Protein virilizer isoform 1

Overview
NameProtein virilizer isoform 1
Smed IDSMED30032777
Length (bp)5780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein virilizer isoform 1 (SMED30032777) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein virilizer isoform 1 (SMED30032777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein virilizer isoform 1 (SMED30032777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein virilizer isoform 1 (SMED30032777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032777SMESG000074578.1 SMESG000074577.1 SMESG000074456.1 SMESG000074445.1 SmedASXL_015752SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032777SMESG000074578.1 SMESG000074577.1 SMESG000074456.1 SMESG000074445.1 SmedASXL_015752SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30032777SMESG000074578.1 SMESG000074577.1 SMESG000074456.1 SMESG000074445.1 dd_Smed_v4_4676_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein virilizer isoform 1 vs. Ensembl Human
Match: VIRMA (vir like m6A methyltransferase associated [Source:HGNC Symbol;Acc:HGNC:24500])

HSP 1 Score: 68.5514 bits (166), Expect = 1.532e-10
Identity = 58/202 (28.71%), Postives = 104/202 (51.49%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +++ +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ AL+Q   + + R +K G  +   + SL    A  V  T   +  V   L +LL    +++ LKL   +ALD    +  G+++F+   R  +N  E++ YQ+L+  ++     + T RV  A S +L K H +E+L
Sbjct:  380 EASVKLTELLDLYRE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTKQDSLGQLVDWTMQALNLQVALRQPIALNV-RQLKAGTKL---VSSLAECGAQGV--TGLLQAGVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RGRQN--EKSGYQKLLELIL----LDQTVRVVTAGSAILQKCHFYEVL 563          

HSP 2 Score: 66.2402 bits (160), Expect = 8.388e-10
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  + +  L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          

HSP 3 Score: 65.855 bits (159), Expect = 1.018e-9
Identity = 72/270 (26.67%), Postives = 126/270 (46.67%), Query Frame = 1
Query: 4519 QEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXV----KQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELAR 5310
            +++ NSLP      +I   L     N +   + +   +R ++ LA HDYG   L   L        SL+KRV  TFS D  +   S L  +  +           DN    V+    SRT++++ + +KQ+LQ   +KE +  +   EL  L+   S+++++L  L D +  L ++L S  D +P +   +E     +  P+SL+ ++ +R  +      + +L  +   W  P +  E +   +L + DL  L+  CC+ F+LH EL R
Sbjct: 1311 EQLSNSLPNKELMTSICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASSFLEFMRQILNSDTIGCCGDDNGLMEVEGAHTSRTMSINAAELKQLLQ---SKEESPENLFLELEKLVLEHSKDDDNLDSLLDSVVGLKQMLESSGDPLPLSDQDVEPV---LSAPESLQNLFNNRTAYVLADVMDDQLKSM---WFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELER 1571          
BLAST of Protein virilizer isoform 1 vs. Ensembl Human
Match: VIRMA (vir like m6A methyltransferase associated [Source:HGNC Symbol;Acc:HGNC:24500])

HSP 1 Score: 67.781 bits (164), Expect = 2.211e-10
Identity = 58/202 (28.71%), Postives = 104/202 (51.49%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +++ +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ AL+Q   + + R +K G  +   + SL    A  V  T   +  V   L +LL    +++ LKL   +ALD    +  G+++F+   R  +N  E++ YQ+L+  ++     + T RV  A S +L K H +E+L
Sbjct:  380 EASVKLTELLDLYRE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTKQDSLGQLVDWTMQALNLQVALRQPIALNV-RQLKAGTKL---VSSLAECGAQGV--TGLLQAGVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RGRQN--EKSGYQKLLELIL----LDQTVRVVTAGSAILQKCHFYEVL 563          

HSP 2 Score: 66.2402 bits (160), Expect = 6.800e-10
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  +    L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          
BLAST of Protein virilizer isoform 1 vs. Ensembl Fly
Match: vir (gene:FBgn0003977 transcript:FBtr0072037)

HSP 1 Score: 82.0333 bits (201), Expect = 5.263e-15
Identity = 39/131 (29.77%), Postives = 76/131 (58.02%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNP 456
            L+FFDTFSH    ++ +D ++F +PV I  +RIIP G  ++++     RLG TNP  F+++FF ++     + +FE +G + +++ + ++        +   L + G Y+ +++A++GI +     PI +P
Sbjct:   10 LLFFDTFSHEEVTDINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPSKFDLEFFVNDLGMPAASAFENLGLLRYNQNDCIHLDCSQEKIVTDGLVLRGWYSTITLAIYGIFTNSVTEPIASP 140          

HSP 2 Score: 56.225 bits (134), Expect = 3.653e-7
Identity = 91/426 (21.36%), Postives = 185/426 (43.43%), Query Frame = 1
Query: 2692 DLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPG-LVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAE--------PATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKS--QIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELL-NFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETL 3933
            DL + + + ++   +++  T+   P    L Y  +++ A VR+ +   YL ++G  +  L K+      + +    +    +     +++     +   ++V    LD     PG L+  +R+L+Y  +SK                  Q   P+ +    +++++   + +  DG+ +  ++++++  + +   Q G        P L+ +          P   ++  +    I  R   +KD+T +  L   Y +         Y   TR ++  ++E  +  ++ T+L YTQ   P+E++E++  KSLWT M+RE+L N    A F     L   +  LPLP+P      L  +   ++ + R LWSAH+     ++  L+  +  +S   L  LL R+   +S L P+  L++A+   E L
Sbjct:  918 DLIKKEQRLQTQRQLSSPGTKYKSP---VLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLEAINVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISK--------------PLAGQKAPPVTEE---LKHRFVALQLYAADGVQLCIQIMERLCAYFE---QPGAH-----APALMTIQGVHCCQIMLPTLQILRELLSYAILCRDGTYKDLTAIDHLVKVYYLL--------YYFPTRCQAGPEVEQCKMEVVQTLLAYTQ---PNEQDEESLHKSLWTLMIREVLKNVDGPAHFIPGLKLLAELLPLPLPMPQPLCDQLQQQHKQRLITERKLWSAHLHPQSGQIAKLVEALAPSSFPQLSELLQRVCMQLSDLAPNMTLLIAKTITELL 1304          
BLAST of Protein virilizer isoform 1 vs. Ensembl Zebrafish
Match: virma (vir like m6A methyltransferase associated [Source:ZFIN;Acc:ZDB-GENE-100922-238])

HSP 1 Score: 82.0333 bits (201), Expect = 8.114e-15
Identity = 131/484 (27.07%), Postives = 201/484 (41.53%), Query Frame = 1
Query: 4186 LTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDN---SESEQTLGTIFFSIMSDILEASKENHTATQ--ENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRD---GMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYRE-----WLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRG-------HDAII-HTGRTS-------KKFVAPMRGRG---FGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDF 5541
            L R  A+L  L +   CK A L L+      D     + E  L  I  S+++ ++  +    +A Q  E M + LQ L D  V++             +  G  +   S   +L N     +LPT     +I   +     N     +     LR ++ L  HDYG   L   L        SLI+R   +F+ +  +   +L           ++Q  + E +   + SR+L LS S +KQ+LQW   KE +  H + EL   +  + +E+ESL+ L +   G+  +IE  S  D     T+    T  ++P P+ L+  +  R V+         LS++  E     W  P +  E E   ++ + DL  LA  CC   +L  EL R    +  +  H +  +G       H+  I  +GR+           +A  RGRG   FG  S           +D FR R  NTSRPPSMHVDDF
Sbjct: 1233 LIRVLALLDSLASQRACKVAMLALLSGSARSDTRSEGKVEDKLSDILPSLLAMLVLPADVGLSAQQNAELMASILQSLCDQDVSL-------------VVSGSGEASVSEAELLAN-----ALPTKEMMTSICEGMLDVLGNTHSSYTLQLTCLRTMMFLTEHDYGLYHLKSSLKKHTTAISSLIRREITSFNKEFAELLSALFDF--------LRQILNSEAMDEDMDSRSLALSVSDMKQLLQW---KEDSGEHLLCELEKHITKLCKEDESLEALLENVVGLRQIIE--SSGD---AQTNAEPETEPSLPAPEPLQTQFNHRTVYV--------LSDVLDEQLKALWFSPFQPDEMETEVDMVKVDLVALAQQCCTELDLKAELERSFLSEPSSPGHSKPSKGFRLGKHKHETFITSSGRSDYVEPAKRAHIMAAPRGRGRGSFGQLSRP---------HDIFRQRKQNTSRPPSMHVDDF 1665          

HSP 2 Score: 75.8702 bits (185), Expect = 5.109e-13
Identity = 56/206 (27.18%), Postives = 104/206 (50.49%), Query Frame = 1
Query: 1285 RLINLVSTYGETN---LNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLV-YFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFE 1890
            +L  L+  +GE       + WV  +EE+P  L +G+++L+  D D     ++ LV W    LS++ AL Q   +  LR +K G  +   +          +L     E  +   L+ LL  + +++ LKL ++R+LD       G+++ +   R   +++  + YQRL+  FL+D+     T RV+ A + +L+K HL+E+L + +
Sbjct:  367 KLSELLEAWGEAQGAERGAGWVTALEEVPAFLVKGMSFLSIKDPDGQSEKLKQLVDWSCEALSLDVALAQPIALN-LRQLKAGTKLVSALADCGAQAVQDLL-----EKGIVGRLLGLLFAEHVSSTLKLNVLRSLDSIISEPQGIEAML-RDRHHHDDDGTSGYQRLLDLFLLDQ-----TVRVATAGAAILHKGHLYEVLTDLQ 560          

HSP 3 Score: 69.707 bits (169), Expect = 4.281e-11
Identity = 43/126 (34.13%), Postives = 63/126 (50.00%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGIIS-PHS 435
            L+F DTF H       VD +RF   V I  +R+IP GI   S +      G T P  F +  F +N    +SP F+++G +E+DE   +  I  P+  +    L + G Y  L++AV+G    PHS
Sbjct:   10 LLFLDTFKHQNAELTNVDVVRFPYGVLITEVRVIPPGIKAHSNLPDSRAFGETAPHAFQLDLFFNNVSKPNSPVFDRLGSLEYDENKSI--IFRPNGKINTDGLVLRGWYTCLTLAVYGTAERPHS 133          
BLAST of Protein virilizer isoform 1 vs. Ensembl Zebrafish
Match: virma (vir like m6A methyltransferase associated [Source:ZFIN;Acc:ZDB-GENE-100922-238])

HSP 1 Score: 77.7962 bits (190), Expect = 1.628e-13
Identity = 132/488 (27.05%), Postives = 200/488 (40.98%), Query Frame = 1
Query: 4186 LTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDN---SESEQTLGTIFFSIMSDILEASKENHTATQ--ENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYH----LPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRD---GMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYRE-----WLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRG-------HDAII-HTGRTS-------KKFVAPMRGRG---FGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDF 5541
            L R  A+L  L +   CK A L L+      D     + E  L  I  S+++ ++  +    +A Q  E M + LQ L D  V++             +  G  +   S   +L N     +LPT     +I   +     N     +     LR ++ L  HDYG   L   L        SLI+R   +F+ +  +   +L   L  +         S     +H    + SR+L LS S +KQ+LQW   KE +  H + EL   +  + +E+ESL+ L +   G+  +IE  S  D     T+    T  ++P P+ L+  +  R V+         LS++  E     W  P +  E E   ++ + DL  LA  CC   +L  EL R    +  +  H +  +G       H+  I  +GR+           +A  RGRG   FG  S           +D FR R  NTSRPPSMHVDDF
Sbjct: 1232 LIRVLALLDSLASQRACKVAMLALLSGSARSDTRSEGKVEDKLSDILPSLLAMLVLPADVGLSAQQNAELMASILQSLCDQDVSL-------------VVSGSGEASVSEAELLAN-----ALPTKEMMTSICEGMLDVLGNTHSSYTLQLTCLRTMMFLTEHDYGLYHLKSSLKKHTTAISSLIRREITSFNKEFAELLSALFDFLRQILNSEAMFLRSAFYRHHHADEDMDSRSLALSVSDMKQLLQW---KEDSGEHLLCELEKHITKLCKEDESLEALLENVVGLRQIIE--SSGD---AQTNAEPETEPSLPAPEPLQTQFNHRTVYV--------LSDVLDEQLKALWFSPFQPDEMETEVDMVKVDLVALAQQCCTELDLKAELERSFLSEPSSPGHSKPSKGFRLGKHKHETFITSSGRSDYVEPAKRAHIMAAPRGRGRGSFGQLSRP---------HDIFRQRKQNTSRPPSMHVDDF 1676          

HSP 2 Score: 76.2554 bits (186), Expect = 4.547e-13
Identity = 56/206 (27.18%), Postives = 104/206 (50.49%), Query Frame = 1
Query: 1285 RLINLVSTYGETN---LNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLV-YFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFE 1890
            +L  L+  +GE       + WV  +EE+P  L +G+++L+  D D     ++ LV W    LS++ AL Q   +  LR +K G  +   +          +L     E  +   L+ LL  + +++ LKL ++R+LD       G+++ +   R   +++  + YQRL+  FL+D+     T RV+ A + +L+K HL+E+L + +
Sbjct:  366 KLSELLEAWGEAQGAERGAGWVTALEEVPAFLVKGMSFLSIKDPDGQSEKLKQLVDWSCEALSLDVALAQPIALN-LRQLKAGTKLVSALADCGAQAVQDLL-----EKGIVGRLLGLLFAEHVSSTLKLNVLRSLDSIISEPQGIEAML-RDRHHHDDDGTSGYQRLLDLFLLDQ-----TVRVATAGAAILHKGHLYEVLTDLQ 559          

