J domain-containing protein

Overview
NameJ domain-containing protein
Smed IDSMED30032781
Length (bp)1095
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032781

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30032781SMESG000005055.1 Contig5101_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJB13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:HGNC Symbol;Acc:HGNC:30718])

HSP 1 Score: 331.257 bits (848), Expect = 2.684e-112
Identity = 160/315 (50.79%), Postives = 219/315 (69.52%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M +DYY +L I R++   +I +AYR+L +K+HP K+ E   S + F  ++EAYDVLSD  KRGIYD+FGE GLK G+P        WT GY +HG PEK F EF+  NNPF E+FD    ++ ++FGGL GRGVK +D  +ER+L ++LE++F GC KK+KI+RRVLN D  ++++ DKILT+ VK GW +GT+I F +EGDQGPN +PADIIF++K++ HPRF RE  NL +   I L KAL  C V++  LDDR+L+IP+ +I+ P Y   V GEGMPL E   +KGDL I F+I FP  LT ++K ++ +  
Sbjct:    1 MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEP-SSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 268.855 bits (686), Expect = 2.204e-87
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 268.855 bits (686), Expect = 2.204e-87
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 268.855 bits (686), Expect = 1.850e-86
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:   73 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 415          
BLAST of J domain-containing protein vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 269.626 bits (688), Expect = 3.230e-86
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:  115 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 457          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 227.639 bits (579), Expect = 6.055e-72
Identity = 134/340 (39.41%), Postives = 189/340 (55.59%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYG-------------------------RGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M KDYY++L I + AT  EI KAYRK+ +KYHP KN E+    ++F  ++EAYDVLSDD+K+ IYDQFGE GLK G P +    G     Y + G+P   F  F+  ++PF        G      GG  G                         RG   +D ++  +L ++LE+V  G  KKMKITR+V+  + +   + DK+LTV +K GW  GTKI FP+EGDQ PN  PADI+FV+KD+PHP+F RE  ++    KI L  AL G  + I  LD     + + +++ P  T  + G+G+P  +    +GDLII+F++ FP  L   Q+ +I   F
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAE-NKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMH-YEFRGDPMNIFSSFFGGSDPF-----GAGGPGMFDLGGGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHARQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQ--RLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVILRNF 331          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 227.639 bits (579), Expect = 6.055e-72
Identity = 134/340 (39.41%), Postives = 189/340 (55.59%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYG-------------------------RGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M KDYY++L I + AT  EI KAYRK+ +KYHP KN E+    ++F  ++EAYDVLSDD+K+ IYDQFGE GLK G P +    G     Y + G+P   F  F+  ++PF        G      GG  G                         RG   +D ++  +L ++LE+V  G  KKMKITR+V+  + +   + DK+LTV +K GW  GTKI FP+EGDQ PN  PADI+FV+KD+PHP+F RE  ++    KI L  AL G  + I  LD     + + +++ P  T  + G+G+P  +    +GDLII+F++ FP  L   Q+ +I   F
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAE-NKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMH-YEFRGDPMNIFSSFFGGSDPF-----GAGGPGMFDLGGGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHARQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQ--RLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVILRNF 331          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-27 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q25AR9])

HSP 1 Score: 73.1738 bits (178), Expect = 8.407e-14
Identity = 37/93 (39.78%), Postives = 60/93 (64.52%), Query Frame = 3
Query:    6 TMLLLYKIILCP*T*IPMSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHG 284
             ++LL  +I C    + +++DYYE+L + R A    I KA++KL +K HP +N +   ++D+F  +++AY+VL D+  R  YDQFGE GL+ G
Sbjct:    3 AIVLLSVLISCY---LVIAEDYYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYDQFGEKGLEDG 92          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 71.2478 bits (173), Expect = 1.765e-13
Identity = 42/127 (33.07%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  585 HDKILTVFVKKGWLEGTKIVFPEEGDQGPN-NVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVT--NIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
             D+I+ V +  G  +G K VF  +GD+      P D + VL +  H +F R+  NLI +  IDL++AL G +  I  LD R +   V    ++       +  EGMP+     +KGDL+++F++ FP
Sbjct:  205 EDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFP 331          

HSP 2 Score: 68.9366 bits (167), Expect = 9.624e-13
Identity = 51/160 (31.87%), Postives = 78/160 (48.75%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITR 548
            YY++L +   A+  E+ KAYRK+ +K+HP KNP+     +QF  +S+AY+VLSD++KR IYDQ GE  L+ G    + F+           NP   F  F+            +   +H                    NL +TL+ ++ G  KK+KI+R
Sbjct:    7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKNPD---GAEQFKQISQAYEVLSDEKKRQIYDQGGEEALQGGGGGGEGFH-----------NPFDVFDMFFGGGGRGGRGERRVKPTVH--------------------NLRVTLDTLYKGVTKKLKISR 132          
BLAST of J domain-containing protein vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 71.2478 bits (173), Expect = 1.765e-13
Identity = 42/127 (33.07%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  585 HDKILTVFVKKGWLEGTKIVFPEEGDQGPN-NVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVT--NIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
             D+I+ V +  G  +G K VF  +GD+      P D + VL +  H +F R+  NLI +  IDL++AL G +  I  LD R +   V    ++       +  EGMP+     +KGDL+++F++ FP
Sbjct:  205 EDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFP 331          

HSP 2 Score: 68.9366 bits (167), Expect = 9.624e-13
Identity = 51/160 (31.87%), Postives = 78/160 (48.75%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITR 548
            YY++L +   A+  E+ KAYRK+ +K+HP KNP+     +QF  +S+AY+VLSD++KR IYDQ GE  L+ G    + F+           NP   F  F+            +   +H                    NL +TL+ ++ G  KK+KI+R
Sbjct:    7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKNPD---GAEQFKQISQAYEVLSDEKKRQIYDQGGEEALQGGGGGGEGFH-----------NPFDVFDMFFGGGGRGGRGERRVKPTVH--------------------NLRVTLDTLYKGVTKKLKISR 132          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307057)

HSP 1 Score: 250.366 bits (638), Expect = 1.943e-80
Identity = 137/352 (38.92%), Postives = 206/352 (58.52%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLK-----HGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDG-------------DLHMS-FGGL-----YGRGVKT--------------KDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDI-VMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL +P+ AT  EI KAYRKL ++YHP KN  ++   D+F  V+EAY+VLSD  KR +YD++GE GLK     +G P S++F       Y +HG+P  TF +F+ ++NPF  +FD  D              D   S FGG+      G G ++              +D  +E +L +TLEE++HGCVKKMKI+RR++ AD  ++   +K L + +K GW  GTK+ F +EGDQ P  +PADI+F+++D+PH  F RE  +L Y  ++ L +AL G +  +  M  D++    +  I+ P     ++G G+P  +    KGDL++ F+I FP  LTA QK ++++
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAE-DKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFT------YQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQAD-GSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKD 344          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0335379)

HSP 1 Score: 248.054 bits (632), Expect = 1.782e-79
Identity = 137/356 (38.48%), Postives = 205/356 (57.58%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLK-----HGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDG-------------DLHMS-FGGL-----YGRGVK------------------TKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDI-VMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL +P+ AT  EI KAYRKL ++YHP KN  ++   D+F  V+EAY+VLSD  KR +YD++GE GLK     +G P S++F       Y +HG+P  TF +F+ ++NPF  +FD  D              D   S FGG+      G G +                   +D  +E +L +TLEE++HGCVKKMKI+RR++ AD  ++   +K L + +K GW  GTK+ F +EGDQ P  +PADI+F+++D+PH  F RE  +L Y  ++ L +AL G +  +  M  D++    +  I+ P     ++G G+P  +    KGDL++ F+I FP  LTA QK ++++
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAE-DKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFT------YQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQAD-GSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKD 348          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307056)

HSP 1 Score: 248.054 bits (632), Expect = 1.782e-79
Identity = 137/356 (38.48%), Postives = 205/356 (57.58%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLK-----HGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDG-------------DLHMS-FGGL-----YGRGVK------------------TKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDI-VMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL +P+ AT  EI KAYRKL ++YHP KN  ++   D+F  V+EAY+VLSD  KR +YD++GE GLK     +G P S++F       Y +HG+P  TF +F+ ++NPF  +FD  D              D   S FGG+      G G +                   +D  +E +L +TLEE++HGCVKKMKI+RR++ AD  ++   +K L + +K GW  GTK+ F +EGDQ P  +PADI+F+++D+PH  F RE  +L Y  ++ L +AL G +  +  M  D++    +  I+ P     ++G G+P  +    KGDL++ F+I FP  LTA QK ++++
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAE-DKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFT------YQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQAD-GSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKD 348          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0077972)

HSP 1 Score: 248.054 bits (632), Expect = 1.782e-79
Identity = 137/356 (38.48%), Postives = 205/356 (57.58%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLK-----HGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDG-------------DLHMS-FGGL-----YGRGVK------------------TKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDI-VMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL +P+ AT  EI KAYRKL ++YHP KN  ++   D+F  V+EAY+VLSD  KR +YD++GE GLK     +G P S++F       Y +HG+P  TF +F+ ++NPF  +FD  D              D   S FGG+      G G +                   +D  +E +L +TLEE++HGCVKKMKI+RR++ AD  ++   +K L + +K GW  GTK+ F +EGDQ P  +PADI+F+++D+PH  F RE  +L Y  ++ L +AL G +  +  M  D++    +  I+ P     ++G G+P  +    KGDL++ F+I FP  LTA QK ++++
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAE-DKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFT------YQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQAD-GSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKD 348          
BLAST of J domain-containing protein vs. Ensembl Fly
Match: DnaJ-1 (gene:FBgn0263106 transcript:FBtr0077123)

