [Source:N... [more]
ARX3.098e-2954.72aristaless related homeobox [Source:NCBI gene;Acc:... [more]
ENSXETT00000045475.11.457e-2837.30pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
olfm33.215e-2766.67olfactomedin 3 [Source:Xenbase;Acc:XB-GENE-960616][more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rax4.989e-3967.00retina and anterior neural fold homeobox [Source:M... [more]
Arx1.798e-2870.00aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Arx1.798e-2870.00aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Alx48.479e-2854.64aristaless-like homeobox 4 [Source:MGI Symbol;Acc:... [more]
Alx49.048e-2854.64aristaless-like homeobox 4 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of retinal homeobox protein Rx vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O97039|RX_DUGJA4.403e-17990.11Retinal homeobox protein Rax (Fragment) OS=Dugesia... [more]
sp|Q9PVX0|RX2_CHICK1.213e-4171.13Retinal homeobox protein Rx2 OS=Gallus gallus OX=9... [more]
sp|Q9PVY0|RX1_CHICK1.374e-4167.89Retinal homeobox protein Rx1 OS=Gallus gallus OX=9... [more]
sp|O42357|RX2_DANRE2.114e-4044.93Retinal homeobox protein Rx2 OS=Danio rerio OX=795... [more]
sp|O42356|RX1_DANRE2.313e-4052.98Retinal homeobox protein Rx1 OS=Danio rerio OX=795... [more]
back to top
BLAST of retinal homeobox protein Rx vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B7ZG600.000e+099.24Retinal homeobox protein Rx OS=Schmidtea mediterra... [more]
B7ZG599.743e-17790.11Retinal homeobox protein Rx OS=Dugesia japonica OX... [more]
H6V0485.770e-14499.50RX (Fragment) OS=Schmidtea polychroa OX=50054 GN=R... [more]
A0A0B6VNG02.134e-4149.16Retinal homeobox protein (Fragment) OS=Lottia giga... [more]
V4ACH77.042e-4149.16Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rx27.154e-4154.55retinal homeobox protein Rx2-like [Source:NCBI gen... [more]
rx16.653e-4066.37retinal homeobox protein Rx1-like [Source:NCBI gen... [more]
rx16.653e-4066.37retinal homeobox protein Rx1-like [Source:NCBI gen... [more]
rx16.653e-4066.37retinal homeobox protein Rx1-like [Source:NCBI gen... [more]
rx31.763e-3784.06retinal homeobox gene 3 [Source:NCBI gene;Acc:3047... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010761.16.783e-2065.00pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
dmbx1b1.903e-1961.67diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
barhl26.690e-1745.24BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl29.334e-1745.24BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
otx51.149e-1256.14orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PHO22.062e-738.33Homeobox transcription factor; regulatory targets ... [more]
YOX18.520e-737.33Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421476.367e-3859.35Predicted protein; Retinal homeobox [Source:UniPr... [more]
EDO389263.975e-2960.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421038.682e-2974.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391602.889e-2772.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317969.121e-2755.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rax5.346e-4051.01retina and anterior neural fold homeobox [Source:N... [more]
rx14.194e-3957.14retinal homeobox protein Rx1 [Source:NCBI gene;Acc... [more]
rax6.474e-3978.31retina and anterior neural fold homeobox [Source:N... [more]
rx27.877e-3958.54Rx2 transcription factor [Source:NCBI gene;Acc:100... [more]
rx19.605e-3992.54retinal homeobox protein Rx1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of retinal homeobox protein Rx vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033843.10.000e+0100.00SMESG000033843.1[more]
SMESG000080420.11.083e-2669.23SMESG000080420.1[more]
SMESG000080420.11.092e-2669.23SMESG000080420.1[more]
SMESG000080420.11.738e-2669.23SMESG000080420.1[more]
SMESG000020038.14.711e-2653.33SMESG000020038.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032786
GenBankCAQ05992.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032786 ID=SMED30032786|Name=retinal homeobox protein Rx|organism=Schmidtea mediterranea sexual|type=transcript|length=911bp
CTTCCGATCTCAATATTGACGATATTCTAGGAATACAAGATCAGAAATCA
TTGATGATAAACAACTATCAGCATCAATCAGTAGAAAATGAAATGTGCGA
TAACTATCAAAATAGAGAAATTTCAGTGAATAAAAGAGATTTGTTGTTGG
GGAAAAGATGTCCGAAAGACAGCTCCGAACAATCTCCTGCTATCAGTGAA
GCTGATGAAACAGAATCGTCTCCAGATCGGTTAAGCAATTGCAACAAAAA
ACACAGAAGAAATCGAACCACTTTCACAACATATCAGCTCCATGAATTAG
AAAGAGCATTTGAAAAGAGTCATTATCCCGATGTTTATAGTCGGGAAGAA
TTGGCAATGAAGATTAGTTTACCTGAAGTTCGGGTTCAGGTTTGGTTTCA
AAATAGACGAGCAAAATGGAGGCGACAAGAAAAAATTGAAGCCGCTAATC
ACACTCACAATTTACAAGAGGTTTTTCCCAATGTTGGCAAATCACTGACT
TCCGGTTTATTTCCGTCTAATCCGTATCCATTTTTGAATATGTCTTTACC
AAGTGTTGAATCGACATCATTTTTCTATCATCAAAATGGAATGCTAAATC
CCATGTCAATGGTGAACAATTTGGGATTCAATAATTTCACATCAATCAAC
TTGGAGCCTCCAAAAGTTCCGATGACATTATCCTATGGGCTATTTAATGA
ATTTTCCAATTTTCTCTCAGCAAGGTCTTCATCAAAAGATCTTAACTCAA
ACAACAAAACTTGTTCAATTCGTTCATCAGATAACATTAATGGTGAATGA
GAGACCCAACTCACTTGATCCCTGAGACAGATGAAAGTACAATCTGACAG
AATTTCTGTACAAATGTTTATATTTCATTTGATTTTATTAATTTGATAGT
TTGCAAACGTT
back to top

protein sequence of SMED30032786-orf-1

>SMED30032786-orf-1 ID=SMED30032786-orf-1|Name=SMED30032786-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
SDLNIDDILGIQDQKSLMINNYQHQSVENEMCDNYQNREISVNKRDLLLG
KRCPKDSSEQSPAISEADETESSPDRLSNCNKKHRRNRTTFTTYQLHELE
RAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQEKIEAANH
THNLQEVFPNVGKSLTSGLFPSNPYPFLNMSLPSVESTSFFYHQNGMLNP
MSMVNNLGFNNFTSINLEPPKVPMTLSYGLFNEFSNFLSARSSSKDLNSN
NKTCSIRSSDNINGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032967Rx-like
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0007601visual perception
GO:0043010camera-type eye development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 81..143
e-value: 3.5E-27
score: 106.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 82..138
e-value: 6.4E-24
score: 83.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 79..139
score: 21.33
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 82..140
e-value: 5.04702E-24
score: 89.61
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 65..143
e-value: 1.8E-32
score: 112.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 50..81
NoneNo IPR availablePANTHERPTHR24329FAMILY NOT NAMEDcoord: 2..216
IPR032967Retinal homeobox protein Rx-likePANTHERPTHR24329:SF405RETINAL HOMEOBOX PROTEIN RXcoord: 2..216
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 114..137
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 78..145