HSP 3 Score: 69.707 bits (169), Expect = 4.432e-11
Identity = 43/126 (34.13%), Postives = 63/126 (50.00%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGIIS-PHS 435
            L+F DTF H       VD +RF   V I  +R+IP GI   S +      G T P  F +  F +N    +SP F+++G +E+DE   +  I  P+  +    L + G Y  L++AV+G    PHS
Sbjct:    9 LLFLDTFKHQNAELTNVDVVRFPYGVLITEVRVIPPGIKAHSNLPDSRAFGETAPHAFQLDLFFNNVSKPNSPVFDRLGSLEYDENKSI--IFRPNGKINTDGLVLRGWYTCLTLAVYGTAERPHS 132          
BLAST of Protein virilizer isoform 1 vs. Ensembl Zebrafish
Match: virma (vir like m6A methyltransferase associated [Source:ZFIN;Acc:ZDB-GENE-100922-238])

HSP 1 Score: 63.1586 bits (152), Expect = 4.810e-10
Identity = 82/258 (31.78%), Postives = 118/258 (45.74%), Query Frame = 1
Query: 4858 SRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRD---GMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYRE-----WLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRG-------HDAIIHTGRTSKK--FVAPM---------RGRG---FGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDF 5541
            SR+L LS S +KQ+LQW   KE +  H + EL   +  + +E+ESL+ L +   G+  +IE  S  D     T+    T  ++P P+ L+  +  R V+         LS++  E     W  P +  E E   ++ + DL  LA  CC   +L  EL R    +  +  H +  +G       H+  I +  TS +  +V P          RGRG   FG  S           +D FR R  NTSRPPSMHVDDF
Sbjct:    4 SRSLALSVSDMKQLLQW---KEDSGEHLLCELEKHITKLCKEDESLEALLENVVGLRQIIE--SSGD---AQTNAEPETEPSLPAPEPLQTQFNHRTVYV--------LSDVLDEQLKALWFSPFQPDEMETEVDMVKVDLVALAQQCCTELDLKAELERSFLSEPSSPGHSKPSKGFRLGKHKHETFITSRYTSGRSDYVEPAKRAHIMAAPRGRGRGSFGQLSRP---------HDIFRQRKQNTSRPPSMHVDDF 236          
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Match: VIRMA (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:100329117])

HSP 1 Score: 73.559 bits (179), Expect = 3.631e-12
Identity = 115/470 (24.47%), Postives = 205/470 (43.62%), Query Frame = 1
Query: 4234 CKHAFLKLI-GQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXX---XXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPE------LSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTS-------KKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDE 5562
            CK A L LI G K  +  +E  Q L T+  S   +++      H    E +++ +Q L D  + +  ++P                  +  +V   +++ N+LP      +I   L     N D   +++  A+R ++ L+ HDYGF  L   L         ++KR+   F  D  +   S    +  +   +++V  ++     V    P++T  L+ + +K +L    +KE  S + + +L  L+   S+E+++L+ L D + S  +++ S    +P +   +E     +P    L+ M+ +R V+         L+++  E L  +  T  +P E      + + DL  L+  CC+ F+L  EL R         GR +  +  +  + +  H+  I +G++          FV   RGRG G    T+        +D FR R  NTSRPPSMHVDDF   ++ E
Sbjct: 1255 CKVAILHLITGGKGDERYAELFQELLTMMKSAADNVI------HQQCGEYVMSIIQYLCDQDIAL--ILPST----------------TEAQVSEQEQLANALPGKELLPSICDSLMETFANSDSSYASLHTAIRTMMFLSEHDYGFYHLKSSLKKHSSALYVVLKRIVCAFGKDTGELASSYLDFMRQIMNSESMVCGEEGGMMEVDGSHPTKTQGLTTAEIKHLLL---SKEETSENLLLDLEKLVLEQSKEDDNLESLLDNVSSFRQIIESAKTPMPLSDQDVEPV---LPATDPLQNMFNNRTVY--------ILADMLDEQLKSLSFTPFQPEEADADLDMVKVDLLELSAKCCSDFDLKSELERSFLLEPSSPGRTKTTKGFKLGKHK--HETFITSGKSEYIEPAKRAHFVPLPRGRGRGGFVQTMRP------HDLFRQRKQNTSRPPSMHVDDFVAAERKE 1678          

HSP 2 Score: 63.929 bits (154), Expect = 3.131e-9
Identity = 51/198 (25.76%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y + +  S+WV  +EE+P  + +GL++     K+     +  LV W    L ++ ALQQ   + + R +K G  +   +    +     +L+ N     V   L +LL    +++ LKL   R+LD       G++SF+   + ++    ++ YQ+L+  ++     + T RV  +CS +L K H  E+L
Sbjct:  377 KLTELLELY-QDDRGSKWVTALEEVPGLIVKGLSFGML--KEPGRDHLSQLVDWAMQALDLQLALQQPIALNV-RQLKAGTKLVSSLAECGSQAVEALLNAN-----VIGKLYNLLFADHVSSSLKLNAFRSLDSIISTNEGMESFL---KPSEGQGTKSGYQKLLELIL----LDQTVRVFTSCSAVLQKCHFSEIL 558          

HSP 3 Score: 62.3882 bits (150), Expect = 1.125e-8
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 1
Query:   55 ENNYMLVFFDTFSHGIKPE-MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPS---FEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGII 423
            E+   L+F DTF H    +   VD +RF   V I  +R+IP G+   + +      G T+P  F++  F  N+   PS   F+++G +++DE + +  I  P+  + +  L + G YN L++AV+G +
Sbjct:    4 ESAMELLFLDTFKHQNSEQGSNVDVVRFPCVVYINEVRVIPPGVRAHNSLPDSRAYGETSPHTFHLDLF-FNNVSKPSATVFDRLGSLDYDENSSI--IFRPNAKINTDGLVLKGWYNCLTLAVYGSV 128          

HSP 4 Score: 54.6842 bits (130), Expect = 2.317e-6
Identity = 62/268 (23.13%), Postives = 129/268 (48.13%), Query Frame = 1
Query: 3148 PINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRY-PLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEE---NEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIE 3939
            P+      +++  A+ + F  +GL    R++Q+++      W+  +      Y  + + VA    +++  +   L++    +FKD+     L + + + CS    G      R   + + +++ I+D +LT+TQ    +E+   +E+    + W+ ML+E+L+        F  GL +L ELLPLPLP+     +  ++ +   + R LWS H+    + L+ ++ +I  TS   L  ++ R+   +  L   TAL++ +  L+ ++E
Sbjct:  963 PVEGQQKDLKWNLAVIQLFSAEGLDTFIRILQKLNSILIQPWRLHVNLGTILYRAITISVARCTLSLLKTMLMELLRGGSFEFKDMRVPCTLVTLHMLLCSIPLSG------RLDGEEQKVQNDIVDILLTFTQGV--NEQLTISEETLANNTWSLMLKEVLSSILKVTEGFVSGLIILSELLPLPLPMQTTQAIDPQDIAVALNTRKLWSMHLHVHSKLLQDIVRSISGTSCQPLQHMIRRVCVQLCDLASPTALLIMRTVLDLIVE 1222          
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Match: VIRMA (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:100329117])

HSP 1 Score: 73.559 bits (179), Expect = 4.408e-12
Identity = 117/470 (24.89%), Postives = 207/470 (44.04%), Query Frame = 1
Query: 4234 CKHAFLKLI-GQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXX---XXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPE------LSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTS-------KKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDE 5562
            CK A L LI G K  +  +E  Q L T+  S   +++      H    E +++ +Q L D  + +  ++P   +  EA             +V   +++ N+LP      +I   L     N D   +++  A+R ++ L+ HDYGF  L   L         ++KR+   F  D  +   S    +  +   +++V  ++     V    P++T  L+ + +K +L    +KE  S + + +L  L+   S+E+++L+ L D + S  +++ S    +P +   +E     +P    L+ M+ +R V+         L+++  E L  +  T  +P E      + + DL  L+  CC+ F+L  EL R         GR +  +  +  + +  H+  I +G++          FV   RGRG G    T+        +D FR R  NTSRPPSMHVDDF   ++ E
Sbjct: 1257 CKVAILHLITGGKGDERYAELFQELLTMMKSAADNVI------HQQCGEYVMSIIQYLCDQDIAL--ILP---STTEA-------------QVSEQEQLANALPGKELLPSICDSLMETFANSDSSYASLHTAIRTMMFLSEHDYGFYHLKSSLKKHSSALYVVLKRIVCAFGKDTGELASSYLDFMRQIMNSESMVCGEEGGMMEVDGSHPTKTQGLTTAEIKHLLL---SKEETSENLLLDLEKLVLEQSKEDDNLESLLDNVSSFRQIIESAKTPMPLSDQDVEPV---LPATDPLQNMFNNRTVY--------ILADMLDEQLKSLSFTPFQPEEADADLDMVKVDLLELSAKCCSDFDLKSELERSFLLEPSSPGRTKTTKGFKLGKHK--HETFITSGKSEYIEPAKRAHFVPLPRGRGRGGFVQTMRP------HDLFRQRKQNTSRPPSMHVDDFVAAERKE 1680          

HSP 2 Score: 64.3142 bits (155), Expect = 2.392e-9
Identity = 51/198 (25.76%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y + +  S+WV  +EE+P  + +GL++     K+     +  LV W    L ++ ALQQ   + + R +K G  +   +    +     +L+ N     V   L +LL    +++ LKL   R+LD       G++SF+   + ++    ++ YQ+L+  ++     + T RV  +CS +L K H  E+L
Sbjct:  400 KLTELLELY-QDDRGSKWVTALEEVPGLIVKGLSFGML--KEPGRDHLSQLVDWAMQALDLQLALQQPIALNV-RQLKAGTKLVSSLAECGSQAVEALLNAN-----VIGKLYNLLFADHVSSSLKLNAFRSLDSIISTNEGMESFL---KPSEGQGTKSGYQKLLELIL----LDQTVRVFTSCSAVLQKCHFSEIL 581          

HSP 3 Score: 62.3882 bits (150), Expect = 1.107e-8
Identity = 39/128 (30.47%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   55 ENNYMLVFFDTFSHGIKPE-MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPS---FEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            E+   L+F DTF H    +   VD +RF   V I  +R+IP G+   + +      G T+P  F++  F  N+   PS   F+++G +++DE + +  I  P+  +    L + G YN L++AV+G +
Sbjct:   22 ESAMELLFLDTFKHQNSEQGSNVDVVRFPCVVYINEVRVIPPGVRAHNSLPDSRAYGETSPHTFHLDLF-FNNVSKPSATVFDRLGSLDYDENSSI--IFRPNAKINTDGLVLKGWYNCLTLAVYGSV 146          

HSP 4 Score: 54.6842 bits (130), Expect = 2.203e-6
Identity = 62/268 (23.13%), Postives = 129/268 (48.13%), Query Frame = 1
Query: 3148 PINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRY-PLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEE---NEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIE 3939
            P+      +++  A+ + F  +GL    R++Q+++      W+  +      Y  + + VA    +++  +   L++    +FKD+     L + + + CS         S R   + + +++ I+D +LT+TQ    +E+   +E+    + W+ ML+E+L+        F  GL +L ELLPLPLP+     +  ++ +   + R LWS H+    + L+ ++ +I  TS   L  ++ R+   +  L   TAL++ +  L+ ++E
Sbjct:  965 PVEGQQKDLKWNLAVIQLFSAEGLDTFIRILQKLNSILIQPWRLHVNLGTILYRAITISVARCTLSLLKTMLMELLRGGSFEFKDMRVPCTLVTLHMLLCS------IPLSGRLDGEEQKVQNDIVDILLTFTQGV--NEQLTISEETLANNTWSLMLKEVLSSILKVTEGFVSGLIILSELLPLPLPMQTTQAIDPQDIAVALNTRKLWSMHLHVHSKLLQDIVRSISGTSCQPLQHMIRRVCVQLCDLASPTALLIMRTVLDLIVE 1224          
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Match: VIRMA (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:100329117])

HSP 1 Score: 73.559 bits (179), Expect = 4.628e-12
Identity = 117/470 (24.89%), Postives = 207/470 (44.04%), Query Frame = 1
Query: 4234 CKHAFLKLI-GQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXX---XXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPE------LSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTS-------KKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDE 5562
            CK A L LI G K  +  +E  Q L T+  S   +++      H    E +++ +Q L D  + +  ++P   +  EA             +V   +++ N+LP      +I   L     N D   +++  A+R ++ L+ HDYGF  L   L         ++KR+   F  D  +   S    +  +   +++V  ++     V    P++T  L+ + +K +L    +KE  S + + +L  L+   S+E+++L+ L D + S  +++ S    +P +   +E     +P    L+ M+ +R V+         L+++  E L  +  T  +P E      + + DL  L+  CC+ F+L  EL R         GR +  +  +  + +  H+  I +G++          FV   RGRG G    T+        +D FR R  NTSRPPSMHVDDF   ++ E
Sbjct: 1242 CKVAILHLITGGKGDERYAELFQELLTMMKSAADNVI------HQQCGEYVMSIIQYLCDQDIAL--ILP---STTEA-------------QVSEQEQLANALPGKELLPSICDSLMETFANSDSSYASLHTAIRTMMFLSEHDYGFYHLKSSLKKHSSALYVVLKRIVCAFGKDTGELASSYLDFMRQIMNSESMVCGEEGGMMEVDGSHPTKTQGLTTAEIKHLLL---SKEETSENLLLDLEKLVLEQSKEDDNLESLLDNVSSFRQIIESAKTPMPLSDQDVEPV---LPATDPLQNMFNNRTVY--------ILADMLDEQLKSLSFTPFQPEEADADLDMVKVDLLELSAKCCSDFDLKSELERSFLLEPSSPGRTKTTKGFKLGKHK--HETFITSGKSEYIEPAKRAHFVPLPRGRGRGGFVQTMRP------HDLFRQRKQNTSRPPSMHVDDFVAAERKE 1665          