HSP 1 Score: 232.261 bits (591), Expect = 1.573e-73
Identity = 129/333 (38.74%), Postives = 188/333 (56.46%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFD-------------------HIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHI-PVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KD+Y+IL + R A+  EI KAYRKL +KYHP KN +S  + ++F  ++EAY+VLSD +KR I+D +GE GLK G P  D         Y +HG+P  TF +F+ S++PF  +F                    +I GD   +F        + +D  IE +L ++LEEV  GC+KKMKI+R    ++       +K+L + VK GW  GTKI FP+EGD  PN  PADI+F+++D+PH  F RE  +L Y  +I L +AL G +V +  L    + + P   I+ PT T  + G G+P+ +    +GDLI+ F+I FP  L    +  + E
Sbjct:    1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSN--GPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSE 330          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 329.331 bits (843), Expect = 1.405e-111
Identity = 156/318 (49.06%), Postives = 220/318 (69.18%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQK 1010
            M +DYY IL I R+A   +I KAYR+L +K+HP+ N  +  + ++F L++EA+DVLSD RK+  YD+FGE GLK G+P     N AW+ GY YHGN ++TF +F+  +NPF ++F     +++ +F  L GR  K +D  IER+L + LE++++GC KK+KI+RRV+N D  T+S+ DKILT  VK GW EGT+I FP+EGDQGPNN+PADI+FV++ + HPRF R+  +L Y   I L KAL G  V++  LD R+L+IP+ +IV P YT  V GEGMPL+    ++GDLII+F   FP  L+AE+K L+    + K
Sbjct:    1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSNSHARAA-ERFNLLAEAFDVLSDPRKKATYDKFGEEGLKGGIPSELGVNSAWSSGYVYHGNADETFRQFFGGDNPFADFFTGDGNEVNTAFESLRGRKEKLQDPPIERDLHLALEDLYYGCTKKIKISRRVMNEDGHTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQNDDLFYTEHISLEKALTGFSVEVETLDGRLLNIPINDIVHPQYTKVVSGEGMPLSNSPSKRGDLIIRFITHFPEKLSAEKKKLLRGALSTK 317          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 329.331 bits (843), Expect = 1.405e-111
Identity = 156/318 (49.06%), Postives = 220/318 (69.18%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQK 1010
            M +DYY IL I R+A   +I KAYR+L +K+HP+ N  +  + ++F L++EA+DVLSD RK+  YD+FGE GLK G+P     N AW+ GY YHGN ++TF +F+  +NPF ++F     +++ +F  L GR  K +D  IER+L + LE++++GC KK+KI+RRV+N D  T+S+ DKILT  VK GW EGT+I FP+EGDQGPNN+PADI+FV++ + HPRF R+  +L Y   I L KAL G  V++  LD R+L+IP+ +IV P YT  V GEGMPL+    ++GDLII+F   FP  L+AE+K L+    + K
Sbjct:    1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSNSHARAA-ERFNLLAEAFDVLSDPRKKATYDKFGEEGLKGGIPSELGVNSAWSSGYVYHGNADETFRQFFGGDNPFADFFTGDGNEVNTAFESLRGRKEKLQDPPIERDLHLALEDLYYGCTKKIKISRRVMNEDGHTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQNDDLFYTEHISLEKALTGFSVEVETLDGRLLNIPINDIVHPQYTKVVSGEGMPLSNSPSKRGDLIIRFITHFPEKLSAEKKKLLRGALSTK 317          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajb1b (DnaJ heat shock protein family (Hsp40) member B1b [Source:ZFIN;Acc:ZDB-GENE-030131-5455])

HSP 1 Score: 268.085 bits (684), Expect = 2.360e-87
Identity = 150/335 (44.78%), Postives = 207/335 (61.79%), Query Frame = 3
Query:   51 IPMSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDG--------DLHMSFG----GLY----------GRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILI 989
            + M KDYY +L I + A+  EI KAYRK  +KYHP KN +S  + ++F  ++EAYDVLSD +K+ IYD+FGE GLK G P      G +T  YT+ G+P   F EF+   NPF   F H  G        D   SFG    G +          GR  + +D ++  +L ++L+EVF GC KKMKI+R+ LN D RTT   DKILTV VKKGW EGTKI FP EGD+ P+N+PAD++FVLKD+PHP + R+  ++IY  KI L +AL GC++++  LD R + +   +IV P     + GEG+PL +  D +GDL++++E+ FP  L+   K  I
Sbjct:    2 VKMGKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKN-KSAGAEEKFKEIAEAYDVLSDPKKKDIYDRFGEEGLKGGAPGGGGGGGNYT--YTFQGDPHAMFSEFFGGRNPFEHIFGHNGGMDENMETDDPFASFGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTGCTKKMKISRKRLNPDGRTTRSEDKILTVEVKKGWKEGTKITFPREGDETPSNIPADVVFVLKDKPHPVYKRDGSDIIYPAKITLKEALCGCVINVPTLDGRTVKVTSQDIVRPGMKRRLTGEGLPLPKAPDRRGDLVVEYEVRFPEKLSQNAKDTI 333          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 267.314 bits (682), Expect = 1.007e-86
Identity = 147/361 (40.72%), Postives = 210/361 (58.17%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF-------------DHIDGDL---------------HMSFGG----------------LYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQ 1007
            M KDYY+IL IP  +   EI KAYRK+ +K+HP KN + +   ++F  ++EAY+VLSD +KR IYDQ+GE GLK G   S +  G     YT+HG+P  TF  F+  +NPF  +F             DH D D+               H  F G                L+G   K +D  +   L ++LEE+FHGC K+M+ITRR LN D +T    DKIL + +K+GW EGTKI FP+EGD+ P N+PADI FVLKD+ HP F R+  N+IY TKI L +AL GC V+I  +D+R + +P  +I+ P     ++GEG+P  +   ++GDLI++F++ FP  +  + + +I++   Q
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAE-EKFKEIAEAYEVLSDPKKRVIYDQYGEDGLKTGGTGSSSGQGTTYH-YTFHGDPHATFASFFGGSNPFDIFFGSSRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHLPQ 359          
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 267.314 bits (682), Expect = 1.007e-86
Identity = 147/361 (40.72%), Postives = 210/361 (58.17%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF-------------DHIDGDL---------------HMSFGG----------------LYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQ 1007
            M KDYY+IL IP  +   EI KAYRK+ +K+HP KN + +   ++F  ++EAY+VLSD +KR IYDQ+GE GLK G   S +  G     YT+HG+P  TF  F+  +NPF  +F             DH D D+               H  F G                L+G   K +D  +   L ++LEE+FHGC K+M+ITRR LN D +T    DKIL + +K+GW EGTKI FP+EGD+ P N+PADI FVLKD+ HP F R+  N+IY TKI L +AL GC V+I  +D+R + +P  +I+ P     ++GEG+P  +   ++GDLI++F++ FP  +  + + +I++   Q
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAE-EKFKEIAEAYEVLSDPKKRVIYDQYGEDGLKTGGTGSSSGQGTTYH-YTFHGDPHATFASFFGGSNPFDIFFGSSRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHLPQ 359          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:780382])

HSP 1 Score: 335.88 bits (860), Expect = 1.331e-113
Identity = 162/315 (51.43%), Postives = 221/315 (70.16%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M +DYY +L I   A   +I KAYRKL +KYHP KN E    + +F  ++EAYDVLSD RK+  YD+FGE GLK GVP       AWT GY +HGNP++TF EF+  +NPF ++F     +++  FGGL GRG+KT+D  IER+L ++LE++F GC KK+KI+RRV+N D  T+S+ DKIL++  + GW EGTKI F  EGDQGPN +PADIIF+++++ HPRF R+  +LIY   I+L KAL GC V++  LD+R+L+IP+ +IV PTY   V GEGM L +    KGDLII+F+I FP +LT ++K L+ +  
Sbjct:   36 MGQDYYSVLEITPSAGDSDIKKAYRKLALKYHPLKNKEPSAPH-RFKQIAEAYDVLSDLRKKATYDKFGEEGLKGGVPPEFGGEEAWTSGYVFHGNPDRTFNEFFGGDNPFADFFTPTGSEVNTGFGGLRGRGMKTQDPPIERDLYLSLEDLFFGCTKKIKISRRVMNDDGHTSSIRDKILSIDARPGWREGTKITFQNEGDQGPNIIPADIIFIVREKQHPRFKRQGNDLIYTANIELGKALTGCTVEVETLDERLLNIPINDIVHPTYRKVVPGEGMRLPKDPTLKGDLIIQFDIHFPEHLTPQKKQLLRKAL 349          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:Xenbase;Acc:XB-GENE-1217623])

HSP 1 Score: 268.855 bits (686), Expect = 1.172e-86
Identity = 142/346 (41.04%), Postives = 207/346 (59.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF-----------DHIDGDLH---------------MSFGGLYGRGV-------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL +   A   EI KAYRK+ +KYHP KN +++   D+F  ++EAYDVLSD +KR +YDQ+GE GLK G   +     ++   YT+HG+P  TF  F+  +NPF  +F           DH D D++                   G + R         K +D  +   L ++LEE++HGC K+MKITRR LN D RT    DKIL V +KKGW EGTKI FP+EGD    N+PADI+F+LKD+PH  F R+  N++Y  KI L +AL GC V+I  +D RV+ +P ++++ P     ++GEG+P  +V +++GDLI++F++ FP  +    + L+++
Sbjct:   60 MGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAE-DKFKEIAEAYDVLSDPKKRAVYDQYGEEGLKTGGGSTGNTGSSFH--YTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHEDMDINEDEDDLFGGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPPVVHELKVSLEEIYHGCTKRMKITRRRLNPDGRTVRTEDKILNVVIKKGWKEGTKITFPKEGDATSENIPADIVFLLKDKPHALFKRDGSNIVYTAKITLKEALCGCTVNIPTIDGRVIPLPCSDVIKPGAVKRLRGEGLPFPKVPNQRGDLIVEFQVRFPDRIPQPTRELLKQ 402          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: dnajb1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:NCBI gene;Acc:493474])

HSP 1 Score: 255.373 bits (651), Expect = 3.810e-82
Identity = 145/346 (41.91%), Postives = 200/346 (57.80%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTE-GYTYHGNPEKTFFEFYSSNNPFREYFDH---------------------------------IDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIE 992
            M KDYY+IL IP+ AT  EI KAYRK  +KYHP KN +     D+F  ++EAYDVLSD +KR ++D++GE GLK       +  G      YT+HG+P   F EF+   NPF  +F                                     G    S  G      + +D  I R L ++LEEVF+GC KKMKI+ + L  D R+    DKILT+ VKKGW EGTKI FP+EGD+ P+N+PADI+FVLKD+ HP F RE  +++Y +KI L +AL GC V+I  +D+R + +  T+I+ P     +  EG+PL +  D++GDLI++F+I FP  LTA  + ++E
Sbjct:    1 MGKDYYKILGIPKGATEEEIKKAYRKQALKYHPDKNKDPGAE-DRFKEIAEAYDVLSDPKKREVFDKYGEEGLKGTPGGGGSSGGPNGTYSYTFHGDPHAVFAEFFGGRNPFDGFFGRNDDDMDTDDPFAGFGGMGGFGGMGGMGGMGGMGGMGGFPRSASGRRDTVPRKQDPPITRELPVSLEEVFNGCTKKMKISHKRLGPDGRSVRNEDKILTIQVKKGWKEGTKITFPKEGDETPSNIPADIVFVLKDKSHPVFKREGSDVVYTSKISLREALCGCSVNIPTVDNRTIPLTFTDIIRPGTKRRITNEGLPLPKSPDQRGDLIVEFDIRFPERLTASSREVLE 345          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:100125006])