HSP 2 Score: 64.3142 bits (155), Expect = 2.310e-9
Identity = 51/198 (25.76%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y + +  S+WV  +EE+P  + +GL++     K+     +  LV W    L ++ ALQQ   + + R +K G  +   +    +     +L+ N     V   L +LL    +++ LKL   R+LD       G++SF+   + ++    ++ YQ+L+  ++     + T RV  +CS +L K H  E+L
Sbjct:  379 KLTELLELY-QDDRGSKWVTALEEVPGLIVKGLSFGML--KEPGRDHLSQLVDWAMQALDLQLALQQPIALNV-RQLKAGTKLVSSLAECGSQAVEALLNAN-----VIGKLYNLLFADHVSSSLKLNAFRSLDSIISTNEGMESFL---KPSEGQGTKSGYQKLLELIL----LDQTVRVFTSCSAVLQKCHFSEIL 560          

HSP 3 Score: 62.003 bits (149), Expect = 1.223e-8
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 1
Query:   55 ENNYMLVFFDTFSHGIKPE-MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPS---FEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGII 423
            E+   L+F DTF H    +   VD +RF   V I  +R+IP G+   + +      G T+P  F++  F  N+   PS   F+++G +++DE + +  I  P+  + +  L + G YN L++AV+G +
Sbjct:   43 ESAMELLFLDTFKHQNSEQGSNVDVVRFPCVVYINEVRVIPPGVRAHNSLPDSRAYGETSPHTFHLDLF-FNNVSKPSATVFDRLGSLDYDENSSI--IFRPNAKINTDGLVLKGWYNCLTLAVYGSV 167          

HSP 4 Score: 54.6842 bits (130), Expect = 2.238e-6
Identity = 62/268 (23.13%), Postives = 129/268 (48.13%), Query Frame = 1
Query: 3148 PINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRY-PLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEE---NEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIE 3939
            P+      +++  A+ + F  +GL    R++Q+++      W+  +      Y  + + VA    +++  +   L++    +FKD+     L + + + CS         S R   + + +++ I+D +LT+TQ    +E+   +E+    + W+ ML+E+L+        F  GL +L ELLPLPLP+     +  ++ +   + R LWS H+    + L+ ++ +I  TS   L  ++ R+   +  L   TAL++ +  L+ ++E
Sbjct:  944 PVEGQQKDLKWNLAVIQLFSAEGLDTFIRILQKLNSILIQPWRLHVNLGTILYRAITISVARCTLSLLKTMLMELLRGGSFEFKDMRVPCTLVTLHMLLCS------IPLSGRLDGEEQKVQNDIVDILLTFTQGV--NEQLTISEETLANNTWSLMLKEVLSSILKVTEGFVSGLIILSELLPLPLPMQTTQAIDPQDIAVALNTRKLWSMHLHVHSKLLQDIVRSISGTSCQPLQHMIRRVCVQLCDLASPTALLIMRTVLDLIVE 1203          
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Match: VIRMA (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:100329117])

HSP 1 Score: 72.7886 bits (177), Expect = 7.235e-12
Identity = 116/472 (24.58%), Postives = 202/472 (42.80%), Query Frame = 1
Query: 4234 CKHAFLKLI-GQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSD-----EPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPE------LSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTS-------KKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDE 5562
            CK A L LI G K  +  +E  Q L T+  S   +++      H    E +++ +Q L D  + +  ++P                  +  +V   +++ N+LP      +I   L     N D   +++  A+R ++ L+ HDYGF  L   L         ++KR+   F  D  +   S L  +  +       D  +       V    P++T  L+ + +K +L    +KE  S + + +L  L+   S+E+++L+ L D + S  +++ S    +P +   +E     +P    L+ M+ +R V+         L+++  E L  +  T  +P E      + + DL  L+  CC+ F+L  EL R         GR +  +  +  + +  H+  I +G++          FV   RGRG G    T+        +D FR R  NTSRPPSMHVDDF   ++ E
Sbjct: 1245 CKVAILHLITGGKGDERYAELFQELLTMMKSAADNVI------HQQCGEYVMSIIQYLCDQDIAL--ILPST----------------TEAQVSEQEQLANALPGKELLPSICDSLMETFANSDSSYASLHTAIRTMMFLSEHDYGFYHLKSSLKKHSSALYVVLKRIVCAFGKDTGELASSYLDFMRQIMNSDCCCDGGNWEQRMMEVDGSHPTKTQGLTTAEIKHLLL---SKEETSENLLLDLEKLVLEQSKEDDNLESLLDNVSSFRQIIESAKTPMPLSDQDVEPV---LPATDPLQNMFNNRTVY--------ILADMLDEQLKSLSFTPFQPEEADADLDMVKVDLLELSAKCCSDFDLKSELERSFLLEPSSPGRTKTTKGFKLGKHK--HETFITSGKSEYIEPAKRAHFVPLPRGRGRGGFVQTMRP------HDLFRQRKQNTSRPPSMHVDDFVAAERKE 1670          

HSP 2 Score: 64.3142 bits (155), Expect = 2.804e-9
Identity = 51/198 (25.76%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y + +  S+WV  +EE+P  + +GL++     K+     +  LV W    L ++ ALQQ   + + R +K G  +   +    +     +L+ N     V   L +LL    +++ LKL   R+LD       G++SF+   + ++    ++ YQ+L+  ++     + T RV  +CS +L K H  E+L
Sbjct:  382 KLTELLELY-QDDRGSKWVTALEEVPGLIVKGLSFGML--KEPGRDHLSQLVDWAMQALDLQLALQQPIALNV-RQLKAGTKLVSSLAECGSQAVEALLNAN-----VIGKLYNLLFADHVSSSLKLNAFRSLDSIISTNEGMESFL---KPSEGQGTKSGYQKLLELIL----LDQTVRVFTSCSAVLQKCHFSEIL 563          

HSP 3 Score: 62.003 bits (149), Expect = 1.163e-8
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 1
Query:   55 ENNYMLVFFDTFSHGIKPE-MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPS---FEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGII 423
            E+   L+F DTF H    +   VD +RF   V I  +R+IP G+   + +      G T+P  F++  F  N+   PS   F+++G +++DE + +  I  P+  + +  L + G YN L++AV+G +
Sbjct:    4 ESAMELLFLDTFKHQNSEQGSNVDVVRFPCVVYINEVRVIPPGVRAHNSLPDSRAYGETSPHTFHLDLF-FNNVSKPSATVFDRLGSLDYDENSSI--IFRPNAKINTDGLVLKGWYNCLTLAVYGSV 128          

HSP 4 Score: 54.6842 bits (130), Expect = 2.519e-6
Identity = 62/268 (23.13%), Postives = 129/268 (48.13%), Query Frame = 1
Query: 3148 PINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRY-PLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEE---NEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIE 3939
            P+      +++  A+ + F  +GL    R++Q+++      W+  +      Y  + + VA    +++  +   L++    +FKD+     L + + + CS    G      R   + + +++ I+D +LT+TQ    +E+   +E+    + W+ ML+E+L+        F  GL +L ELLPLPLP+     +  ++ +   + R LWS H+    + L+ ++ +I  TS   L  ++ R+   +  L   TAL++ +  L+ ++E
Sbjct:  947 PVEGQQKDLKWNLAVIQLFSAEGLDTFIRILQKLNSILIQPWRLHVNLGTILYRAITISVARCTLSLLKTMLMELLRGGSFEFKDMRVPCTLVTLHMLLCSIPLSG------RLDGEEQKVQNDIVDILLTFTQGV--NEQLTISEETLANNTWSLMLKEVLSSILKVTEGFVSGLIILSELLPLPLPMQTTQAIDPQDIAVALNTRKLWSMHLHVHSKLLQDIVRSISGTSCQPLQHMIRRVCVQLCDLASPTALLIMRTVLDLIVE 1206          
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Match: VIRMA (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:100329117])

HSP 1 Score: 63.1586 bits (152), Expect = 6.484e-9
Identity = 51/198 (25.76%), Postives = 95/198 (47.98%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y + +  S+WV  +EE+P  + +GL++     K+     +  LV W    L ++ ALQQ   + + R +K G  +   +    +     +L+ N     V   L +LL    +++ LKL   R+LD       G++SF+   + ++    ++ YQ+L+  ++     + T RV  +CS +L K H  E+L
Sbjct:  287 KLTELLELY-QDDRGSKWVTALEEVPGLIVKGLSFGML--KEPGRDHLSQLVDWAMQALDLQLALQQPIALNV-RQLKAGTKLVSSLAECGSQAVEALLNAN-----VIGKLYNLLFADHVSSSLKLNAFRSLDSIISTNEGMESFL---KPSEGQGTKSGYQKLLELIL----LDQTVRVFTSCSAVLQKCHFSEIL 468          
BLAST of Protein virilizer isoform 1 vs. Ensembl Mouse
Match: Virma (vir like m6A methyltransferase associated [Source:MGI Symbol;Acc:MGI:1913435])

HSP 1 Score: 75.8702 bits (185), Expect = 5.576e-13
Identity = 77/315 (24.44%), Postives = 142/315 (45.08%), Query Frame = 1
Query: 4519 QEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXV----KQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMR 5418
            +++ NSLP+      I   L     N +   + +   +R ++ LA HDYG   L   L        SL+KRV  TFS D  +   + L  +  +           D+    V+   P RT++L+ + +KQ+LQ   +KE +      EL  L+   S++++SL+ L D +  L ++L S  + +P +   +E     +  P+SL+ ++ +R  +      + +L  +   W  P +  E +   +L + DL  L+  CC+ F+LH EL R         GR +  +  +  + +  H+  I T     +++ P +
Sbjct: 1360 EQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNADAMGCCGDDSGLMEVEGAHPPRTMSLNAAELKQLLQ---SKEESPESLFLELEKLVLEHSKDDDSLESLLDNVIGLKQMLESSGEPLPLSDQDVEPV---LSAPESLQNLFNNRTAYVLADVMDDQLKSM---WFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSKTTKGFKLGKHK--HETFI-TSSGKSEYIEPAK 1662          

HSP 2 Score: 72.7886 bits (177), Expect = 4.732e-12
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +++ +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ A +Q   + + R +K G  +   +         ++L      INV   L DLL    +++ LKL   +ALD    +  G+++F+   R T+N  E++ YQRL+  ++     + T RV  A S +L K H +E+L
Sbjct:  380 EASVKLTELLDLYQE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTEQDSLGQLVDWTMQALNLQVAFRQPIALNV-RQLKAGTKLVTSLAECGAPGVTELLQAG--VINV---LFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RSTQN--EKSGYQRLLELIL----LDQTVRVVTAGSAILQKCHFYEIL 563          

HSP 3 Score: 65.4698 bits (158), Expect = 8.033e-10
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  +    L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          
BLAST of Protein virilizer isoform 1 vs. Ensembl Mouse
Match: Virma (vir like m6A methyltransferase associated [Source:MGI Symbol;Acc:MGI:1913435])

HSP 1 Score: 75.485 bits (184), Expect = 7.635e-13
Identity = 77/315 (24.44%), Postives = 142/315 (45.08%), Query Frame = 1
Query: 4519 QEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXV----KQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMR 5418
            +++ NSLP+      I   L     N +   + +   +R ++ LA HDYG   L   L        SL+KRV  TFS D  +   + L  +  +           D+    V+   P RT++L+ + +KQ+LQ   +KE +      EL  L+   S++++SL+ L D +  L ++L S  + +P +   +E     +  P+SL+ ++ +R  +      + +L  +   W  P +  E +   +L + DL  L+  CC+ F+LH EL R         GR +  +  +  + +  H+  I T     +++ P +
Sbjct: 1310 EQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNADAMGCCGDDSGLMEVEGAHPPRTMSLNAAELKQLLQ---SKEESPESLFLELEKLVLEHSKDDDSLESLLDNVIGLKQMLESSGEPLPLSDQDVEPV---LSAPESLQNLFNNRTAYVLADVMDDQLKSM---WFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSKTTKGFKLGKHK--HETFI-TSSGKSEYIEPAK 1612          

HSP 2 Score: 72.7886 bits (177), Expect = 4.867e-12
Identity = 58/198 (29.29%), Postives = 100/198 (50.51%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ A +Q   + + R +K G  +   +         ++L      INV   L DLL    +++ LKL   +ALD    +  G+++F+   R T+N  E++ YQRL+  ++     + T RV  A S +L K H +E+L
Sbjct:  384 KLTELLDLYQE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTEQDSLGQLVDWTMQALNLQVAFRQPIALNV-RQLKAGTKLVTSLAECGAPGVTELLQAG--VINV---LFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RSTQN--EKSGYQRLLELIL----LDQTVRVVTAGSAILQKCHFYEIL 563          

HSP 3 Score: 65.4698 bits (158), Expect = 7.995e-10
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  +    L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          
BLAST of Protein virilizer isoform 1 vs. Ensembl Mouse
Match: Virma (vir like m6A methyltransferase associated [Source:MGI Symbol;Acc:MGI:1913435])

HSP 1 Score: 72.4034 bits (176), Expect = 5.472e-12
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +++ +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ A +Q   + + R +K G  +   +         ++L      INV   L DLL    +++ LKL   +ALD    +  G+++F+   R T+N  E++ YQRL+  ++     + T RV  A S +L K H +E+L
Sbjct:  380 EASVKLTELLDLYQE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTEQDSLGQLVDWTMQALNLQVAFRQPIALNV-RQLKAGTKLVTSLAECGAPGVTELLQAG--VINV---LFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RSTQN--EKSGYQRLLELIL----LDQTVRVVTAGSAILQKCHFYEIL 563          

HSP 2 Score: 65.4698 bits (158), Expect = 6.987e-10
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  +    L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          
BLAST of Protein virilizer isoform 1 vs. UniProt/SwissProt
Match: sp|Q291E4|VIR_DROPS (Protein virilizer OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=vir PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.272e-14
Identity = 42/132 (31.82%), Postives = 79/132 (59.85%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVN-SISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNP 456
            L+FFDTFSH    ++ +D ++F +PV I  +RIIP G  ++++     RLG TNP  F+++FF ++     + +FE +G + +++ + ++   S   +P    L + G Y+ +++AV+GI++     PI +P
Sbjct:   10 LLFFDTFSHEDITDINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPSKFDLEFFVNDLGMPGASAFENLGLLRYNQNDCIHLDCSREKIP-TDGLVLRGWYSTITLAVYGILTNSVTQPIASP 140          
BLAST of Protein virilizer isoform 1 vs. UniProt/SwissProt
Match: sp|Q9W1R5|VIR_DROME (Protein virilizer OS=Drosophila melanogaster OX=7227 GN=vir PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.276e-14
Identity = 39/131 (29.77%), Postives = 76/131 (58.02%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNP 456
            L+FFDTFSH    ++ +D ++F +PV I  +RIIP G  ++++     RLG TNP  F+++FF ++     + +FE +G + +++ + ++        +   L + G Y+ +++A++GI +     PI +P
Sbjct:   10 LLFFDTFSHEEVTDINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPSKFDLEFFVNDLGMPAASAFENLGLLRYNQNDCIHLDCSQEKIVTDGLVLRGWYSTITLAIYGIFTNSVTEPIASP 140          

HSP 2 Score: 56.225 bits (134), Expect = 3.661e-6
Identity = 91/426 (21.36%), Postives = 185/426 (43.43%), Query Frame = 1
Query: 2692 DLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPG-LVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAE--------PATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKS--QIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELL-NFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETL 3933
            DL + + + ++   +++  T+   P    L Y  +++ A VR+ +   YL ++G  +  L K+      + +    +    +     +++     +   ++V    LD     PG L+  +R+L+Y  +SK                  Q   P+ +    +++++   + +  DG+ +  ++++++  + +   Q G        P L+ +          P   ++  +    I  R   +KD+T +  L   Y +         Y   TR ++  ++E  +  ++ T+L YTQ   P+E++E++  KSLWT M+RE+L N    A F     L   +  LPLP+P      L  +   ++ + R LWSAH+     ++  L+  +  +S   L  LL R+   +S L P+  L++A+   E L
Sbjct:  918 DLIKKEQRLQTQRQLSSPGTKYKSP---VLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLEAINVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISK--------------PLAGQKAPPVTEE---LKHRFVALQLYAADGVQLCIQIMERLCAYFE---QPGAH-----APALMTIQGVHCCQIMLPTLQILRELLSYAILCRDGTYKDLTAIDHLVKVYYLL--------YYFPTRCQAGPEVEQCKMEVVQTLLAYTQ---PNEQDEESLHKSLWTLMIREVLKNVDGPAHFIPGLKLLAELLPLPLPMPQPLCDQLQQQHKQRLITERKLWSAHLHPQSGQIAKLVEALAPSSFPQLSELLQRVCMQLSDLAPNMTLLIAKTITELL 1304          
BLAST of Protein virilizer isoform 1 vs. UniProt/SwissProt
Match: sp|A2AIV2|VIR_MOUSE (Protein virilizer homolog OS=Mus musculus OX=10090 GN=Virma PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.341e-12
Identity = 77/315 (24.44%), Postives = 142/315 (45.08%), Query Frame = 1
Query: 4519 QEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXV----KQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELAR---------GRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMR 5418
            +++ NSLP+      I   L     N +   + +   +R ++ LA HDYG   L   L        SL+KRV  TFS D  +   + L  +  +           D+    V+   P RT++L+ + +KQ+LQ   +KE +      EL  L+   S++++SL+ L D +  L ++L S  + +P +   +E     +  P+SL+ ++ +R  +      + +L  +   W  P +  E +   +L + DL  L+  CC+ F+LH EL R         GR +  +  +  + +  H+  I T     +++ P +
Sbjct: 1310 EQLSNSLPSKELMTAICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASASLDFMRQILNADAMGCCGDDSGLMEVEGAHPPRTMSLNAAELKQLLQ---SKEESPESLFLELEKLVLEHSKDDDSLESLLDNVIGLKQMLESSGEPLPLSDQDVEPV---LSAPESLQNLFNNRTAYVLADVMDDQLKSM---WFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELERSFLSEPSSPGRSKTTKGFKLGKHK--HETFI-TSSGKSEYIEPAK 1612          

HSP 2 Score: 72.7886 bits (177), Expect = 3.404e-11
Identity = 58/198 (29.29%), Postives = 100/198 (50.51%), Query Frame = 1
Query: 1285 RLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ A +Q   + + R +K G  +   +         ++L      INV   L DLL    +++ LKL   +ALD    +  G+++F+   R T+N  E++ YQRL+  ++     + T RV  A S +L K H +E+L
Sbjct:  384 KLTELLDLYQE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTEQDSLGQLVDWTMQALNLQVAFRQPIALNV-RQLKAGTKLVTSLAECGAPGVTELLQAG--VINV---LFDLLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RSTQN--EKSGYQRLLELIL----LDQTVRVVTAGSAILQKCHFYEIL 563          

HSP 3 Score: 65.4698 bits (158), Expect = 5.593e-9
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  +    L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSGLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          
BLAST of Protein virilizer isoform 1 vs. UniProt/SwissProt
Match: sp|Q69YN4|VIR_HUMAN (Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 7.355e-10
Identity = 58/202 (28.71%), Postives = 104/202 (51.49%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL 1878
            +++ +L  L+  Y E +  ++WV  +EE+P  + +GL+YL    K+T    +  LV W    L+++ AL+Q   + + R +K G  +   + SL    A  V  T   +  V   L +LL    +++ LKL   +ALD    +  G+++F+   R  +N  E++ YQ+L+  ++     + T RV  A S +L K H +E+L
Sbjct:  380 EASVKLTELLDLYRE-DRGAKWVTALEEIPSLIIKGLSYLQL--KNTKQDSLGQLVDWTMQALNLQVALRQPIALNV-RQLKAGTKL---VSSLAECGAQGV--TGLLQAGVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFL---RGRQN--EKSGYQKLLELIL----LDQTVRVVTAGSAILQKCHFYEVL 563          

HSP 2 Score: 66.2402 bits (160), Expect = 4.028e-9
Identity = 37/122 (30.33%), Postives = 64/122 (52.46%), Query Frame = 1
Query:   70 LVFFDTFSH-GIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGII 423
            L+F DTF H   +    +D +RF   V I  +R+IP G+   S +      G T+P  F +  F +N     +P F+++G +E+DE   +  I  P+  + +  L + G YN L++A++G +
Sbjct:    9 LLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYGETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSI--IFRPNSKVNTDGLVLRGWYNCLTLAIYGSV 128          

HSP 3 Score: 65.855 bits (159), Expect = 4.889e-9
Identity = 72/270 (26.67%), Postives = 126/270 (46.67%), Query Frame = 1
Query: 4519 QEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXV----KQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELL-SKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELAR 5310
            +++ NSLP      +I   L     N +   + +   +R ++ LA HDYG   L   L        SL+KRV  TFS D  +   S L  +  +           DN    V+    SRT++++ + +KQ+LQ   +KE +  +   EL  L+   S+++++L  L D +  L ++L S  D +P +   +E     +  P+SL+ ++ +R  +      + +L  +   W  P +  E +   +L + DL  L+  CC+ F+LH EL R
Sbjct: 1311 EQLSNSLPNKELMTSICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLKRVVSTFSKDTGELASSFLEFMRQILNSDTIGCCGDDNGLMEVEGAHTSRTMSINAAELKQLLQ---SKEESPENLFLELEKLVLEHSKDDDNLDSLLDSVVGLKQMLESSGDPLPLSDQDVEPV---LSAPESLQNLFNNRTAYVLADVMDDQLKSM---WFTPFQAEEIDTDLDLVKVDLIELSEKCCSDFDLHSELER 1571          
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Match: A0A2R2MLZ5 (protein virilizer homolog OS=Lingula unguis OX=7574 GN=LOC106153148 PE=4 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.694e-111
Identity = 412/1478 (27.88%), Postives = 685/1478 (46.35%), Query Frame = 1
Query: 1264 DIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIG---------VQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANM-------------------LLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAP---NGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQG--VDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDNSESEQTLGTIFFSIMSDI-LEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQ----------DNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELARGRQQDD-EAIRHKRR---RRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKL 5550
            ++P+ A RL+++V TY       +WVE MEE+P  LA+GLAYL +  ++    ++++LV W   GL++E A++Q    + +RH+K GI +   +CS + DIA+K+LS       VQ  L+DL  ++ ++  +K+ II+ALD +TRL+ G+D F+G         V+ ++    E+  YQR++  ++ K       R  +A + L+ K H+ E+       +  L +        +K+   +                      L+EI+++F++A D++A PRRT+P    F+ V  KP++PYP+L  ++ S ++L ++ ++LS S             S  +  A   L+ E ++    ++ L   P   NGIT     R+   S D+   + A D    Q     LG ++ + L+ L+ ID+L  +  +   I+   +N E L        L  +  +T    G   +  V++ DDNLA ++P  E                                    +E   + +  S+C  Y   LL  +VR + +   L ++  +L  +G++ V S      DWL P + LPS +   L  V  L +        L     P GLVT+LR+L++  V  +                       NQG   + ++YKY I E F  D   V   ++Q+I +   L WQ GI        L++   +P  A+V A    L+ +R   F+D+T L  LF  +TV CS    G            + I+  IID + T+TQS   + E+ +  +KSLWT M++EL  +  ++P+ F  GL ++ ELLPLPLPL +   +T+EE +   + R LWSAH+  +  E+  +I T+  +S   L   L R+   ++ L   ++L++ +  L+ L+E  D + ++               T    E   KE   ++  +T + ++G T                                 R   +   L+  PP K   L+L+     +  +++E+    +F  +++ + + + K++H   QE +++ LQ L D  VTM                     I + + +   ++I +SLP   Q +     +  H  N D   ++I  +LR LV+L  HDYGF  +   +D       SL  R+N TFS D+ DC  +L TA+ LLQ L+             +  + P +Y    R +++S   +K+ L W    +    HP+ +L  LL    +EEESL  L DG+  L+ L  K +      D  E     +P P++L+E +  R   Q    +E +L+ IY  WL  + V + +   ++   DLE ++   C  F++ +EL +G+   + +  + KRR   RRG D I  +    ++FVAPMRGRGFG     ++S    +R+D FRSRPPNTSRPPSMHVDDF KL
Sbjct:  940 ELPEEASRLLDIVQTYRTEEHADKWVEAMEEVPGLLAKGLAYLVWKAENKD--VVDTLVEWTMEGLNLELAIKQPVTAFKIRHLKMGIKLTAALCSTDADIALKLLSQG-----VQSKLLDLYSSQYMSMSVKILIIKALDDTTRLKEGMDWFLGGSVRQEKPVVKMESGEMPEKGCYQRVLEMILVKQNI----RTVVAWTSLVRKAHIHEIASRLRSTVLSLVEKTESDDSEMKVSLSSEEETEEPRCLLQEEDEESVVACLEEILKFFVNACDLMAQPRRTLPAKVKFE-VKQKPYDPYPHLCQILNSCDLLGNLFFLLSCSAT---------ANSAAIFCAVRELLCELMRTQTGMLFLSSQPDAVNGIT-----RVLTQSSDDSKEEVAEDNPLQQ-----LGFQMIYYLQMLQFIDQLRAFHEKD--INKEIDNVEAL------ATLHSIYSMTFNTIGREAVVHVLSQDDNLAALIPFMEL---------------------------------TGDEAKDIKIKKSVCASYTTELLLFVVRFSHSVEMLERFAPKLLEIGENEVTSKITLLHDWLIPTKTLPSYTYEGLPEVIKLLKQYNEEVLGL-----PKGLVTILRILRHLAVPPDVE---------------------NQGEHTEELKYKYVIIELFSADCFPVFINILQKIGELQLLPWQQGIASSYQYQALIMAFIKPTLAIVKATLSYLVHARGAAFQDLTSLPTLFQLHTVMCSICLSGE------LSEDAQKIQTDIIDILSTFTQSVPAESESNEDLEKSLWTRMMKELFKYVLTSPYTFLSGLHMVSELLPLPLPLQSRESVTEEELTLTVNTRRLWSAHLHPIAPEILEVIKTLAGSSCQVLQHALRRVCWQLADLASPSSLLVGRCILDALLESMDNSIEK--------------STQPAKEGEKKEEEKEEKANTEQRSSGETA--------------------------------RILNLTAYLVAHPPIKSPVLQLM-----RGETKAEEKYKDLFPRLLNLLNVVSEKQSHINAQECIVSVLQSLCDPAVTM---------------------ITAESSLTLQEQIASSLPIKEQLMQQCTAILEHIGNQDHSYASILPSLRTLVMLTEHDYGFYHVKSAMDSNSMALFSLFLRINNTFSKDSSDCMSTLSTAVELLQLLLASDQPPPGDEGLGEAEEPPGEY----RKMSISIGELKKYLNWTPEVQ---PHPLDDLEKLLAEYVKEEESLDGLLDGISGLV-LTLKTEEGGQPQDFAEPV---LPAPKTLKEQFDLRLTCQLGDVDEDKLTLIY--WLSNLAVDDSDQELDMVEEDLEEISQKYCPDFDVKNELRKGKLPSEMDKTKLKRRPNKRRGIDTINTSSLRGRQFVAPMRGRGFG---RGMMS----NRHDPFRSRPPNTSRPPSMHVDDFVKL 2221          

HSP 2 Score: 125.561 bits (314), Expect = 1.201e-24
Identity = 71/213 (33.33%), Postives = 125/213 (58.69%), Query Frame = 1
Query: 1264 DIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIG---------VQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFEL 1875
            ++P+ A RL+++V TY       +WVE MEE+P  LA+GLAYL +  ++    ++++LV W   GL++E A++Q    + +RH+K GI +   +CS + DIA+K+L+       VQ  L+DL  ++ ++  +K+ II+ALD +TRL+ G+D F+G         V+ ++    E+  YQR++  ++ K       R  +A + L+ K H+ E+
Sbjct:  566 ELPEEATRLLDIVQTYRTEEHADKWVEAMEEVPGLLAKGLAYLVWKAENKD--VVDTLVEWTMEGLNLELAIKQPVTAFKIRHLKMGIKLTAALCSTDADIALKLLNQ-----GVQAKLLDLYSSQYMSMSVKILIIKALDDTTRLKEGMDWFLGGSVSQEKPVVKMESGEMPEKGCYQRVLEMMLVKQNI----RTVVAWTSLVRKAHIHEI 767          