HSP 1 Score: 253.447 bits (646), Expect = 1.828e-81
Identity = 130/335 (38.81%), Postives = 197/335 (58.81%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDH------------IDGDLHMSFGGLYGRGV------------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILI 989
            M KDYY +L I + A+  +I KAYRK  +K+HP KN +S  + ++F  ++EAY+VLSD +KR +YDQFGE GLK G    D   G +   YT+HG+P  TF  F+   NPF  +F              +DGD   SF      G             + +D  I  +L ++LEE++ GC K+M+I+R+ LN D R+    DKILT+ +KKGW EGTKI FP EGD+ P  +PADI+FV+KD+PH  F R+  N++   ++ L +AL GC +++  LD R + + + +I+ P     + G G+P  +  ++ GDL+++FE++FP  +    K ++
Sbjct:    1 MGKDYYSVLGIEKGASEDDIKKAYRKQALKWHPDKN-KSAHAEEKFKEIAEAYEVLSDPKKREVYDQFGEEGLKGGSGAPDGHGGNFH--YTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGDPFSSFTSFNMNGFPREKNQVGNQFRRKQDPPIIHDLRVSLEEIYTGCTKRMRISRKRLNPDGRSVRTEDKILTIEIKKGWKEGTKITFPREGDEAPMTIPADIVFVVKDKPHTHFKRDGSNIVCPVRVSLREALCGCSINVPTLDGRSIPMTINDIIKPGMRRRIIGYGLPFPKNPEQNGDLLVEFEVIFPDSIPQSSKEIL 332          
BLAST of J domain-containing protein vs. Ensembl Xenopus
Match: dnaja4.1 (DnaJ heat shock protein family (Hsp40) member A4 [Source:NCBI gene;Acc:780309])

HSP 1 Score: 143.28 bits (360), Expect = 1.295e-38
Identity = 102/327 (31.19%), Postives = 156/327 (47.71%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHG-----NPEK-----------TFFEFYSSNNPFREYFDHIDGDLHMSFGG----------LYGRGVKTKDDSIERNLMITLEEVF---HGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPV--TNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
            YY+ L +  +AT  EI KAYRKL +KYHP KNP+     ++F L+S+AY+VLSD +KR +YDQ GE  +K G      F+        + G     N EK           +  + Y+  +       ++       +GG            GRGV+ +   I   ++  ++ +    HG  +++    R      +      KIL V + KG  +G KI+F  EGDQ P   P D++ VL  + H  + R++ +LI K  I L +AL G    I  +D R+L +      ++   +   ++ EGMPL     EKG LII+FE+ FP
Sbjct:    7 YYDTLGVKPNATPDEIKKAYRKLALKYHPDKNPKEG---EKFKLISQAYEVLSDPKKRDLYDQGGEQAIKEGGMGGGNFSSPMDIFDMFFGGGGRMNREKRGKNVVHQLAVSLNDLYNGTSRKLALQKNVICSKCEGYGGKKGAVEKCTTCKGRGVQVRVQQIGPGMVQQIQSMCSDCHGEGERINQKDRCKQCSGKKVVREKKILEVHINKGMKDGQKIMFSGEGDQEPGLEPGDVVIVLDQKEHDVYQRQQNDLIMKMNITLVEALCGFKKPIETMDGRILQVTSFPGEVIKYGHFKCIRNEGMPLQRDPFEKGLLIIQFEVAFP 330          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:MGI Symbol;Acc:MGI:1916637])

HSP 1 Score: 327.791 bits (839), Expect = 4.388e-111
Identity = 160/315 (50.79%), Postives = 218/315 (69.21%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M  DYY +L + R++   +I KAYRKL +K HP K+ E     + F  ++EAYDVLSD  KRGIYD+FGE GLK G+P        WT GY +HGNP+K F EF+  +NPF E+FD    D+ ++FGGL+GRGV+ +D  IER+L ++LE++F GC KK+KI+RRVLN D  ++++ DKILT+ V+ GW +GT+I F +EGDQGPN +PADIIF++K++ HPRF RE  NL +   I L KAL  C V++  LDDR+L+IP+ +IV P Y   V GEGMPL E   +KGDL I F+I FP  LT ++K ++ +  
Sbjct:    1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAP-EIFKQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:MGI Symbol;Acc:MGI:1916637])

HSP 1 Score: 263.848 bits (673), Expect = 8.097e-87
Identity = 131/267 (49.06%), Postives = 178/267 (66.67%), Query Frame = 3
Query:  201 VSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            ++EAYDVLSD  KRGIYD+FGE GLK G+P        WT GY +HGNP+K F EF+  +NPF E+FD    D+ ++FGGL+GRGV+ +D  IER+L ++LE++F GC KK+KI+RRVLN D  ++++ DKILT+ V+ GW +GT+I F +EGDQ              ++ HPRF RE  NL +   I L KAL  C V++  LDDR+L+IP+ +IV P Y   V GEGMPL E   +KGDL I F+I FP  LT ++K ++ +  
Sbjct:    2 IAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQ--------------EKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 254          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 266.544 bits (680), Expect = 1.334e-86
Identity = 146/346 (42.20%), Postives = 207/346 (59.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KR +YDQ+GE GLK G   S    G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGSSGGSGGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 266.544 bits (680), Expect = 1.334e-86
Identity = 146/346 (42.20%), Postives = 207/346 (59.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KR +YDQ+GE GLK G   S    G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGSSGGSGGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 266.544 bits (680), Expect = 1.334e-86
Identity = 146/346 (42.20%), Postives = 207/346 (59.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KR +YDQ+GE GLK G   S    G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGSSGGSGGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|P59910|DJB13_HUMAN (DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.289e-111
Identity = 160/315 (50.79%), Postives = 219/315 (69.52%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M +DYY +L I R++   +I +AYR+L +K+HP K+ E   S + F  ++EAYDVLSD  KRGIYD+FGE GLK G+P        WT GY +HG PEK F EF+  NNPF E+FD    ++ ++FGGL GRGVK +D  +ER+L ++LE++F GC KK+KI+RRVLN D  ++++ DKILT+ VK GW +GT+I F +EGDQGPN +PADIIF++K++ HPRF RE  NL +   I L KAL  C V++  LDDR+L+IP+ +I+ P Y   V GEGMPL E   +KGDL I F+I FP  LT ++K ++ +  
Sbjct:    1 MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEP-SSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80Y75|DJB13_MOUSE (DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 3.069e-110
Identity = 160/315 (50.79%), Postives = 218/315 (69.21%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M  DYY +L + R++   +I KAYRKL +K HP K+ E     + F  ++EAYDVLSD  KRGIYD+FGE GLK G+P        WT GY +HGNP+K F EF+  +NPF E+FD    D+ ++FGGL+GRGV+ +D  IER+L ++LE++F GC KK+KI+RRVLN D  ++++ DKILT+ V+ GW +GT+I F +EGDQGPN +PADIIF++K++ HPRF RE  NL +   I L KAL  C V++  LDDR+L+IP+ +IV P Y   V GEGMPL E   +KGDL I F+I FP  LT ++K ++ +  
Sbjct:    1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAP-EIFKQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|O75953|DNJB5_HUMAN (DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.058e-86
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5BIP8|DNJB5_BOVIN (DnaJ homolog subfamily B member 5 OS=Bos taurus OX=9913 GN=DNAJB5 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.259e-86
Identity = 147/346 (42.49%), Postives = 209/346 (60.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KRG+YDQ+GE GLK G   S   +G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGSSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSARPFSGFDPDDMDVDEDDDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. UniProt/SwissProt
Match: sp|O89114|DNJB5_MOUSE (DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 9.330e-86
Identity = 146/346 (42.20%), Postives = 207/346 (59.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMS---------------FG--GLYG-----RGV-----------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP  A   EI KAYRK+ +KYHP KN E +   ++F  ++EAYDVLSD +KR +YDQ+GE GLK G   S    G++   YT+HG+P  TF  F+  +NPF  +F         S               FG  G +G     RG            K +D  +   L ++LEE++HG  K+MKITRR LN D RT    DKIL + +K+GW EGTKI FP+EGD  P+N+PADI+FVLKD+PH  F R+  N++Y   I L +AL GC V+I  +D RV+ +P  +++ P     ++GEG+P  +V  ++GDLI++F++ FP  LT + + ++++
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAE-EKFKEIAEAYDVLSDPKKRSLYDQYGEEGLKTGGGSSGGSGGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQ 343          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A1I8ISK7 (J domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016125g1 PE=4 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.768e-138
Identity = 188/313 (60.06%), Postives = 244/313 (77.96%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M +DYY+ LN+  + T+ ++ +AYRKL +KYHP+KN E + + ++F  ++EAYDVLSD+RKR +YDQFGE GLK GVP     +GA TEGYT+HG+P + F EF+ ++NPFRE+FD +DGD+HMSFGGL+GRG K KD+ IER+L+++LEE+FHGCVKKMKI RRV+N D  T+SV +KILT+ VK+GW +GTKI FPEEGDQGPNNVPADI+FV+KD+PHPRF RE  +LIY   I L +AL    V+I  LDDRVLHIP+T+IV PT+  TV GEGMPL E   +KGDL I+F + FP  L+AEQ+  I +
Sbjct:    1 MGRDYYKTLNLSANCTVDDVKRAYRKLALKYHPQKNAE-ESAKEKFLQIAEAYDVLSDNRKRAVYDQFGEEGLKAGVPHGFNRSGAHTEGYTFHGDPLRVFLEFFGNDNPFREFFDRVDGDMHMSFGGLHGRGQKKKDEPIERDLVVSLEEIFHGCVKKMKIARRVMNEDGHTSSVREKILTIVVKRGWRQGTKITFPEEGDQGPNNVPADIVFVVKDKPHPRFRREGSDLIYTADIPLGRALTSYTVNITTLDDRVLHIPITDIVHPTFVKTVPGEGMPLPENPAQKGDLHIRFNVQFPTKLSAEQRKAIAD 312          
BLAST of J domain-containing protein vs. TrEMBL
Match: K1QF03 (DnaJ-like protein subfamily B member 13 OS=Crassostrea gigas OX=29159 GN=CGI_10006977 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.376e-135
Identity = 185/315 (58.73%), Postives = 237/315 (75.24%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M  DYY+IL + R AT  +I K YRKL +KYHP +N     + D+F   +EAYDVLSD RKR  YDQFGE GLK+GVP+     GAWT+GYT+HGN EK F +F+  +NPF+E++D +DGDL M FGGL GRG K +D  IER+L+++LEEVFHGC KKMKITRRV+N D  T+S+ +KILT+ VKKGW  GTKI FPEEGDQGPNNVPADI+F++KD+PHPRF R+  NLI+  K+ L KAL GC V+I+ LD+RVLHIP+ +I+ P YT  V GEGMP++    +KGDL+I+F+I FP  LT ++K LI++  
Sbjct:    1 MGVDYYDILKLTRSATDADIKKNYRKLSLKYHPDRNSGDQDALDKFKQCAEAYDVLSDPRKRATYDQFGEEGLKNGVPQGSGEAGAWTQGYTFHGNAEKVFRDFFGGDNPFQEFYDRVDGDLSMGFGGLQGRGRKKQDPPIERDLVLSLEEVFHGCTKKMKITRRVMNEDGHTSSIREKILTITVKKGWKPGTKITFPEEGDQGPNNVPADIVFIVKDKPHPRFRRQGINLIHTAKVPLGKALTGCTVEIITLDERVLHIPINDIIKPGYTKVVPGEGMPVSADPTKKGDLVIEFDIEFPTSLTPDRKDLIKKAL 315          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A210Q9X2 (DnaJ-like subfamily B member 13 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07855 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 5.830e-135
Identity = 183/317 (57.73%), Postives = 235/317 (74.13%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQ 1007
            M  DYY IL+I R AT  EI K YRKL +++HP KNP    +YD++  V+EAYDVL D  KR +YDQFGE GLK+GVP      GAWT+GYT+HGN EK F +F+  +NP++E++D +DGDL M FGGL GRG K +D  IER+L ++LEEVFHGC KKMKI+RRV+N D  T+S+ DKILT+ VK GW  GTKI FPEEGDQGPNNVPADI+F++KD+PHPRF R   NL++  K+ L KAL GC V+I  LD+RVLHIP+ +I+ P YT  V GEGMP+++   +KGDL+I+F+I FP  LT ++K +I+    Q
Sbjct:    1 MGVDYYNILDISRSATDAEIKKQYRKLSLRFHPDKNPGDQVAYDKYKQVAEAYDVLCDPPKRAVYDQFGEEGLKNGVPEGSGETGAWTQGYTFHGNAEKVFRDFFGGSNPYQEFYDRVDGDLSMGFGGLQGRGRKKQDPPIERDLFLSLEEVFHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKNGWKPGTKITFPEEGDQGPNNVPADIVFIVKDKPHPRFRRNGVNLVHTAKVPLGKALTGCDVEINTLDERVLHIPINDIIKPGYTKRVPGEGMPISQSPSQKGDLVIEFDIEFPTSLTPDRKDMIKRSLLQ 317          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A1S3K330 (dnaJ homolog subfamily B member 13 OS=Lingula unguis OX=7574 GN=LOC106178147 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.701e-134
Identity = 182/315 (57.78%), Postives = 236/315 (74.92%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M +DYY +L + R A   +I KAYRKL ++YHP+KN     + ++F  ++EAYDVLSD RKR  YDQFGE GLK GVP+    +GAWT+GYT+HGNP+K F +F+  +NPF+E++D +DGD+ M FGGL+GRG K KD  IER+L ++LEE FHGC KKMKI+RRV+N D  T+S+ DKILT+ VKKGWL GTKI F EEGDQGPNNVPADI+F++KD+PHPRF R   +LIY  KI L +AL GC V++  LD+R+L+IP+ +IV P YT  V  EGMP+++   +KGDLII+F I FPR LT E+K LI +  
Sbjct:    1 MGQDYYSVLGLSRSAADADIKKAYRKLALRYHPEKNFGDQVAAEKFKHIAEAYDVLSDPRKRATYDQFGEEGLKGGVPQGSGESGAWTQGYTFHGNPDKVFRDFFGGDNPFQEFYDRVDGDMVMGFGGLHGRGAKKKDPPIERDLALSLEETFHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKKGWLPGTKITFQEEGDQGPNNVPADIVFIVKDKPHPRFRRSGTDLIYTAKIPLGQALTGCTVEVTTLDERILNIPINDIVHPGYTKRVPTEGMPISKDPSQKGDLIIEFNIEFPRQLTPEKKDLIRKAL 315          
BLAST of J domain-containing protein vs. TrEMBL
Match: A0A2C9JC89 (J domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078668 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 6.173e-134
Identity = 185/308 (60.06%), Postives = 229/308 (74.35%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQK 980
            M  DYY+IL + R AT  +I K YRKL +KYHP KN     + D+F  V+EAYDVLSD RKR +YDQFGE GLKHGVP      GAWT GY +HGNPEK F EF+  +NPF+E+ D IDGDL M FGGL+GRG K +D  IER+L ++LEEV+HGC KKMKI+RRV+N D  T+S+ DKILT+ VKKGW  GTKI FP+EGDQGPNNVPADI+F++KD+PHPRF R+  NLI++ ++ L +AL GC V+I  LD+R LHIP+ +I+ P YT  V GEGMPL     +KGDLII+F+I FP  L  E+K
Sbjct:    1 MGVDYYDILGLTRSATDADIKKFYRKLSLKYHPDKNQGDQNAADKFMQVAEAYDVLSDPRKRAVYDQFGEEGLKHGVPAGSGHAGAWTYGYVFHGNPEKVFREFFGGDNPFQEFHDRIDGDLSMGFGGLHGRGAKKQDPPIERDLFLSLEEVYHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKKGWRPGTKITFPQEGDQGPNNVPADIVFIVKDKPHPRFRRDGANLIHRARVPLGRALTGCTVEIHTLDERTLHIPINDIIRPGYTKVVPGEGMPLVVAPCDKGDLIIEFDIEFPPSLPPEKK 308          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajb1b (dnaJ homolog subfamily B member 1 [Source:NCBI gene;Acc:103047132])

HSP 1 Score: 262.307 bits (669), Expect = 4.455e-85
Identity = 148/339 (43.66%), Postives = 199/339 (58.70%), Query Frame = 3
Query:   51 IPMSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGD--------------------------LHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILI 989
            + M KDYY +L I + A+  EI KAYRK  +KYHP KN +S  + ++F  ++EAYDVLSD +K+ IYD+FGE GLK G              YT+ G+P   F EF+   NPF ++F H  G                            +M  GG  G+  K +D  +   L ++LEEVF GC KKMKI+RR LN D R+T   DKILTV VKKGW EGTK+ FP+EGD+ P N+PAD++FV+KD+PHP F R+  ++IY  K+ L +AL GC V    LD R + + V +IV P     V GEG+P  +  D +GDLI++FE+ FP  L+ + K  I
Sbjct:    2 VKMGKDYYSVLGIKKGASDDEIKKAYRKQALKYHPDKN-KSPGAEEKFKEIAEAYDVLSDSKKKDIYDRFGEEGLKGGAGGGGPNGPGGFT-YTFQGDPHAMFSEFFGGRNPFEQFFGHGYGPEEDMETDNPFMNFGMGGMGGMGGGRPFNMRPGGPGGKLEKRQDPPVTHELKVSLEEVFSGCTKKMKISRRRLNPDGRSTRSEDKILTVEVKKGWKEGTKVTFPKEGDETPTNIPADVVFVVKDKPHPVFKRDGSDIIYPAKVTLKEALCGCSVKAPTLDGRSVTVTVQDIVRPGMKRRVTGEGLPFPKTPDRRGDLIVEFEVKFPERLSQDAKDTI 338          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 255.373 bits (651), Expect = 1.434e-83
Identity = 133/315 (42.22%), Postives = 182/315 (57.78%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M +DYY  L I R AT  +I KAYR+L +K+HP+ N  +  S ++F  ++EAYDVLSD RK+  YD FGE GLK G+P     NGAW+ GY YHGNP+KTF +F+  +NPF                            ++E  ++ T +                         + DKILT+ VK GW EGT+I F +EGDQGPNN+PADIIF+++ +PHPRF R+  +L Y   I L  AL G  V++  LD R+L+IPV +IV P Y+  V GEGMPL+     KGDLII+F+  +P  LT E++ L+++  
Sbjct:    1 MGRDYYASLEINRSATDADIKKAYRRLALKFHPQSN-RNPGSEERFIELAEAYDVLSDLRKKATYDTFGEEGLKGGIPPEIAANGAWSSGYVYHGNPDKTFRQFFGGDNPF----------------------------AVEMYILSTKKHF-----------------------IKDKILTISVKPGWNEGTRITFQKEGDQGPNNIPADIIFIVRQKPHPRFTRQNADLTYTAHISLEMALTGFAVEVATLDGRLLNIPVNDIVHPEYSKVVPGEGMPLSSNPSTKGDLIIQFKTQYPEKLTPEKRQLLKQAL 263          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 253.447 bits (646), Expect = 1.285e-81
Identity = 141/339 (41.59%), Postives = 204/339 (60.18%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF---------DHIDGDLHMSFG-----------------GLYGRGVKTKDD-SIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIE 992
            M KDYY+IL I + A   +I KAYRK  +K+HP KN   + S ++F  ++EAY+VLSD +KR IYDQ GE GLK G   +D     +T  YT+HG+P  TF  F+   NPF  +F         D ++ D    FG                 GL G+    K D +I   L ++LEEVFHGC K+MKI+R+ LN D RT    DKILT+ +K+GW EGTKI FP EGD+ PN +PADI+FV+KD+PH  F RE  +++Y  ++ L ++L GC V +  +D +  +I +T+++ P    T+ G+G+P  +  D++GDLI++F++ FP  L    K +++
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKAPNAS-EKFKEIAEAYEVLSDPKKREIYDQHGEEGLKGGGGPTDGQGSNFT--YTFHGDPHATFATFFGGANPFEMFFGRKVNGRDDDDMEVDGSDPFGSFTSFNINGFPRGERPVGLGGQPRSRKQDPAIHHELRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDEAPNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGCSVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLK 336          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 249.21 bits (635), Expect = 8.155e-81
Identity = 132/312 (42.31%), Postives = 191/312 (61.22%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIE 992
            M KDYY+IL I + A   +I KAYRK  +K+HP KN   + S ++F  ++EAY+VLSD +KR IYDQ GE GLK G   +D     +T  YT+HG+P  TF  F+   NPF  +F                           R L ++LEEVFHGC K+MKI+R+ LN D RT    DKILT+ +K+GW EGTKI FP EGD+ PN +PADI+FV+KD+PH  F RE  +++Y  ++ L ++L GC V +  +D +  +I +T+++ P    T+ G+G+P  +  D++GDLI++F++ FP  L    K +++
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKAPNAS-EKFKEIAEAYEVLSDPKKREIYDQHGEEGLKGGGGPTDGQGSNFT--YTFHGDPHATFATFFGGANPFEMFFG--------------------------RKLRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDEAPNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGCSVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLK 283          
BLAST of J domain-containing protein vs. Ensembl Cavefish
Match: dnajb1a (dnaJ homolog subfamily B member 1-like [Source:NCBI gene;Acc:103024650])