HSP 3 Score: 83.9593 bits (206), Expect = 5.159e-12
Identity = 42/128 (32.81%), Postives = 76/128 (59.38%), Query Frame = 1
Query:   52 DENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGIIS 426
            D    +L+FFDTF+H    ++ +D ++F +PV I  +R+IP G  I +++    RLG TNP  F ++ F +N    ++ +FEK+G M++       ++  P+ P+ +  L + G Y+ +S+AVFG ++
Sbjct:    3 DTEEQVLLFFDTFTHDNTEDLNLDLVQFPRPVLINELRVIPLGTKIRADVPGGLRLGATNPSAFKLELFVNNLSKPNAATFEKLGNMDYICTQ--ENVFHPTEPVPTDGLILKGWYSTVSLAVFGSLT 128          
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Match: K1QVA4 (Virilizer-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10013984 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 2.129e-101
Identity = 397/1477 (26.88%), Postives = 662/1477 (44.82%), Query Frame = 1
Query: 1240 DDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNN---EERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELL--INFEVXXXXXXXXXXXXXXXXXXXYEANML-----------------LKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPH--NPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXX-XXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNP--QSLEEMYQSRGVWQRVQGEECRLSEIYREWLG--PVKVTEREPPELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKR------RRRGHDAIIHTGRTSKK-FVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDE 5562
            ++A++   + P  A  +++++  Y   +   +WV  +EELP N  +GL++L   +K T   ++++++ W   GL  E A+ Q E+ + +RH+K G T+ G +C+ + DI ++ L     E +VQ  L+ L+E+  ++  LKLQI+R+LD +T    G+   +G   K  N    E+ T +QR++  ++ K       RV +A   L+ K++ +E+L  +N EV       +   K++          +                 +KE  + F  A  IIA   R++P   ++   + KP   +PYP L   ++S   L  + ++LS    +             L +A   LI   +Q    L   L +   +T  I+K L     D+G  D   +   H      LG+E+   L+ L+CID +  +         L    E  E++ +   L  L  +T   +G   + QV++MD NL  +L L E                           K+  D     +K       S+ + Y  +LL  I+RH+ N   +  YG RL AL ++  +S   E ++WL P + +   +       V HL +  +      D   VP  L+T +R L+Y  ++     P                   ++  + ++YKYA+ E +  D L++   ++Q++S+     WQ GI     +    L V +P   +V    Q LI++R  QFKD+TGL  LF  +TV CS         S+ +  +++ I+  I+DT+L YTQ      E ++A  +SLWT  L+EL+ +T  AP+ +  GL +L E+LPLPLP+     LT+EE S   + R LWS H+ C+ Q+++ +I  +  ++   L  +L R+   +S L  ++A+M+A+  L+ ++  +    +     +E          GET+E                E       S  LN                              +L  +L+ P  K A L+L+ Q     ++     L      I++ + E +   H  +QE +++ +Q L D  V        A+ M E I    QD IA             +LP       I   L  H  + D   ++I   +R LV+L  HDYGF  L  VL+ +      L+ R+N TFS D+ DC  +L T L  L+ L+  +   DE +    P RT  LS   ++++L W  + E    HP+ +L  L++  +E+EE+L+ L + M  L+++L +        +  E      P P  +SL  +Y  R V+   + E+ RL+  Y  WL    + V + E P+L+  D++++    C  FNL +EL +        +   R      RR+  +  I+ GR +K+ FVAPMRGRG            +  R     +R PNTSRPPSMHVDDF KL+K +
Sbjct:  689 ENALDSHRECPPEAKVILSVIDQYLGADHYDKWVIALEELPSNFPKGLSWLLVQEKRTD--VLDTIIDWALEGLDEEKAMNQPESAFKIRHLKMGTTLAGALCTCDPDICIQAL-----EKDVQTKLLSLMESPYMSFSLKLQIVRSLDQTTFFVDGIQWLLGRHVKQLNKAVGEKDTCFQRILTLMLGKQN----IRVIVALKALVKKINAYEVLWKLNTEVKSLMEAASKGGKQEERPDTSTDQEMAPMSVISEVTVDSIISYIKEATKLFRIAPYIIAQSSRSLPGKAMY---SKKPPAIDPYPGLYHTVKSCGTLECVFYLLSSPLTFGHPQ---------LFAAVQDLIRSLLQTLHGL-RFLFSRKDVTNGIIKCLLQ---DDGQDDGEENPIQH------LGVEMVAYLKTLQCIDVIRNF---------LNRAPEKQENSDIIPTLHELYTITTTPQGRQTVIQVVSMDTNLETLLQLVE---------------------------KKGEDDKDKRKK-------SVVVAYTMSLLLMIIRHSTNMGLMETYGPRLVALSEEDFSSKLLEMQEWLLPFKTVTDLTQDGVAAVVGHLKQYTE------DLQKVPRSLITTMRTLRYISIAPENPYP-------------------DEVSEELKYKYALVEMYGLDCLSICTTILQKVSEILLRPWQRGIIQSSEQITYHLSVVKPTLEIVQHTLQYLIKARATQFKDLTGLPVLFELHTVLCS------VPLSSNHMEELQEIQKMILDTLLAYTQPLPTQAETDEALSESLWTKTLKELIKYTTKAPYTYLSGLLILSEMLPLPLPIQTRESLTEEEVSATVNNRKLWSIHLHCLSQQVQEMIQILATSTCQPLQLVLRRVCWQLSDLSAASAIMVARCILDMVVMSFATLRRPPEKKDE----------GETTE-------------EKMERIASPYASKMLN------------------------------LLAYVLSQPSVKCAALQLMTQNSVDSDTSKYGDLLPQMLEILNTVCETNP--HVNSQECIVSIIQSLCDPEV--------ALVMGENI--SIQDQIAY------------ALPNGNYMTQITTALLDHMGSADHSYASILPCVRTLVMLTDHDYGFYYLKSVLEQKTTAIGRLMVRINTTFSKDSSDCLSTLSTLLEFLRLLMTVKQPLDETLT---PPRTYTLSQQELQEVLSWNPSME---NHPLLDLEKLVEESAEDEETLESLYESMTGLMKMLRE-------PEAKEKKVLMEPPPVQESLAYLYSKRAVYVVTEVEDDRLNPEY--WLSNPSLDVADIE-PDLTMADMQDMCRRYCPEFNLEEELKKTVITSQVEVTKPRRIKIGDRRKSQEISIYRGRGAKRPFVAPMRGRGIARGMMGGGGRMDSFR-----TRTPNTSRPPSMHVDDFMKLEKGQ 1960          

HSP 2 Score: 83.9593 bits (206), Expect = 4.084e-12
Identity = 39/129 (30.23%), Postives = 78/129 (60.47%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAH--NHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFG---IISPHSIN 441
            L+FFDTFSH    E+ +D ++F +PV I  +RIIP    +++++    RLG TNP +F+++ + +  N  ++ +FEK+G + + E   +   +   +P   ++ + G YN L++A++G   ++ P +++
Sbjct:   12 LLFFDTFSHENAEELNLDLVQFPRPVLIQEVRIIPLQTKVQADVPGGVRLGATNPSSFSLELYVNNLNRPNAATFEKLGIINYKENVDIQMKTDAEVPTDGLI-LKGWYNTLTVAIYGSMTVVKPETLS 139          

HSP 3 Score: 73.1738 bits (178), Expect = 9.796e-9
Identity = 34/117 (29.06%), Postives = 67/117 (57.26%), Query Frame = 1
Query: 1240 DDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTN 1590
            + A++   + P  A  +++++  Y   +   +WV  +EELP N  +GL++L   +K T   I+++++ W   GL  E A+ Q E+ + +RH+K G T+ G +C+ + DI ++ L  +
Sbjct:  508 EKALDSHRECPPEAKVILSVIDQYLGADHYDKWVIALEELPSNFPKGLSWLLVQEKRTD--ILDTIIDWALEGLDEEKAMNQPESAFKIRHLKMGTTLAGALCTCDPDICIQALDAD 622          
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Match: A0A4D5RPX2 (Putative nuclear membrane protein involved in mrna transport (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 4.515e-75
Identity = 382/1508 (25.33%), Postives = 636/1508 (42.18%), Query Frame = 1
Query: 1264 DIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQR-----------------------KTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINF--------------EVXXXXXXXXXXXXXXXXXXXY---------EANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALR-LIWEFVQHHESLIHLLV---APNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXX----CVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKI-----KLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDNSESEQTLGTIFFSIMSDILEASKE-NHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIAS----------PNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHDELAR----GRQQDDEA----IRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQ 5553
            ++ D   ++++ +S + E   N  WVE +E    NL+       + +KD  +    SL+ WV+ GLS++AAL Q +  Y +RH+K GI M   +     DI  ++L     E  +   L++L     ++ PLKL I+RALD +T  R G+      +                        ++K +E  T YQ L+  L  K +     R ++A + LL KLHL++LL                 EV     +     + ++   +          +A + L  + R +  A   +A P R +P  + F+     P +PYP L  M +  ++L  M  + S               S T  + ALR  +   ++    ++  L    A N +   +L+       +  G     D  YHQ     +G+ + + L+ L+ +D LL + ++ GG+         L+DA++   L  L  +     G A +  V+ M DNL  ++P         L   + +            DT+               L  S+C  Y   LL   V ++D+   L  Y   L  L +  +     E   W++P + LPS +  S+     CV    E+         AA++PP LVT LR+L++  +      P      +SD  +             ++YKY I + F +DGL+    ++Q+IS+ +   +      +  +   ++   +P   ++  +   LI  R  +FKDVT +  L   +T+      +G   +S+  +S    ++  I++T+LTYTQ  L   E E+A +KSLWT M+ E+L +T  AP+ F  GLT+L ELLPLPLPL    PL+ ++  ++ ++R LWSA++  +  +++ ++ T+  ++   +  L  R+   +S L   +A ++A+  L+ L                         +     P    S      D ++    G           IR  + L + A +     KL P S  +         L++  P K A L  +   P           G +F  ++  +  +S E +H  TQE +++ +Q L D  +        A+T  E    G   T A+          P+  +  +++ NS+P   Q   I   L  H        S++  A+R LV+L  HD+GF  +   L+ +P     L+ R++ TF  DN D   +L   L L+  L V ++    P+      R+L L    +  ++ W G K     HP+  L  LL   S EEE+L+ L   + S +E L +      ++   E     +P    L   +  R V+   + +E RLS  +  WL        + PE    DL ++       FNL  EL +    G ++   +    +  ++   G +A+  T  T K F+APMRGRGF        S  N    D FRSRPPNTSRPPSMHVDDF  L+
Sbjct:  327 ELSDDFRKVVDSLSAFAEKEHNERWVEALENATTNLSPDALAELFGNKDL-EAAASSLLDWVEEGLSLKAALSQLQPAYKVRHMKAGIRMATMLFLTGEDIISRLL-----ERQIPGKLLELFMAPYMSLPLKLHILRALDAATYTRAGMQELFATKMLAPPEANVQIDLSLIAEPLDELYESKKSEMLTGYQVLLKLLFLKQS----TRATVALTALLKKLHLYDLLCMLHTSVDKIVQDTDLREVKEKDEEGTERTRLEVETGQAAHCTSEDLDKAAVCLDLLCRTYRKAHKEVAQPLRYLPAQSRFE-APQTPFDPYPALFRMFKENHLLEMMSLLASSPVS----------SSHTGVAFALREFLAVLLKTRPGMLFFLSDHEAANCLHRALLQ-------EESGPVSMEDSVYHQ-----VGVHLVYHLQTLQHVDSLLAYHSK-GGVK------RELDDAEVVTCLHDLYTVLFSDVGRAAVVDVLAMHDNLDALVPFLR------LTGDMDF------------DTR---------------LCKSVCAGYATELLLLTVHNSDSAHLLKNYSDVLYQLSQQEMTPRLQELSAWIEPTRKLPSYTHESVTFLMGCVKKAAET---------AALLPPELVTALRILRHLGLP-----PRDFRSGESDDEEE------------LKYKYVIMQIFANDGLSCFLTILQKISEEYLKPYHGPASLVGQQGAQVVATVKPVVNLLQFMLGYLISCRGTEFKDVTAVPVLLQTFTL------LGMIPASSPLRSLALKVQVEIVETLLTYTQPHLSSAETEEALNKSLWTQMISEVLKYTLRAPYTFVTGLTVLSELLPLPLPLQIREPLSSDDLPKVVNSRKLWSAYLHSLSADIQEIVGTLSYSTCPTVQQLFRRVCIQLSDLAAPSASVVARALLDMLY------------------------SSLAEPPFPGSSPPVPMVDPHRTTIVGDD---------IRGTASLAVPATVLPPVPKLLPSSSTILVLLDQFCFLVSHGPFKVAVLHALKGSP---------KYGELFTYLLGLLNLSSDELSHIHTQECILSVVQALCDPDI--------ALTPIEENLSGMSTTQANESAKGSAEEKPDLAVLLKKLANSVPPKEQLQAICSTLVHHIGTASHSYSSVLLAVRVLVMLTEHDFGFFCIKTALEREPESLCLLLDRLSATFDKDNADSLSTLSACLELMWLLCVPEEEG--PLGQ---LRSLRLGPGELASLINWKG-KTHLECHPLLRLEKLLGECSREEEALESLLASIASQLEYLGRA----ASSSDREMLEPMLPAQDGLSAQFGLRTVYLLGEIDEERLSPSF--WLAAAVDDSEQEPEQVEVDLASMMERTLPDFNLKSELEKLILSGEEETGSSKSPLVNKRKLMLGAEAMEPT--TKKPFIAPMRGRGFSRGGMGHTSRAN----DPFRSRPPNTSRPPSMHVDDFLALE 1661          
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Match: A0A5J4NHX8 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0014307 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.211e-74
Identity = 299/969 (30.86%), Postives = 466/969 (48.09%), Query Frame = 1
Query: 3025 VPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQC------------GIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTS---XXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHN--EYVQSLKAAETGETSEPSNKESTSKQSEDTNKENT-------------GGTGISNSLNQTL--IRADSF-------LGID---AKIKL-----YPDSLELTRTWAMLKLLLNVPPCK--------HAFLKLIGQKPYQDNSESEQTLGTIFFSIMSDILEASKEN--HTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQP------GMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQ------------DNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIP-GNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYRE-----WLGPVKVTEREP------------PELSRCDLENLAYVCCNGFNLHDELAR-GRQQD--DEAIRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVS----------------------TNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDEKLDEE 5577
            +PP L+T+LRL++  + ++            S +       P  Q V  +R   ++ E +  +GL  L  LIQ++SD+  L  Q             GI   ++   L++ + E    +V  +   ++  + ++F+D+T + PL   YT  C   A+         + Q+E +R ++++ +L Y  + +    + K   KSLW  + RE++ FT SAP  +  GL LL++LLPLPLP+   + LT+    +I+SAR  W+ HVL +  E  GL+  +G T+   N  L + L +LL  ++ LG S A  LA   L++L  VWD   +E+          S+ A +  E S P N+  ++K   D     +               +G  ++++ T+   R D+        +G D   AK+ +       DS ELT   A+L   L VP C+         +     G     D S +  T    F  I  +IL A  +   H  +Q  ++ CL L+ D           A    E+ F    DT     R L    + N+LP       +V  L  H  +PD+DM+T+P AL PL++L  HD+GF ++  VLD+          F ++++RVN+ FS +NPDCQ +L + L LLQ+LVV +            D +DE  Q     R L++S + V+ +L W  +K+ +   PV +LH LL++++++E SL+ LR GM++L+ LLS+   +P   +D  E ++  +P P SLE ++ SR  +  +        + Y +     W      +   P            P L  C+L  LA  CCNG  + +EL + GRQ+D  + AIRH++RRRG  +II TGR+SKKFVAPMRGRGF +R     S                         G+R D FRSRP NTSRPPS+HVDDF KL KD+ + E+
Sbjct:  951 IPPALLTLLRLIRSHVCNQ------------SGTMVGLIPRPEQQVV--LRRSLSLIELYSANGLCELTSLIQKLSDYFVLQCQTTISQTACALDLIGITTANSNTSLVVSMLEAGVHIVTQLLTTILHVQGDEFRDLTPVRPLCLAYT--CGVYAVSPL---GPKRKQLERLRSAVVNGLLAYLNADIGTALSIKEIAKSLWVSVCREVITFTISAPAYYLPGLKLLLDLLPLPLPIFNANSLTEANQQRIRSARDRWAIHVLALAPEFTGLVELLGGTNPDPNNLLYSNLLQLLRRLADLGLSCATFLATACLDSLFVVWDELFEELRKKPIPPDRGSVDAGDVMEKSLPPNRSDSAKSLADDASSISVPLRTPSARLLLHSASGSDSAIDVTVSSCRGDAVERSVQDAVGSDSSNAKVLVDCFSDLDDSSELTSALALLHANLQVPACRSEPSGASCRSSKSADGSSAKGDQSNAS-TRKRRFLFIAENILSACSDKVCHLRSQLVLLKCLALMFDIESA------SACFESESNFGPTNDTANVEARQL---RLANNLPDANCSEGLVHILITHLSHPDRDMATLPSALCPLLLLTQHDHGFLLVKNVLDNCAVQTNGQHFFANMVQRVNDCFSIENPDCQATLASCLRLLQSLVVGRSTLPLTFSNDAADCADES-QADTAQRCLHISGARVRDLLGW--SKDGDEGKPVRDLHALLEMLTDDEPSLEYLRSGMKNLLSLLSEEFDVPECQSDTREYSS--LPQPSSLEVLFASRPYFVPLVDLTAESEKAYEQLLKVRWCLRTSFSATSPEFSEVIPKSSTTPSLVTCNLAELASGCCNGLRIREELVKCGRQRDSAEAAIRHQKRRRGQSSIIETGRSSKKFVAPMRGRGFILRGVPTQSGGQSLSSAGSGLGGLGSGTSLIGGTGNRVDPFRSRPLNTSRPPSLHVDDFTKLVKDDTVVED 1885          