HSP 1 Score: 243.432 bits (620), Expect = 1.102e-77
Identity = 135/336 (40.18%), Postives = 195/336 (58.04%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHM----------------------------SF----GGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLT 968
            M KDYY+IL I + A+  EI KAYRK  +++HP KN ++  + D+F  ++EAYDVLSD +K+ IYD++GE   +     S     A    YT+HG+P   F EF+   +PF ++F H  GD  M                            SF    GG +G   K KD  +   L ++LEEV+ GC KKMKI+R+ LN D  +    DKILTV +K+GW EGTKI FP EGD+ P N+PADI+FV+KD+ HP F R+  ++IY  +I L  AL GC ++   LD R + +   +++ P     + GEG+PL++  D++GD++++F + FP  LT
Sbjct:    2 MGKDYYKILGIQKGASEEEIKKAYRKQALRFHPDKN-KAPGAEDKFKEIAEAYDVLSDSKKKEIYDRYGE---EGLKGHSGGGGSANGPSYTFHGDPHAMFAEFFGGRSPFDQFFAH-GGDDDMDVEDPFAAFGMGGMGGMGGMGGMGGFPRSFKSRVGGGHGCREKKKDPPVIHELKVSLEEVYSGCTKKMKISRKRLNTDGCSMRNEDKILTVDIKRGWKEGTKITFPREGDETPTNIPADIVFVVKDKSHPVFRRDGSDIIYTARISLRDALCGCTINAPTLDGRSITVTSRDVIKPGMKKRIVGEGLPLSKCPDKRGDMVLEFLVKFPEKLT 332          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005773.1 (pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 gene:ENSPMAG00000005230.1 transcript:ENSPMAT00000005773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 5.898e-53
Identity = 92/264 (34.85%), Postives = 141/264 (53.41%), Query Frame = 3
Query:  306 NGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF-----------------------DHIDGDLHMSFGGLYGRGV-------------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP-RYLTAEQKIL 986
             G++T  Y++HG+P  TF  F+   +PF  +F                       + ++ D    F      G              +T+D  +   L ++LE+++ GC K+M+I+RR LN D R+T   +KILT+ +KKGW EGTKI FP EGD+G  N+PAD++FV+KD+ HP F R+  +++Y   + L +AL GC V +  LD R L + +T +V P  T  V GEG+P       +GDL++ F + FP R   A + +L
Sbjct:    8 GGSFT--YSFHGDPHATFRAFFGGADPFEMFFGSGRGGGGPGGLGGLGMNGGGGGEAMEIDSDDPFAAFGLGGGGGGGGGGPSHHRRRTQDPPVVHELQVSLEDIYRGCTKRMRISRRRLNPDGRSTRTEEKILTLEIKKGWKEGTKITFPREGDEGGRNIPADVVFVVKDKAHPLFRRDGSDIVYTASVSLREALCGCSVKVPTLDGRKLSLSMTEVVRPGLTRRVAGEGLPFPRAPSRRGDLVVDFSVRFPDRIPPASRDVL 269          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 123.25 bits (308), Expect = 4.217e-32
Identity = 100/329 (30.40%), Postives = 153/329 (46.50%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRS--------DTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGR--GVKTKDDSIER-------NLMITLEEVFHGCVKKMKIT--------------RRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTN--IVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
            YY+ L +  +AT  E+ KAYRKL +KYHP KNP      ++F  +S+AY+VL D +KR +YD  GE  LK G   S        D F+  +  G   H    +     +  +    E ++     L +    L  +  G   +  ++ER        + + ++++  G V++++                 R    + R      KIL V + KG  +G KI F  EGDQ P+  P  II VL  + HP F+R + +L+ K +I+L +AL G    I  LD+R + I      ++       +  EGMPL     EKG LII+F + FP
Sbjct:    7 YYDTLGVNPNATHEELKKAYRKLALKYHPDKNPNEG---EKFKQISQAYEVLLDPKKRELYDMGGEQALKGGSSNSGNGFSSPMDIFDLFFNGGTRMH-RERRGKNAVHQLSVGLEEMYNGSTRKLALQKNVLCAKCEGRGGRKGAVERCVPCRGTGMYLQIQQIGLGMVQQIQSVCPECHGHGERINPRHRCRYCNGRKIVREKKILEVHISKGMKDGQKITFYGEGDQDPDLEPGHIIIVLDQKEHPVFHRREDDLVMKMEIELVEALCGFQRSIKTLDNRTILITSHQGEVIKEGDVKCILNEGMPLYRDPFEKGRLIIQFSVKFP 331          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 78.9518 bits (193), Expect = 1.031e-17
Identity = 47/115 (40.87%), Postives = 66/115 (57.39%), Query Frame = 3
Query:  618 GWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPV--TNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
            G  +G KI F  EGDQ P   P D+I VL+ + HP F+R+  +LI + +I+L +AL G    I  LDDRV+ I      ++       +  EGMP+     EKG LII+F++VFP
Sbjct:    1 GMKDGQKIQFGGEGDQEPGLEPGDVIIVLEQKEHPVFHRQGQDLIREMEIELVEALCGFQRPISTLDDRVIVITSHPGEVIKHGEVKCILNEGMPILRNPFEKGRLIIQFKVVFP 115          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: dnaja3b (DnaJ heat shock protein family (Hsp40) member A3b [Source:ZFIN;Acc:ZDB-GENE-040115-3])

HSP 1 Score: 72.0182 bits (175), Expect = 2.692e-14
Identity = 96/345 (27.83%), Postives = 151/345 (43.77%), Query Frame = 3
Query:   63 KDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGA--WTEGYTYHGNPE----KTFFEFYSSN-NPFREYFDH-IDGDLHMSFGGLYGRGVKTK-----DDSIER-----NLMITLEEVFHGC----VKKMKITRRVLNADIRTTSVHDKILT--VFVKKGWLEGTK---IVFP-----EEGDQGPNNVPADIIFV-LKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGM-PLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            KDYY+IL + +     +I K+Y +L  KYHP  N +   + ++F  ++EAY+VLSDD KR  YD +G  G   G        G   W  G T   +PE    K F EF  SN   F   FD   +  + ++F     +GV  +     +D+ +R     N   T  +  H C    ++ +     V+ +  R  S    I+T    +  G  E  +   +V P     E+G      V    IF+  + +    F RE  ++     I +A+ALLG    +  L D    I + + V P + + + G+G+  +   G   GD  I  +I  P+ L+  QK L+ E
Sbjct:   12 KDYYQILGVAKDVAQKDIKKSYYQLAKKYHPDTNKDDPKAKEKFAELAEAYEVLSDDAKRKQYDTYGSAGFDAGFGSGAGTGGQQYWRAGSTV--DPEELFRKIFGEFSRSNFGDFSSMFDQPQEFFMELTFTQA-AKGVNKEIALFLNDTCQRCEGRGNEPGTKLQRCHYCNGTGMETINTGPFVMRSTCRRCSGKGTIMTNPCTLCHGSGETKQKKTVVVPVPAGVEDGQTVRMPVGKKEIFITFRVQKSATFRREGADVHSDLHISVAQALLGGTARVQGLYDS-FTITIPSGVQPDHRIRMAGKGINRVNSYG--YGDHYIHVKIRIPKRLSERQKALLLE 350          
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 71.633 bits (174), Expect = 3.370e-14
Identity = 46/163 (28.22%), Postives = 81/163 (49.69%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVL 557
            YY++L +  ++T  E+ KAYRKL +KYHP KNP      ++F  +S+AY+VLSD +KR +YD+ GE  +K                       E         ++P   +        +M FGG      +TK  ++   + ++LE++++G  +K+ + + V+
Sbjct:    7 YYDLLGVKPNSTADELKKAYRKLALKYHPDKNPNEG---EKFKQISQAYEVLSDAKKRELYDRGGEQAIK-----------------------EGGAGGSGGFSSPMDIF--------NMFFGGGGSMQRETKGKNVVHQISVSLEDLYNGATRKLSMQKNVI 135          

HSP 2 Score: 63.5438 bits (153), Expect = 1.452e-11
Identity = 45/131 (34.35%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  576 TSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPV--TNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRY 962
             SV   +L +   KG  +  KI F  EGDQ P   P D+I VL  + H  F R+  +L+ + +I L +AL G    I  LD+R + I      ++       V  EGMP      EKG LII F++   R+
Sbjct:  208 ASVKIYLLAINSAKGMTDNQKISFYGEGDQEPGLDPGDVIIVLDQKEHDVFRRKGQDLLMEMEISLTEALCGFRRPIKTLDNRTIVITSHPGEVIKYDAIKCVLNEGMPFHRNPFEKGRLIIHFKVRARRH 338          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 135.576 bits (340), Expect = 9.822e-37
Identity = 105/349 (30.09%), Postives = 162/349 (46.42%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEV-----FHGCVKKMK---------ITRR--------------------VLNADIRTTSVHDK-------ILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVT--NIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPR-YLTAEQKI 983
            +Y+IL +P  AT +EI KAYRK  +KYHP KNP S+ + ++F   S AY++LSD  KR IYDQFGE GL           GA        G  +  F +F+ +    R        D+            K +   +  N  I  +E        G VKK           +TR+                    +++   R  S + K       IL V V+ G  +G +IVF  E DQ P+ +P D++F++ +RPH  F R+  +L+Y+ +IDL  A+ G    +  +    L + +    ++ P     ++G+GMP+ + G   G+LIIKF I FP  + T+E+ +
Sbjct:    7 FYDILGVPVTATDVEIKKAYRKCALKYHPDKNP-SEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGL-------SGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFPENHFTSEENL 346          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 102.449 bits (254), Expect = 4.708e-25
Identity = 56/180 (31.11%), Postives = 97/180 (53.89%), Query Frame = 3
Query:  465 KDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADII-FVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            ++++++ NL ++LE++F G  K  KI R+  +     T +      + +K GW  GTKI +  +GD  P       + FV++++ HP F R+  +LIY   +   ++LLG    I  +D R L +     V P+ T T  G+GMP  +   ++G+LI+K+++ +P  L   QK  I+E F
Sbjct:  178 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQID-----IQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 352          

HSP 2 Score: 55.4546 bits (132), Expect = 3.889e-9
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 3
Query:   72 YEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFG 263
            Y++L +   A   E+ K YRK  +KYHP K P  D   ++F  +SEA+++L+D +KR IYDQ+G
Sbjct:    8 YDLLGVSPSANEQELKKGYRKAALKYHPDK-PTGDT--EKFKEISEAFEILNDPQKREIYDQYG 68          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 77.7962 bits (190), Expect = 1.881e-16
Identity = 39/74 (52.70%), Postives = 50/74 (67.57%), Query Frame = 3
Query:   60 SKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKH 281
            ++DYY IL I + AT  EI  AYR+L  KYHP KN  S+ ++ +F  V EAYDVLSD  K+ IYDQFG   +K+
Sbjct:   21 AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKN 94          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: DJP1 (Cytosolic J-domain-containing protein; required for peroxisomal protein import and involved in peroxisome assembly; facilitates import of Mim1p and Mim2p into the mitochondrial outer membrane; homologous to E. coli DnaJ [Source:SGD;Acc:S000001443])

HSP 1 Score: 70.0922 bits (170), Expect = 8.949e-14
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 3
Query:   66 DYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPR 293
            +YY++L +   A+ IEI KAYRK  ++ HP KNP    + ++F  +SEAY VL DD  R  YD+   YG K  +P+
Sbjct:    6 EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYDK---YGRKEAIPQ 78          
BLAST of J domain-containing protein vs. Ensembl Yeast
Match: JJJ1 (Co-chaperone that stimulates the ATPase activity of Ssa1p; required for a late step of ribosome biogenesis; associated with the cytosolic large ribosomal subunit; contains a J-domain; mutation causes defects in fluid-phase endocytosis [Source:SGD;Acc:S000005171])

HSP 1 Score: 67.0106 bits (162), Expect = 1.109e-12
Identity = 33/84 (39.29%), Postives = 52/84 (61.90%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPES-DCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTF 305
            M   YYE+L +  HA+ +E+ KAYRK  ++YHP KNP++ + +  +F ++  AY+VLSD ++R  YD   E  L    P +D +
Sbjct:    1 MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWYDSHKEQILNDTPPSTDDY 84          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO38685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC61])

HSP 1 Score: 356.681 bits (914), Expect = 5.003e-123
Identity = 174/315 (55.24%), Postives = 223/315 (70.79%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M  DYY+IL + R AT  +I K YRKL +KYHP KN E      +F   +EAYDVLSD +KR IY+QFGE GLK GVP  D    AWT+GYT+HG+  + F EF+  NNPF E FD  D D+   FGG++GRG + +D  IER L +TLEEVF GCVKKMKI+RRV+N D  T+++ DKILT+ VK+GW   TKI FP+EGDQGPNN+PADI+F++KD+PHP F R+  NLIY   + L KAL GC+VD+  LD R++ IPV +IV P Y   V  EGMP+++  D++GDLII+F I FP +L+ EQK L++E  
Sbjct:    1 MGLDYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEV-KFRQAAEAYDVLSDPKKRAIYNQFGEEGLKSGVPEKD----AWTQGYTFHGDANRVFREFFGGNNPFSELFDSYDPDI--GFGGIHGRGRRKQDPPIERELYLTLEEVFKGCVKKMKISRRVMNEDGHTSNIRDKILTINVKRGWRASTKITFPKEGDQGPNNIPADIVFIVKDKPHPIFKRDNDNLIYIATVPLGKALTGCVVDVPTLDGRLISIPVNDIVKPEYQKVVPEEGMPISKNPDKRGDLIIQFNIEFPNHLSPEQKRLLKEAL 308          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO49360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG53])

HSP 1 Score: 234.187 bits (596), Expect = 8.012e-75
Identity = 129/324 (39.81%), Postives = 198/324 (61.11%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDT----FNGA-WTEGYTY----HGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLY---GRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYRE-KFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILI 989
            M KDYY +LN+ + A+  +I KAYRK  +KYHP KN +S  + ++F  +SEAY+VLSD +K+ IYDQ+GE GLK   P  +     F+GA +  G+T      G+  +TF   +   +PF +    + G    +  G +   GR  K +D  +ER+L+++LEE++ G  KKMKI+R+V + +  +  + +KILTV VK GW EGTKI FP+EGD+ P  +PAD++F +KD+PH  F R+   NL+YK KI L  AL G  + +  L  R + +   +++ P  +  + GEG+P+ +    KGDLIIK+++  P  +T  QK ++
Sbjct:    1 MGKDYYAVLNVDKAASADDIKKAYRKQALKYHPDKN-KSPGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGLKGTPPPQNGGGHGFSGANFGPGFTTFTYTSGDARETFSRVFGDEDPFADLIGGLGGFSFFNGMGSHQRKGRKQKVQDPPLERDLLVSLEELYKGTTKKMKISRKVPDPN-GSQRLEEKILTVNVKPGWKEGTKITFPKEGDRKPGVIPADVVFKIKDKPHKHFTRDGDNNLVYKAKISLRDALGGTTISVPTLSGRTVQVHNADVIQPGSSKRIVGEGLPMPKDNSRKGDLIIKYDVYLPNNITPAQKQVL 322          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO46721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPE1])

HSP 1 Score: 234.572 bits (597), Expect = 1.149e-74
Identity = 130/338 (38.46%), Postives = 194/338 (57.40%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVP---RSDTFNGAWTEGYTY---HGNPEKTFFEFYSSNNPFREYFD-HIDGDLHMSFG----------------------GLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREK-FNLIYKTKIDLAKALLG----CIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLT 968
            M K+YY+IL + + A+  E+ KAY+K   KYHP KN +     ++F  ++EAY+VLSD +KR I+DQ+GE GLK GVP     D       EG+TY   HG+P  TF   +   +PF+++ D    G++   F                       G + +  + +D  +E+ L ++LE++  G  KK+KI +RVLN+    T   +KILTV VKKGW  GT+I FP+EGDQ P  +PADI+F +KD+ H  F R+   N++Y  KI L  AL G      V +  LD RV+++P+ +IV P     +KGEG+PL ++  ++ D+++ FE+VFP  L 
Sbjct:    1 MGKNYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAE-EKFKEIAEAYEVLSDPQKREIFDQYGEEGLKGGVPPPGAGDADGFQMPEGFTYFQFHGDPRATFSRVFGDEDPFKDFMDTAFRGNMPFGFSQSNVTSGPSYSRQRSSSYEDIPGFFSQCQRMQDPPVEKELFVSLEKLLTGTTKKLKIIKRVLNSIGHGTRSEEKILTVNVKKGWKAGTRITFPKEGDQKPGRIPADIVFTIKDKKHEHFTRDNDNNILYTVKISLRDALTGYSSNITVPVPTLDHRVVNVPLNDIVKPGSKKRIKGEGLPLPKIPGQRMDMLVTFEVVFPSRLA 337          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO38741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC40])

HSP 1 Score: 198.364 bits (503), Expect = 6.535e-61
Identity = 122/320 (38.12%), Postives = 189/320 (59.06%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFRE---YFDHIDGDLHMSFGGL-YGRGV-------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYRE-KFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQK 980
            M ++YY IL +PR+A+  +I KAYR+  + +HP KN  S    ++F  +SEAY VL+D R+R I+D +GE GLK G   S         G+++  +P K F E +    PF+E   +  +  G     F G+ +G G          ++ ++E+ L ++LEE++ G V+K++I  +VL+ +       DKIL + VK GW  GTKI FP EGD  P  + +DIIF++ D+PH  F R+ + NLIY +K+ L  AL+GC++ +  +D RVL I V  ++ P     ++GEG+PL++   E+ DLI+ FE+ FP  LT EQ+
Sbjct:    1 MGRNYYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAE-EKFKEISEAYKVLTDPRQRDIFDMYGEEGLK-GTSDSPFGGPCGGFGFSFSEDPMKIFAEVFRDEEPFKETGNFSSYSTGQKGFGFEGMDFGPGPDPFKKEGPIQEPAVEKILPVSLEELYIGSVRKLRINHQVLSMNNEYIR-EDKILQIEVKPGWKAGTKITFPREGDMKPGIIASDIIFIIADKPHQFFKRDSENNLIYVSKLTLKDALVGCVIQVPTIDGRVLSIQVNEVIRPGMQKRIQGEGLPLSKNPIERADLIVTFEVEFPTNLTGEQR 317          
BLAST of J domain-containing protein vs. Ensembl Nematostella
Match: EDO31903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL1])

HSP 1 Score: 179.104 bits (453), Expect = 2.782e-53
Identity = 114/346 (32.95%), Postives = 180/346 (52.02%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQ-FGEYGLKHGVP-RSDTFN------GAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFG--GLYGR---------------------------GVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREK-FNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQK 980
            M  +YYE+L + R+AT  +I +AYR+L +KYHP KN  ++ ++ +   VSEAY+VL D ++R  +D+ F     ++    R+ +F+      G     ++      K  F         R + D    DL   FG  GL+ R                             K +D  IER+L+I LEE+  G  K+MK++R++   D  ++   +K L V +K GW +GT+IVFP EGD+ P   P+DI+F +KD+PH  F R+K  NLIYK  + L  AL G  + +  L   V+ +    I+ P    T+KGEG+P+      + D+I++F++ FP +L+ EQ+
Sbjct:    1 MESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEENFKE---VSEAYEVLCDPQQRERFDKKFAPDTFRYSYSKRATSFDYEVNCGGFRNSHFSCTTEEAKRMFS--------RSFCDEDFSDLIGGFGDFGLFSREKSRKSSRYDDFFNEFKDEMDFETPFKKFKVQDPPIERDLLIGLEELLRGSTKRMKLSRKIFQ-DGLSSKTEEKTLIVNIKPGWKQGTRIVFPREGDRRPGKDPSDIVFKIKDKPHRHFTRDKDNNLIYKATVSLRTALGGMNIHVPSLCGEVIDLENKGIIQPGMVRTIKGEGLPIPGNPSVRADMIVEFDVHFPNFLSREQR 334          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:101160432])