HSP 2 Score: 114.005 bits (284), Expect = 3.192e-21
Identity = 87/274 (31.75%), Postives = 140/274 (51.09%), Query Frame = 1
Query:  976 FPDLDKRLMTERWRFLPKRIVSQ---GQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYK------EHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLV---STYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYIC-SLNTDIAMKVLSTNPSEI----------NVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIG 1728
            F   D RL    WRF P  + ++   G L   L++ P+   TLF++    L REER    +   K      +H++  +      +  +T++++S       +       SA  L+ +    +T     L  EWV+ +E L  +LA GLAYL + D+ +   + E+LV WV  GL + AAL+QS + YI+RH+  G+ + G +  +L   IA  +L      +           VQH L++LLE+ ++ TPL+L + RALD +TRL +GLD+F+G
Sbjct:   21 FTQDDPRLARCYWRFNPWSMAAKCATGSLAERLRI-PDPTMTLFQLHCWLLEREERIVATEPDVKVAASDADHTIDGV------DVDDTVTDESARLPPPPDDWTTAAASAQYLLTITLKFTTDPNKLLTEEWVDAVEGLESHLAPGLAYLYHTDRQSLQSVTEALVVWVYTGLDLSAALRQSNSAYIVRHLLAGVRLTGLVTGTLFPRIAWSLLYPGAHSLASDGAQFEVFQVQHLLLNLLESPLVTTPLRLAVCRALDRTTRLVVGLDAFLG 287          

HSP 3 Score: 113.62 bits (283), Expect = 4.076e-21
Identity = 122/469 (26.01%), Postives = 206/469 (43.92%), Query Frame = 1
Query: 1741 TKNNE------ERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINF-EVXXXXXXXXXXXXXXXXXXXYEANML--LKEIIRYFIHAKDIIANP-RRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKT---------------------------LTSAALRLIWEFVQHHESLIHLLVAPNGITTTIL-------KRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGL----------AENSELLEDAQLAGILLGLAKLTGERRGA-----------------------AWIAQVITMDDNLAPILPLFEAL-EKKTLAAMIHWYEYINPDDLPE----SDTKQESDSAITNEKT---------RVPLPHSICLHYLPNLLT-AIVRHADNPTYLGKYGSRLAAL 2871
            +KN+E       RTPYQRL++  I     +  +R++ A  RLLNKLH +E+L+ F +++           +  + L  E  ++  L++I     HA++IIANP   T+PC  +  +     H+PYP+L  M++ T  L    W++ Q   +  +D+   +Q+K                            + S+ + LI  F+    +L  LL +  G T+ +L        R+  + P+    +   D +        LGLE+A+KLE LR +D L+ W+ +  G++G+          +E+  +  +  L   L G+A+L     G+                        W+A+VI+MDD+ AP L L EA   +++  ++ H        D+      ++T   S  A T + T         R  L + I    L N L   ++RH++N  YL +YG RLA L
Sbjct:  375 SKNDEPSDQSTRRTPYQRLLFLFI----ASKHSRITSAYQRLLNKLHFYEMLLEFRDLMNQLRFNAQSGPRVGMSLSIEQKVVYYLRQISNLLRHAEEIIANPLPTTLPCPMLLGEDKKSAHDPYPDLCSMLDHTGFLDDFAWLIDQ---FQSSDESSSLQAKPEENLPPLASPCGTRLPSDSVSLRNSEPVWSSIVELISSFLSEVSTLT-LLASRPGPTSKMLVSLLKSASRITSMKPNQIAAEWQVDTTEMMLL---LGLELAYKLETLRYLDVLINWTRKQ-GVTGIFSVVAQLLSFSEDDPIQSEPLLRDTLFGIARLCVSSTGSIQFGDLNSTAQDTVKTILNTSAPIWVAEVISMDDHFAPFLMLLEAFCTQESQGSLPHSKSSDKLRDVDSVKKGTNTSDSSTLATTTDATPSSGLRATLRQILLNPIDPSSLVNFLVLTVLRHSENVAYLDRYGPRLAQL 831          
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Match: A0A4D5RR36 (Putative nuclear membrane protein involved in mrna transport (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.994e-74
Identity = 381/1508 (25.27%), Postives = 635/1508 (42.11%), Query Frame = 1
Query: 1264 DIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQR-----------------------KTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINF--------------EVXXXXXXXXXXXXXXXXXXXY---------EANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALR-LIWEFVQHHESLIHLLV---APNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXX----CVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKI-----KLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQKPYQDNSESEQTLGTIFFSIMSDILEASKE-NHTATQENMIACLQLLLDARVTMLSVVPEAITMDEAIFEGCQDTIAS----------PNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHDELAR----GRQQDDEA----IRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQ 5553
            ++ D   ++++ +S + E   N  WVE +E    NL+       + +KD  +    SL+ WV+ GLS++AAL Q +  Y +RH+K GI M   +     DI  ++L     E  +   L++L     ++ PLKL I+RALD +T  R G+      +                        ++K +E  T YQ L+  L  K +     R ++A + LL KLHL++LL                 EV     +     + ++   +          +A + L  + R +  A   +A P R +P  + F+     P +PYP L  M +  ++L  M  + S               S T  + ALR  +   ++    ++  L    A N +   +L+       +  G     D  YHQ     +G+ + + L+ L+ +D LL + ++ GG+         L+DA++   L  L  +     G A +  V+ M DNL  ++P         L   + +            DT+               L  S+C  Y   LL   V ++D+   L  Y   L  L +  +     E   W++P + LPS +  S+     CV    E+         AA++PP LVT LR+L++  +      P      +SD  +             ++YKY I + F +DGL+    ++Q+IS+ +   +      +  +   ++   +P   ++  +   LI  R  +FKDVT +  L   +T+      +G   +S+  +S    ++  I++T+LTYTQ  L   E E+A +KSLWT M+ E+L +T  AP+ F  GLT+L ELLPLPLPL    PL+ ++  ++ ++R LWSA++  +  +++ ++ T+  ++   +  L  R+   +S L   +A ++A+  L+ L                         +     P    S      D ++    G           IR  + L + A +     KL P S  +         L++  P K A L  +   P           G +   ++  +  +S E +H  TQE +++ +Q L D  +        A+T  E    G   T A+          P+  +  +++ NS+P   Q   I   L  H        S++  A+R LV+L  HD+GF  +   L+ +P     L+ R++ TF  DN D   +L   L L+  L V ++    P+      R+L L    +  ++ W G K     HP+  L  LL   S EEE+L+ L   + S +E L +      ++   E     +P    L   +  R V+   + +E RLS  +  WL        + PE    DL ++       FNL  EL +    G ++   +    +  ++   G +A+  T  T K F+APMRGRGF        S  N    D FRSRPPNTSRPPSMHVDDF  L+
Sbjct:  328 ELSDDFRKVVDSLSAFAEKEHNERWVEALENATTNLSPDALAELFGNKDL-EAAASSLLDWVEEGLSLKAALSQLQPAYKVRHMKAGIRMATMLFLTGEDIISRLL-----ERQIPGKLLELFMAPYMSLPLKLHILRALDAATYTRAGMQELFATKMLAPPEANVQIDLSLIAEPLDELYESKKSEMLTGYQVLLKLLFLKQS----TRATVALTALLKKLHLYDLLCMLHTSVDKIVQDTDLREVKEKDEEGTERTRLEVETGQAAHCTSEDLDKAAVCLDLLCRTYRKAHKEVAQPLRYLPAQSRFE-APQTPFDPYPALFRMFKENHLLEMMSLLASSPVS----------SSHTGVAFALREFLAVLLKTRPGMLFFLSDHEAANCLHRALLQ-------EESGPVSMEDSVYHQ-----VGVHLVYHLQTLQHVDSLLAYHSK-GGVK------RELDDAEVVTCLHDLYTVLFSDVGRAAVVDVLAMHDNLDALVPFLR------LTGDMDF------------DTR---------------LCKSVCAGYATELLLLTVHNSDSAHLLKNYSDVLYQLSQQEMTPRLQELSAWIEPTRKLPSYTHESVTFLMGCVKKAAET---------AALLPPELVTALRILRHLGLP-----PRDFRSGESDDEEE------------LKYKYVIMQIFANDGLSCFLTILQKISEEYLKPYHGPASLVGQQGAQVVATVKPVVNLLQFMLGYLISCRGTEFKDVTAVPVLLQTFTL------LGMIPASSPLRSLALKVQVEIVETLLTYTQPHLSSAETEEALNKSLWTQMISEVLKYTLRAPYTFVTGLTVLSELLPLPLPLQIREPLSSDDLPKVVNSRKLWSAYLHSLSADIQEIVGTLSYSTCPTVQQLFRRVCIQLSDLAAPSASVVARALLDMLY------------------------SSLAEPPFPGSSPPVPMVDPHRTTIVGDD---------IRGTASLAVPATVLPPVPKLLPSSSTILVLLDQFCFLVSHGPFKVAVLHALKGSP---------KYGELLTYLLGLLNLSSDELSHIHTQECILSVVQALCDPDI--------ALTPIEENLSGMSTTQANESAKGSAEEKPDLAVLLKKLANSVPPKEQLQAICSTLVHHIGTASHSYSSVLLAVRVLVMLTEHDFGFFCIKTALEREPDSLCLLLDRLSATFDKDNADSLSTLSACLELMWLLCVPEEEG--PLGQ---LRSLRLGPGELASLINWKG-KTHLECHPLLRLEKLLGECSREEEALESLLASIASQLEYLGRA----ASSSDREMLEPMLPAQDGLSAQFGLRTVYLLGEIDEERLSPSF--WLAAAVDDSEQEPEQVEVDLASMMERTLPDFNLKSELEKLILSGEEETGSSKSPLVNKRKLMLGAEAMEPT--TKKPFIAPMRGRGFSRGGMGHTSRAN----DPFRSRPPNTSRPPSMHVDDFLALE 1662          
BLAST of Protein virilizer isoform 1 vs. Ensembl Cavefish
Match: virma (vir like m6A methyltransferase associated [Source:ZFIN;Acc:ZDB-GENE-100922-238])