HSP 1 Score: 325.479 bits (833), Expect = 2.660e-110
Identity = 161/319 (50.47%), Postives = 219/319 (68.65%), Query Frame = 3
Query:   51 IPMSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQ 1007
            + ++  YYE L I R A+  EI KAYR+L VK+HPK+N E+  S +++ L+ EAYDVLSD RK+ IYD+FGE GLK G+P     +GAW+  YTYHGNP+KTF +F+  +NPF ++F     D  + FG    +  KT+D  IER L +TLE++F GC KK+KI+RRVLN D  T+ + DKILTV VK GW EGT++VFP+EGDQGP+  PAD++ +++ + HP F R+  +LIYK KI L  AL    VDI  LD R+L IP+ +IV P Y   V GEGMPL++   ++GDLII FEI FP  L+++ K LI++  + 
Sbjct:    1 MSLNNAYYEALEINRTASDAEIKKAYRRLAVKFHPKRNAEA-GSAEKYSLLGEAYDVLSDPRKKAIYDKFGEEGLKAGIPPEFGSDGAWSSKYTYHGNPDKTFRQFFGGDNPFADFFTK---DAPLQFGVPQTKLEKTQDPPIERELYLTLEDLFLGCTKKIKISRRVLNDDGHTSCIKDKILTVDVKPGWREGTRVVFPKEGDQGPDRTPADVVLIVRHKSHPLFIRQHNDLIYKLKISLMNALTDFSVDIPTLDGRLLSIPINDIVHPAYNKVVTGEGMPLSQDSSQRGDLIITFEIQFPEKLSSDSKGLIKQALSS 315          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:101160432])

HSP 1 Score: 305.449 bits (781), Expect = 1.065e-102
Identity = 150/296 (50.68%), Postives = 205/296 (69.26%), Query Frame = 3
Query:  120 KAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQ 1007
            + YR+L VK+HPK+N E+  S +++ L+ EAYDVLSD RK+ IYD+FGE GLK G+P     +GAW+  YTYHGNP+KTF +F+  +NPF ++F     D  + FG    +  KT+D  IER L +TLE++F GC KK+KI+RRVLN D  T+ + DKILTV VK GW EGT++VFP+EGDQGP+  PAD++ +++ + HP F R+  +LIYK KI L  AL    VDI  LD R+L IP+ +IV P Y   V GEGMPL++   ++GDLII FEI FP  L+++ K LI++  + 
Sbjct:    5 RRYRRLAVKFHPKRNAEA-GSAEKYSLLGEAYDVLSDPRKKAIYDKFGEEGLKAGIPPEFGSDGAWSSKYTYHGNPDKTFRQFFGGDNPFADFFTK---DAPLQFGVPQTKLEKTQDPPIERELYLTLEDLFLGCTKKIKISRRVLNDDGHTSCIKDKILTVDVKPGWREGTRVVFPKEGDQGPDRTPADVVLIVRHKSHPLFIRQHNDLIYKLKISLMNALTDFSVDIPTLDGRLLSIPINDIVHPAYNKVVTGEGMPLSQDSSQRGDLIITFEIQFPEKLSSDSKGLIKQALSS 296          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:101170125])

HSP 1 Score: 280.026 bits (715), Expect = 4.734e-92
Identity = 143/338 (42.31%), Postives = 209/338 (61.83%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHG-VPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF---------DHIDGDLHMSFG----------------GLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIE 992
            M KDYY+ L I + AT  +I KAYRK  +K+HP KN  ++   ++F  V+EAY+VLSD +KR IYDQ+GE GLK G  P  D     +T  YT+HG+P  TF  F+  +NPF  +F         + +D D +  FG                GL G+  + +D  I   L +TLEEVFHGC K+MKI+R+ LN D RT    DKILT+ +K+GW EGTKI FP EGD+ PN +PADI+FV+KD+PHP F RE  N++Y  ++ L ++L GC V +  +D +  ++ +T+++ P    TV G+G+PL +  +++GDL+++F++ FP  L    K +++
Sbjct:    2 MGKDYYKTLGISKGATDEDIKKAYRKQALKWHPDKNKSANAD-EKFKEVAEAYEVLSDPKKRDIYDQYGEEGLKGGSAPAGDGQGTNFT--YTFHGDPHATFATFFGGSNPFEMFFGRKANGRDDEDMDVDGNDPFGSFTSFNMNGFPRDGHVGLGGQQRRKQDPPIVHELRVTLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDESPNTIPADIVFVIKDKPHPHFRREGSNIVYPVRVSLRQSLCGCSVTVSTIDGKTCNMKITDVIKPGLRKTVTGQGLPLPKNPEQRGDLVVEFDVNFPDALPGNAKDVLK 336          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 266.544 bits (680), Expect = 1.052e-86
Identity = 143/344 (41.57%), Postives = 206/344 (59.88%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFD-----HIDGDLHMS-FGGLYG----------------RGV---------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP+ +   EI KAYR++ +++HP KN +++   ++F  ++EAY+VLSD +KR +YDQ GE GLK G   S    G+ T  YT+HG+P  TF  F+  +NPF  +F       +D D   + FG  +G                RG          K +D  +   L ++LEE+FHGC K+MKITRR LN D R+    DKIL + +KKGW EGTKI FP+EGD+ P N+PADI FVLKD+ H  F R+  N+IY  KI L +AL GC V I  L++RV+ +P  +I+ P     ++GEG+P  +   ++GDLI++F + FP  +  + + +I +
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKNTDANAE-EKFKEIAEAYEVLSDPKKRVVYDQLGEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNRNTEMDEDEPFTHFGRQFGFPGGMNNGFPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGCTVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQ 343          
BLAST of J domain-containing protein vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 261.922 bits (668), Expect = 1.274e-84
Identity = 146/364 (40.11%), Postives = 207/364 (56.87%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYF----------------DHI---DGDLHMS-------FGGLYG----------------RGV---------KTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEE 995
            M KDYY+IL IP+ +   EI KAYR++ +++HP KN +++   ++F  ++EAY+VLSD +KR +YDQ GE GLK G   S    G+ T  YT+HG+P  TF  F+  +NPF  +F                DH    D D  M        FG  +G                RG          K +D  +   L ++LEE+FHGC K+MKITRR LN D R+    DKIL + +KKGW EGTKI FP+EGD+ P N+PADI FVLKD+ H  F R+  N+IY  KI L +AL GC V I  L++RV+ +P  +I+ P     ++GEG+P  +   ++GDLI++F + FP  +  + + +I +
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKNTDANAE-EKFKEIAEAYEVLSDPKKRVVYDQLGEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNRSHSRSNGFPFHGDHSNDPDQDTEMDEDEPFTHFGRQFGFPGGMNNGFPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGCTVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQ 363          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000005055.1 (SMESG000005055.1)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 318/318 (100.00%), Postives = 318/318 (100.00%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQK 1010
            MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQK
Sbjct:    1 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGFNQK 318          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000076708.1 (SMESG000076708.1)

HSP 1 Score: 388.267 bits (996), Expect = 4.168e-135
Identity = 180/308 (58.44%), Postives = 234/308 (75.97%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQK 980
            M +DYY IL I R+A   +I KAYR   +K HP KN     ++++F L+SEAY+VLSD  KR +YDQFGE GLK+G+P      GAWT+GYTYHGNP+KTF  F+ ++NPF+E++D +DGD+H+SFGGLYGR    +D SIER+L +TLEE++HGC+KK+KI+RRV+N D  T+S+ DKIL+V V+ GW EGTKI FP+EGDQGPN +PAD++F+LKDR H RF R++ NLIY + I LA AL+GC +DIV LDDR+LHIP+T+I+ P Y   V GEGMP     D KGDL I+F+I FP+ LT EQK
Sbjct:    1 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQK 308          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000073794.1 (SMESG000073794.1)

HSP 1 Score: 196.052 bits (497), Expect = 1.595e-59
Identity = 124/339 (36.58%), Postives = 193/339 (56.93%), Query Frame = 3
Query:   57 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTE-GYTYHGNPEKTFFEFYSSNNPFREYFDH------------IDGDLHMSF---------GGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQG-PNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCI-VDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 1001
            M KDYY IL   + A+  EI KAYRK+ +KYHP KN +S  +  +F  ++EAY+VLSD +K+ IYD++GE GLK G+      +G      YT+HG+P + F  F+ +++PF   F +            +D D H            GG +      +D  I  +L ++LE+V  G +KK+KITR+  +    +    +KIL + VKKGW  GTKI FP EGD+   +N+PADI+FV+KDR H  F R+  ++  K KI L  AL G   + I  L+++++++P+  ++ P     + G G+P  +    +GD++++FEI+FP  LT   K +I++  
Sbjct:    1 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKN-KSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYGEEGLKGGMGGGSDGSGGPGGFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHAQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISLKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 338          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000012107.1 (SMESG000012107.1)

HSP 1 Score: 138.658 bits (348), Expect = 4.881e-37
Identity = 106/329 (32.22%), Postives = 155/329 (47.11%), Query Frame = 3
Query:   69 YYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRS---------DTFNGAWTEGYTYHGNPEK--------TFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHD--------------KILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVT--NIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP 956
            YY+IL +  + +  E+ KAYRKL +KYHP KNP++    D+F  +S+A++VL+D +KR IYD+ GE  LK G   S         D F G    G +      K        T  E Y  N        ++  D     GG  G  V+         + + + ++  G V++M+ T R    +    +  D              K+L V + KG  +G +I F  EGDQ P   P DI  VL+++PH  F R+K +LIY  K+DL  +L G    I  LD R L +      ++       ++ EGMP  +   E G LII+FE+VFP
Sbjct:    7 YYDILGVHPNVSEQELKKAYRKLALKYHPDKNPDAG---DKFKEISQAFEVLADAKKRQIYDEGGEQALKEGGGDSGFHNPMDIFDMFFGGMGGGRSRGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEG-AVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFP 331          
BLAST of J domain-containing protein vs. Planmine SMEST
Match: SMESG000077692.1 (SMESG000077692.1)