HSP 1 Score: 80.1073 bits (196), Expect = 2.405e-14
Identity = 59/211 (27.96%), Postives = 109/211 (51.66%), Query Frame = 1
Query: 1273 DSADRLINLVSTYGE---TNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTP-YQRLV-YFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFE 1890
            +SA +L  L+  +GE    +  + WV  +EE+P  L +GL+ L   D++  +  ++ LV W    L++++AL Q   +  LR +K G  +   +    T     +L     E  +   L++LL    +++ LKL ++R+LD       G+++ +   R+ + +  RT  YQRL+  FL+D+     T RV+ A + +L K H +E+L + +
Sbjct:  233 ESAAKLSELLEAWGEGSEADRGAGWVTALEEIPSLLVKGLSLLAVKDREGQNVQLKLLVDWTSEALNLDSALSQPIALN-LRQLKAGAKLASSLADCGTQAVQVLL-----EKGIVGRLLELLFADHVSSTLKLSVLRSLDSIISEPQGMETLL---REGQQDSNRTSGYQRLLELFLLDQ-----TVRVATAGAAILQKGHFYEVLTDLQ 429          

HSP 2 Score: 68.1662 bits (165), Expect = 1.134e-10
Identity = 41/126 (32.54%), Postives = 62/126 (49.21%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPL-ASMLAISGCYNMLSIAVFGIIS-PHS 435
            L+F DTF H       VD +RF   V I  +R+IP GI   S +      G T P  F +  F +N     +P F+++G +E+DE   +  +  P+  +    L + G Y  L++AV+G    PHS
Sbjct:    9 LLFLDTFKHQSAELTNVDVVRFPYGVLITEVRVIPPGIKAHSNLPDSRAFGETAPHAFQLDLFFNNVSKPSAPVFDRLGSLEYDENKSI--VFRPNGKINTDGLVLRGWYTCLTLAVYGTAERPHS 132          
BLAST of Protein virilizer isoform 1 vs. Ensembl Nematostella
Match: EDO41955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2V5])

HSP 1 Score: 95.1301 bits (235), Expect = 2.642e-19
Identity = 145/644 (22.52%), Postives = 270/644 (41.93%), Query Frame = 1
Query: 1969 LKEIIRYFIHAKDIIANPR-RTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALR-LIWEFVQHHESLIHLLVAP---NGITTTILKR------------LFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGER---RGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALG-KDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAA-IVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYP-LLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTS 3831
            L EI      A ++IA P  +  P +     +     +PYP L  +  +  +L S+  +++             +    L    +R L++  +Q    L+ L   P   NG+   + +             L     D    D  + Q         LGL + + L+ L+ +D+L      S  +  + ++++ L        +   A   G+     G A +  V+++  NL  +LP  E                          T  ++D A         L   +   Y   L+   V+ ++N   L + G RL A+  K    S  AE   W+ PL+DL   +      + +L E +K +   ++ +  V  G++  LR+L++       +R         D T+      ++Q    +++     + F  +G+ +   L+Q++ +     W+ G +P     P +++C+A P   ++ ++   L+ +   QFKD   +  L   +TV CS    G      +  S  + I+ SI+D  +T+T+  +   ++E+A  +S+W+ MLRELL +  S P AF GGL LL ELLP+PLP+     L  E+ +Q  + R LWSAH+  +  +L+ ++ ++  ++
Sbjct:  754 LDEICNILKRANELIAQPPIKAFPTTAKITGLESSTKDPYPVLFRLFATRRLLESIVVLMASP-----------VGCHPLVYCCIRDLVFYLLQSQRGLLFLSSHPEAVNGLIRVLTQTTEADIHHSEAPPLNEFLRDGSTADLCTPQH--------LGLLLIYHLQTLQAVDQLRSSPLPSHSVCDI-DSADTLSTLHTLYSMTFSAIGKGDLFYIDGKAAVVSVLSLSKNLESLLPFVEP-------------------------TGNQADDA--------KLKKCVSSRYASVLIFLTVKVSENVDMLSELGPRLLAITQKQEAESSLAELNHWVAPLKDLKFDASD----IPNLVEYVKSSLDSINTSQRVSCGVLVALRVLRHLACPPKQDR---------DKTE------VHQ--KNLKWNLKCMQLFAANGMDIFITLLQKLGESLLRPWRLG-QPFSTGQPFIMICMATPLLVLLKSMLGELLDTGTYQFKDRRLMTSLMVLHTVMCSAPMTG------QLSSIAQQIQGSIVDLFMTFTRPVVQSSDHEEAIKESVWSLMLRELLKYITSTPQAFLGGLVLLSELLPVPLPMHTLEELPPEDVTQAMNHRLLWSAHLNPLSSDLQEILKSLAGSA 1316          

HSP 2 Score: 82.4185 bits (202), Expect = 2.013e-15
Identity = 65/222 (29.28%), Postives = 110/222 (49.55%), Query Frame = 1
Query: 1261 EDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQ--SENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIG--VQRKTKNN--------EERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFE 1890
            E + +  ++LI         + N +WVE  EE+P  +  GLA +    +D+ D +I  LV W    L ME A++Q  + NM +L   K G+     +CS +  IA  +++       VQ  L  L+  + +++ LKL   +A D  T   +GL++F+G    ++T+++        +    YQ+LV FL+     + T RV  A S L  K+H++ELL   +
Sbjct:  478 EKMKEVGEKLIEQFELCKTLDKNIKWVEAFEEIPPLIVPGLACVIKTKEDS-DVVITKLVEWSMYALDMEEAMKQPIAVNMRLL---KAGLRTVNALCSCSPQIAALLINAG-----VQGRLHTLITTEHVSSSLKLLTFQAFDSCTDSNVGLENFLGWSSAKETEDDNGTDDGAQKSTNGYQKLVDFLL----TDQTVRVMEAASILARKIHVYELLTALQ 686          

HSP 3 Score: 74.3294 bits (181), Expect = 5.877e-13
Identity = 44/150 (29.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:   67 MLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHN--HADSPSFEKIGEMEFDERNGVNSISFPSMPLAS-MLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPP 507
            +L+F DTFSH    EM +D I F +PV +   R+IP G  + + I    ++G T+PQ+F +  F  N  +A +  FE++G +++ E N    I+   +  A+ ++ + G YN ++I+++G  +  +      P  +P    P   M   P
Sbjct:   14 ILLFCDTFSHQENEEMHLDLISFPRPVAVTEARVIPAGHRVHAAISEREKVGETHPQSFKLDMFIRNLDNAGAVVFERLGLLDYKEPNNFQVIA--EIKAATDVVVLRGWYNKITISLYGYFTDVNRASPAEPRQEPRLDRPSVIMDPRP 161          
BLAST of Protein virilizer isoform 1 vs. Ensembl Medaka
Match: virma (vir like m6A methyltransferase associated [Source:NCBI gene;Acc:101168735])

HSP 1 Score: 77.0258 bits (188), Expect = 2.184e-13
Identity = 89/374 (23.80%), Postives = 158/374 (42.25%), Query Frame = 1
Query: 1288 LINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANM-----------------LLKEIIRYFIHAK-DIIANPRRTMPCSTIFDDVTHKPH--NPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHES-LIHLLVAPNGITTTILKRLFGLSPDNGGTD 2346
            L  L++  GE + ++ WV  +EE P  L +GLAYL   ++  A+  +++LV W    L +E AL Q   +  LR +K G  +    C       + +L            L++LL    +++ LKL I+R LD       G+++F+        + E++ YQRLV   + +     T RV  A + +L K H++E+L++ +       +   +  +  +   E                    +L+E+      A   ++  P +  P S     +T  P   NPYP L   M + + L S   +LS +           +      + A++ +  F+   +S L+ LL  P+   T +L RL     ++ G D
Sbjct:  364 LKELLADIGE-DRDARWVTALEEAPGLLNKGLAYLIKQEQGDAEEPLKALVQWALQALDLEIALTQPIALN-LRQLKAGAKL--VSCLAGCPHGLTILLRE----GTLKVLLELLHADHVSSTLKLSILRTLDGLISCPAGVEAFLHA-----GDSEKSGYQRLVQLFLREE----TVRVITAGNAVLQKSHVYEVLVDLQQSAAAWSETQQEDMEDAECPMEEETPLGSSPVSEAELDRIAGVLEELHHLLESASHSMVQPPGKAFPTSA---RITGPPERDNPYPTLYRYMHACHFLESTTLVLSAAA----------VAGHVGVTQAVKELLRFLSLTQSGLLFLLAQPS--PTNLLLRLLASVAESEGED 705          

HSP 2 Score: 73.9442 bits (180), Expect = 2.000e-12
Identity = 99/375 (26.40%), Postives = 165/375 (44.00%), Query Frame = 1
Query: 4471 EGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVK-----QDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPP-ELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRG-------HDAIIHTGRTSKKFVAPMRGRGF-----GVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDF 5541
            EGC   +      L  +E+++S+   T  L ++G       N +  +  +   +R L  L  H+YG   L   L        SL+KR+  +FS D+ D   +LL  L  +           Q +S+EPV  H       +S S +K +LQW    E + +HP++ L  LL  + +E++S++ +   +E++I +L +   +  +T  +  T   +P P++L   +  R V+   +  + +L  +   W  P +  + E   ++ + DL  LA  CC   +L  EL R    +  +  H +  +G       H+  I T      +V P +         G         N    +D FR R  NTSRPPSMHVDDF
Sbjct: 1273 EGCMAEVELLANALPGREMMSSV--CTSLLEVLG-------NKESSVPLLLTCIRTLTFLTEHNYGIYHLKVALKKHSSEVFSLLKRLISSFSKDSADLLSALLDFLRQIVNTETMCVEEGQGSSEEPVFVH----PRLMSPSEMKALLQW----EESESHPISSLEKLLTKLCKEDDSMETM---LENVI-VLRQTLEVASDTAPVVETEPILPPPETLAAQFNHRTVFILSEALDEQLKAL---WFSPFQTDDIETDLDMVKVDLVALAQECCPELDLKAELERSFLSEPSSPGHTKATKGFRLGKHKHETFI-TSSGKSDYVEPAKRAHIMPAPRGRGGRGGFGQNMSRPHDIFRLRKQNTSRPPSMHVDDF 1622          

HSP 3 Score: 67.3958 bits (163), Expect = 1.621e-10
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query:   70 LVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHA--DSPSFEKIGEMEFDERNGVNSISF-PSMPL-ASMLAISGCYNMLSIAVFG 417
            L+F +TF H       VD +RF   V I  +R+IP GI   S +      G T+P  F ++ F +N A  + P+F ++G +E+DE     SI F PS  +  + L + G Y  L++AV+G
Sbjct:    9 LLFLETFKHQNAELTNVDVVRFPCGVLITEVRVIPPGIKAHSNLPDSRAFGETSPHAFQLELFFNNVAKPNGPTFHRLGSLEYDEN---KSIVFRPSGKVNTNGLVLRGWYTSLTLAVYG 125          
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Match: SMESG000074456.1 (SMESG000074456.1)

HSP 1 Score: 2660.94 bits (6896), Expect = 0.000e+0
Identity = 1372/1389 (98.78%), Postives = 1375/1389 (98.99%), Query Frame = 1
Query:  103 KPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK 4269
            K  MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRH+KGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCST+FDD THKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA           DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQ+EDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK
Sbjct:  147 KRPMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHLKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTLFDDATHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA-----------DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQNEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK 1524          
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Match: SMESG000074577.1 (SMESG000074577.1)

HSP 1 Score: 2593.15 bits (6720), Expect = 0.000e+0
Identity = 1335/1346 (99.18%), Postives = 1335/1346 (99.18%), Query Frame = 1
Query:   49 MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG 4086
            MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA           DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG
Sbjct:    1 MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA-----------DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG 1335          
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Match: SMESG000074577.1 (SMESG000074577.1)

HSP 1 Score: 2519.96 bits (6530), Expect = 0.000e+0
Identity = 1304/1325 (98.42%), Postives = 1304/1325 (98.42%), Query Frame = 1
Query:  112 MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGXXXXXXXXXXXXXXXXXXXXTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG 4086
            MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMK          VQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA           DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG
Sbjct:    1 MQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMK----------VQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA-----------DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFAFAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTG 1304          
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Match: SMESG000074456.1 (SMESG000074456.1)

HSP 1 Score: 2276.13 bits (5897), Expect = 0.000e+0
Identity = 1139/1156 (98.53%), Postives = 1143/1156 (98.88%), Query Frame = 1
Query:   49 MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVXXXXXXXXXXXXXXXXXXXYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWXXXXXXXXXXXXXXXXCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIRHS 3516
            MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRH+KGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCST+FDD THKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA           DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESI+ +
Sbjct:    1 MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESEIDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFPSMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMTAPPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLMSLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGEIQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTATSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLFEVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDAINIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTYADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHLKGGITMGGYICSLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTRLRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRLLNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIHAKDIIANPRRTMPCSTLFDDATHKPHNPYPNLLCMMESTNILSSMDWILSQSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTTILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLVWSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMDDNLAPILPLFEALEKKTLA-----------DDLPESDTKQESDSAITNEKTRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPFAEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTVLRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINEFFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMVCAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQIESIQSA 1145          