HSP 1 Score: 120.939 bits (302), Expect = 5.851e-31
Identity = 102/365 (27.95%), Postives = 154/365 (42.19%), Query Frame = 3
Query:    3 FTMLLLYKIILCP*T*IPMSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHG---------CVKKMKITRRVLNADIRTTSVH-------------------------DKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPR---YLTAEQKIL 986
            F ++LL    + P   I   +D+Y+ILN+PR A   +I KAYR L  + HP KN +   +  QF  ++ AY+ LSD  KR I+D  GE GLK      D+  G                    SS +PF  +F    GD+    GG   +    +   +  +L ++LEE+++G          VKK     R  N      ++                          +K+L V ++ G  +G    F  EG+   +  P D+ F ++   HPRF R   +L     I L  AL G  ++I  LD   + +    +  P  T+    EGMP  E    KG L I  ++ FP+   Y   E++IL
Sbjct:    3 FLIILLLSFAVYP---IYCGRDFYKILNVPRSANSNQIKKAYRNLAKQLHPDKNKDDPNAESQFQDLNAAYEALSDPEKRKIFDARGEEGLK------DSHGGG-------------------SSMDPFSSFF----GDVFFDMGGSRRQKDIPRGGDVVMDLFVSLEELYNGNFVEVVRYKSVKKSAHGTRRCNCRHEMKTIQTGPGRFTMTQEQVCDECPNVRFVPEEKLLEVEIEPGMRDGQLYPFVAEGEPHIDGEPGDLKFRIRQSSHPRFERRGDDLYTNVTISLLDALQGFSMEIKHLDGHKVKVIREKVTWPGATIKKSMEGMPNYENNHVKGSLYITIDVAFPKDKVYSEEEKEIL 335          
The following BLAST results are available for this feature:
BLAST of J domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJB132.684e-11250.79DnaJ heat shock protein family (Hsp40) member B13 ... [more]
DNAJB52.204e-8742.49DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB52.204e-8742.49DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB51.850e-8642.49DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB53.230e-8642.49DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-136.055e-7239.41DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-136.055e-7239.41DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-278.407e-1439.78DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-121.765e-1333.07DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-121.765e-1333.07DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG50011.943e-8038.92gene:FBgn0031322 transcript:FBtr0307057[more]
CG50011.782e-7938.48gene:FBgn0031322 transcript:FBtr0335379[more]
CG50011.782e-7938.48gene:FBgn0031322 transcript:FBtr0307056[more]
CG50011.782e-7938.48gene:FBgn0031322 transcript:FBtr0077972[more]
DnaJ-11.573e-7338.74gene:FBgn0263106 transcript:FBtr0077123[more]
back to top
BLAST of J domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb131.405e-11149.06DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb131.405e-11149.06DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb1b2.360e-8744.78DnaJ heat shock protein family (Hsp40) member B1b ... [more]
dnajb51.007e-8640.72DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb51.007e-8640.72DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb131.331e-11351.43DnaJ heat shock protein family (Hsp40) member B13 ... [more]
chd91.172e-8641.04chromodomain helicase DNA binding protein 9 [Sourc... [more]
dnajb13.810e-8241.91DnaJ heat shock protein family (Hsp40) member B1 [... [more]
dnajb41.828e-8138.81DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnaja4.11.295e-3831.19DnaJ heat shock protein family (Hsp40) member A4 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajb134.388e-11150.79DnaJ heat shock protein family (Hsp40) member B13 ... [more]
Dnajb138.097e-8749.06DnaJ heat shock protein family (Hsp40) member B13 ... [more]
Dnajb51.334e-8642.20DnaJ heat shock protein family (Hsp40) member B5 [... [more]
Dnajb51.334e-8642.20DnaJ heat shock protein family (Hsp40) member B5 [... [more]
Dnajb51.334e-8642.20DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of J domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P59910|DJB13_HUMAN1.289e-11150.79DnaJ homolog subfamily B member 13 OS=Homo sapiens... [more]
sp|Q80Y75|DJB13_MOUSE3.069e-11050.79DnaJ homolog subfamily B member 13 OS=Mus musculus... [more]
sp|O75953|DNJB5_HUMAN1.058e-8642.49DnaJ homolog subfamily B member 5 OS=Homo sapiens ... [more]
sp|Q5BIP8|DNJB5_BOVIN1.259e-8642.49DnaJ homolog subfamily B member 5 OS=Bos taurus OX... [more]
sp|O89114|DNJB5_MOUSE9.330e-8642.20DnaJ homolog subfamily B member 5 OS=Mus musculus ... [more]
back to top
BLAST of J domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8ISK71.768e-13860.06J domain-containing protein OS=Macrostomum lignano... [more]
K1QF033.376e-13558.73DnaJ-like protein subfamily B member 13 OS=Crassos... [more]
A0A210Q9X25.830e-13557.73DnaJ-like subfamily B member 13 OS=Mizuhopecten ye... [more]
A0A1S3K3301.701e-13457.78dnaJ homolog subfamily B member 13 OS=Lingula ungu... [more]
A0A2C9JC896.173e-13460.06J domain-containing protein OS=Biomphalaria glabra... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb1b4.455e-8543.66dnaJ homolog subfamily B member 1 [Source:NCBI gen... [more]
dnajb131.434e-8342.22DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb41.285e-8141.59DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb48.155e-8142.31DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb1a1.102e-7740.18dnaJ homolog subfamily B member 1-like [Source:NCB... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005773.15.898e-5334.85pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 g... [more]
DNAJA44.217e-3230.40DnaJ heat shock protein family (Hsp40) member A4 [... [more]
DNAJA41.031e-1740.87DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja3b2.692e-1427.83DnaJ heat shock protein family (Hsp40) member A3b ... [more]
dnaja13.370e-1428.22DnaJ heat shock protein family (Hsp40) member A1 [... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YDJ19.822e-3730.09Type I HSP40 co-chaperone; involved in regulation ... [more]
SIS14.708e-2531.11Type II HSP40 co-chaperone that interacts with the... [more]
SCJ11.881e-1652.70One of several homologs of bacterial chaperone Dna... [more]
DJP18.949e-1443.42Cytosolic J-domain-containing protein; required fo... [more]
JJJ11.109e-1239.29Co-chaperone that stimulates the ATPase activity o... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386855.003e-12355.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493608.012e-7539.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467211.149e-7438.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387416.535e-6138.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319032.782e-5332.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of J domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb132.660e-11050.47DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb131.065e-10250.68DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb44.734e-9242.31DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb51.052e-8641.57DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb51.274e-8440.11DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of J domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005055.10.000e+0100.00SMESG000005055.1[more]
SMESG000076708.14.168e-13558.44SMESG000076708.1[more]
SMESG000073794.11.595e-5936.58SMESG000073794.1[more]
SMESG000012107.14.881e-3732.22SMESG000012107.1[more]
SMESG000077692.15.851e-3127.95SMESG000077692.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032781 ID=SMED30032781|Name=J domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1095bp
GTTTTACTATGTTACTATTGTATAAAATAATTTTGTGTCCTTAAACGTAA
ATTCCGATGAGCAAAGATTACTATGAAATCCTGAATATTCCGAGACATGC
TACAATTATTGAAATAAATAAAGCATACCGAAAATTGGGAGTCAAATATC
ACCCGAAAAAGAATCCAGAATCTGATTGTTCCTACGATCAGTTTTTCTTG
GTTAGCGAGGCTTACGATGTATTATCCGATGATAGGAAAAGAGGCATTTA
TGATCAATTTGGAGAATATGGCCTGAAACATGGAGTTCCAAGATCTGATA
CCTTCAACGGAGCATGGACTGAAGGTTATACATATCATGGAAATCCAGAA
AAAACTTTTTTTGAATTCTACAGCTCGAATAATCCGTTTCGGGAATATTT
TGATCACATTGATGGAGATTTACATATGAGCTTCGGAGGACTCTATGGGC
GTGGAGTTAAAACAAAAGACGATTCCATCGAAAGGAATTTAATGATAACA
TTGGAAGAGGTTTTTCATGGATGTGTGAAAAAAATGAAAATTACTAGAAG
GGTTTTAAATGCCGACATTCGCACTACTAGTGTTCACGATAAAATTCTCA
CAGTCTTCGTCAAGAAAGGTTGGCTAGAGGGCACAAAAATAGTTTTTCCC
GAAGAAGGTGATCAAGGTCCAAATAATGTTCCGGCTGACATTATATTTGT
CCTCAAAGATAGACCTCACCCTCGATTCTATAGGGAAAAATTTAATCTTA
TTTATAAAACGAAAATCGACTTGGCAAAGGCTCTTCTTGGTTGCATAGTC
GACATCGTAATGTTGGACGATCGAGTCTTGCACATTCCAGTCACCAATAT
CGTCGATCCTACTTATACAATGACAGTGAAAGGAGAAGGAATGCCTCTTA
CCGAAGTAGGAGACGAGAAAGGAGACTTGATTATAAAATTTGAAATTGTT
TTTCCACGATATTTAACAGCAGAACAAAAAATATTAATTGAAGAAGGATT
TAATCAAAAATAAAAATAAATTTTGAACATTCCTCATAATTAAAATATTT
CATTGAAGATTAAAATAATCAATATCATTAAAGATGCAAAAAGTT
back to top

protein sequence of SMED30032781-orf-1

>SMED30032781-orf-1 ID=SMED30032781-orf-1|Name=SMED30032781-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVS
EAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKT
FFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLE
EVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEE
GDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDI
VMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFP
RYLTAEQKILIEEGFNQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR002939DnaJ_C
IPR018253DnaJ_domain_CS
IPR008971HSP40/DnaJ_pept-bd
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 6..24
score: 44.8
coord: 41..61
score: 41.1
coord: 61..80
score: 36.07
coord: 24..39
score: 51.49
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 3..61
e-value: 2.6E-17
score: 73.5
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 4..66
e-value: 9.7E-20
score: 70.5
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 4..69
score: 20.357
IPR001623DnaJ domainCDDcd06257DnaJcoord: 4..58
e-value: 8.26891E-18
score: 74.1189
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 1..124
e-value: 1.9E-23
score: 85.0
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 3..72
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 139..219
e-value: 8.1E-28
score: 98.2
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 220..318
e-value: 4.2E-22
score: 80.1
NoneNo IPR availablePANTHERPTHR24078DNAJ HOMOLOG SUBFAMILY C MEMBERcoord: 1..313
NoneNo IPR availablePANTHERPTHR24078:SF525DNAJ HOMOLOG SUBFAMILY B MEMBER 5coord: 1..313
NoneNo IPR availableCDDcd10747DnaJ_Ccoord: 139..303
e-value: 2.53192E-43
score: 144.49
IPR002939Chaperone DnaJ, C-terminalPFAMPF01556DnaJ_Ccoord: 141..300
e-value: 6.6E-36
score: 123.6
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 46..65
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 224..310
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 140..222