HSP 2 Score: 326.635 bits (836), Expect = 3.675e-91
Identity = 175/176 (99.43%), Postives = 176/176 (100.00%), Query Frame = 1
Query: 3742 IQSARTLWSAHVLCVRQELKGLIHTIGCTSXXXXXXXXXXXXXXISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK 4269
            IQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQ+EDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK
Sbjct: 1142 IQSARTLWSAHVLCVRQELKGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWDRACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQNEDTNKENTGGTGISNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAFLKLIGQK 1317          
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Match: SMESG000074445.1 (SMESG000074445.1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 444/445 (99.78%), Postives = 445/445 (100.00%), Query Frame = 1
Query: 4423 MLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCXXXXXXXXXXXXXXXVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDXXXXXXXXXXXXXXMHVDDFQKLQKDEKLDEEIMIXXXXXXXXXXXXXXXXXINHGSRTFNSIQKGNSTGDQSRMXXXXXXXXXXXRNRQMK 5757
            MLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCQVSLLTALSLLQALVVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDSFRSRPPNTSRPPSMHVDDFQKLQKDEKLDEEIMIRERNLRNLRGGRSGLRNINHGSRTFNSIQKGNS+GDQSRMPPPSSSSSSSSRNRQMK
Sbjct:    1 MLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTNTQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDHQPGMFLSLIKRVNETFSADNPDCQVSLLTALSLLQALVVKQDNSDEPVQYHLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQRVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHDELARGRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNTLVSTNNGDRYDSFRSRPPNTSRPPSMHVDDFQKLQKDEKLDEEIMIRERNLRNLRGGRSGLRNINHGSRTFNSIQKGNSSGDQSRMPPPSSSSSSSSRNRQMK 445          
The following BLAST results are available for this feature:
BLAST of Protein virilizer isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
VIRMA1.532e-1028.71vir like m6A methyltransferase associated [Source:... [more]
VIRMA2.211e-1028.71vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vir5.263e-1529.77gene:FBgn0003977 transcript:FBtr0072037[more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
virma8.114e-1527.07vir like m6A methyltransferase associated [Source:... [more]
virma1.628e-1327.05vir like m6A methyltransferase associated [Source:... [more]
virma4.810e-1031.78vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIRMA3.631e-1224.47vir like m6A methyltransferase associated [Source:... [more]
VIRMA4.408e-1224.89vir like m6A methyltransferase associated [Source:... [more]
VIRMA4.628e-1224.89vir like m6A methyltransferase associated [Source:... [more]
VIRMA7.235e-1224.58vir like m6A methyltransferase associated [Source:... [more]
VIRMA6.484e-925.76vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Virma5.576e-1324.44vir like m6A methyltransferase associated [Source:... [more]
Virma7.635e-1324.44vir like m6A methyltransferase associated [Source:... [more]
Virma5.472e-1228.71vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q291E4|VIR_DROPS5.272e-1431.82Protein virilizer OS=Drosophila pseudoobscura pseu... [more]
sp|Q9W1R5|VIR_DROME5.276e-1429.77Protein virilizer OS=Drosophila melanogaster OX=72... [more]
sp|A2AIV2|VIR_MOUSE5.341e-1224.44Protein virilizer homolog OS=Mus musculus OX=10090... [more]
sp|Q69YN4|VIR_HUMAN7.355e-1028.71Protein virilizer homolog OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MLZ51.694e-11127.88protein virilizer homolog OS=Lingula unguis OX=757... [more]
K1QVA42.129e-10126.88Virilizer-like protein OS=Crassostrea gigas OX=291... [more]
A0A4D5RPX24.515e-7525.33Putative nuclear membrane protein involved in mrna... [more]
A0A5J4NHX82.211e-7430.86Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
A0A4D5RR364.994e-7425.27Putative nuclear membrane protein involved in mrna... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
virma2.405e-1427.96vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419552.642e-1922.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
virma2.184e-1323.80vir like m6A methyltransferase associated [Source:... [more]
back to top
BLAST of Protein virilizer isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074456.10.000e+098.78SMESG000074456.1[more]
SMESG000074577.10.000e+099.18SMESG000074577.1[more]
SMESG000074577.10.000e+098.42SMESG000074577.1[more]
SMESG000074456.13.675e-9198.53SMESG000074456.1[more]
SMESG000074445.10.000e+099.78SMESG000074445.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032777 ID=SMED30032777|Name=Protein virilizer isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5780bp
ATTTGAAAGAATTTTCAAAATTTGAAATTATTATTTTTAGTTTATCAAAT
GGATGAAAATAATTATATGCTTGTCTTTTTTGACACTTTTAGTCATGGAA
TAAAACCTGAAATGCAAGTAGATTCCATTAGATTTTCTCAACCAGTTAAA
ATAGGCCTGATTCGAATTATTCCATTCGGTATTGCTATAGAAAGTGAAAT
AGATTCAGAAGCTCGTTTAGGAGTCACAAACCCACAGAATTTCAATGTGA
AGTTTTTTGCTCACAATCATGCTGATTCACCGTCATTTGAAAAAATCGGC
GAAATGGAATTTGATGAAAGAAATGGTGTGAATAGTATTTCTTTTCCATC
AATGCCACTTGCGTCAATGCTAGCTATAAGTGGATGCTACAATATGCTAT
CAATAGCGGTTTTTGGAATAATTTCTCCGCATTCTATAAATCCTATTAAA
AATCCATTAAATCAACCTGGTCAAACATTACCGTTATTTACAATGACTGC
TCCCCCTGGTTATGGAAGTAATCCTTTAGGAATGAGAGCTATTCTGGGAC
AATCAAATGCCTTGAATTTGGGATCATTGAATACTCAAATGCAATCCCAA
CCATTAAACACAGGACCGACTAATCAGGCAGCTACAAATATGCTGATGTC
ACTGGCAATAGCTGCCGGCCAACAAGCAACTATTGATTCACAACTAGCAA
ACATTTCACAGTCTAATGATGGGTCGCAAATCAAAGAGGATCAGCACGAT
GATCTTGTAAAGTCCGATCAAACTTTGGGCCTCTATGAAGATGGAGAAAT
ACAGGAAATAGATTATGAGGACGTTTCCAGCAATGAGGATTTATTGTTTG
GCATGGATGACGATGCCGACTACGTCACAATGGAAAGTGAACAGATGATC
AAAGAAGGAGAAGTAGCAATACAGAGCGTCATAAATGGAACAACGGCAAC
ATCTATAAAAAAAATCAGCACAGGATTTCCAGATCTTGATAAACGTTTAA
TGACAGAAAGATGGCGTTTTCTACCTAAACGAATCGTGAGCCAAGGCCAA
CTTATTTCCGAATTAAAAGTTTTACCAAATTCATGCAAAACGTTATTTGA
GGTTGAATTGGATAGATTATGTCGCGAAGAAAGAGAATCTAATGGAAAAA
GATTTTATAAAGAACATTCATTAACTGAAATTTCAAATAATATCAAAAAA
GAAGCATTTGAAACCCTAAGTGAGAAAAGTGGCACTCAAGATGATGCGAT
AAATATCGTTGAGGATATTCCAGATTCGGCCGATCGCCTTATTAATCTTG
TATCTACATACGGGGAGACAAATTTAAATTCAGAGTGGGTAGAAGACATG
GAGGAATTACCGAAAAATTTAGCTCAGGGATTGGCGTATTTAACATACGC
AGACAAAGACACTGCTGACTATATAATAGAGTCTTTGGTAACTTGGGTAA
AGGTTGGATTAAGCATGGAAGCAGCTCTACAACAATCAGAAAACATGTAC
ATTCTACGTCACATCAAAGGGGGAATAACTATGGGAGGATATATATGTTC
TCTCAATACAGATATAGCAATGAAGGTATTATCTACCAATCCATCTGAAA
TCAATGTTCAACATTCATTAATAGATTTACTTGAAAACAAAATGATTGCA
ACTCCATTGAAATTGCAAATTATTAGGGCTTTAGATTTATCAACCCGTCT
CAGAATTGGACTAGACAGTTTCATTGGAGTGCAACGTAAAACCAAAAATA
ACGAAGAAAGAACTCCATATCAGCGTTTAGTTTATTTCTTAATTGACAAA
AACACTTATAATTACACTGCTAGAGTTAGTATGGCCTGTTCACGGTTGTT
AAATAAACTCCATCTTTTTGAACTTCTCATCAATTTCGAAGTGATCATTA
ACAAATTAAAGAAAAACATTATCGATAAGAAGGATATGATAAAATTAAAA
TATGAAGCAAATATGTTGCTAAAGGAAATTATTCGCTATTTCATTCATGC
AAAGGATATTATTGCTAATCCAAGGCGAACCATGCCTTGTTCTACGATTT
TTGACGATGTGACTCATAAACCGCACAATCCTTATCCGAATTTACTCTGT
ATGATGGAATCAACAAACATTTTGTCTAGTATGGATTGGATTCTTTCGCA
ATCAACTTATTATACTGAGACTGATGACCAAGATGAAATCCAATCGAAAA
CTCTTACATCTGCAGCCTTAAGATTGATCTGGGAGTTTGTACAGCATCAT
GAAAGCTTGATCCATTTACTAGTTGCTCCAAATGGTATTACAACAACAAT
ATTGAAACGCCTTTTTGGCCTTAGTCCCGATAACGGCGGAACTGATTGTG
CCAGCGATCAATCATATCATCAAGAACAATGGCTTGATCTTGGACTTGAA
ATTGCATTTAAATTGGAAGCATTACGCTGTATTGATGAGTTACTTGTCTG
GAGCGCTCAGAGTGGAGGTATATCTGGTCTTGCTGAAAATTCAGAGCTAT
TGGAAGATGCTCAGCTAGCAGGTATTCTGCTGGGGTTAGCAAAATTAACA
GGTGAAAGACGTGGAGCTGCTTGGATAGCTCAGGTTATTACTATGGATGA
TAACCTTGCTCCTATCTTACCTCTGTTTGAAGCATTGGAAAAGAAAACAT
TAGCTGCCATGATTCACTGGTACGAATACATTAATCCAGATGATTTACCC
GAATCAGATACCAAACAAGAATCTGATTCAGCGATTACCAATGAAAAAAC
ACGCGTTCCGTTACCCCATTCAATTTGTTTGCATTATCTACCGAATCTTC
TTACTGCAATTGTTAGACATGCAGATAATCCTACATATCTGGGAAAATAT
GGATCTCGACTAGCGGCTCTTGGCAAGGATACTGTTAATAGTCCATTTGC
TGAAGCTCGAGACTGGCTTCAACCGTTACAAGATCTTCCTAGTTCTAGTC
CACTGAGTTTAGACTGTGTATCCCATCTGACTGAGAGTATGAAAGTGGCT
TTTTGCGAACTAGATGCTGCAATAGTTCCTCCTGGATTGGTAACTGTATT
AAGACTATTGAAATATCAGATGGTGTCAAAGAATACAAATCGGCCACATT
ATTTATTGGATAGTGATTCGGATTCCACACAAAACCAGTACGATTTGCCA
ATTAATCAAGGAGTTGATTATATTCGCTATAAATATGCAATAAATGAATT
CTTTCATCACGACGGTTTAACTGTATTAAACAGACTCATCCAACAAATTA
GTGATCACCACCAGCTGAGCTGGCAATGCGGAATCGAACCTATTGATAAC
CGCTATCCGTTGTTATTATGCGTAGCGGAGCCGGCAACCGCCATGGTTTG
CGCAATTACTCAACGGCTCATACAATCACGAGTCAACCAATTTAAAGATG
TTACTGGATTACTGCCTTTATTTTCATGCTATACGGTGTTCTGCTCAGGA
TTAGCAATTGGGCACTATATTTCATCTACTCGTTATAAAAGTCAAATTGA
ATCTATTCGTCATTCAATTATAGACACTGTTTTGACGTATACTCAGTCAC
AATTGCCCGATGAAGAAAACGAGAAAGCATTTGACAAAAGTTTATGGACG
TGCATGTTGAGAGAACTGTTAAATTTTACACAGAGTGCGCCATTTGCATT
TGCAGGTGGTTTGACTTTGTTGATAGAACTTCTTCCATTACCTTTGCCAT
TATTGGCAAATTCGCCTTTGACGGACGAAGAAACATCGCAAATCCAGTCT
GCCAGGACATTGTGGAGTGCACATGTTCTATGTGTGAGACAAGAATTGAA
AGGTCTCATTCACACTATCGGATGCACCAGCAATTACAATTTAATTGCAT
TATTAAATCGTCTTCTAAATTTAATAAGTACCCTCGGTCCTAGTACAGCA
CTCATGCTAGCTCAGAATAGTTTAGAAACTCTTATTGAGGTTTGGGACAG
AGCTTGCAAAGAGATGGCATCGCATAACGAATATGTTCAATCTCTAAAAG
CAGCCGAAACAGGGGAAACATCCGAACCGTCAAATAAGGAATCTACTAGC
AAGCAAAGTGAAGACACTAATAAGGAGAATACTGGGGGAACCGGCATTTC
AAATAGTCTCAATCAAACCTTGATTAGAGCAGATTCCTTTTTAGGAATTG
ATGCTAAAATAAAACTTTATCCAGATTCATTAGAACTAACAAGGACCTGG
GCAATGCTTAAATTATTATTAAATGTGCCACCATGCAAACATGCATTTCT
GAAACTCATCGGACAAAAGCCTTATCAAGATAATTCCGAATCAGAGCAAA
CCCTAGGAACTATATTTTTTTCTATTATGTCAGATATATTAGAAGCCAGT
AAAGAAAACCATACAGCTACTCAGGAAAATATGATTGCATGCTTACAGTT
ACTACTTGATGCTCGTGTAACTATGTTATCTGTCGTACCAGAAGCAATTA
CTATGGATGAAGCCATTTTTGAAGGATGTCAAGATACAATTGCTTCTCCA
AATCGTGTTTTAACAAATCAAGAAATTATTAACAGTCTACCAACTAATAC
TCAATGTTTGACAATTGTTGGATGGTTGGCCCGACACTGTGTAAACCCCG
ACCAAGATATGTCTACGATTCCTGGTGCTCTTAGGCCTTTAGTTATTTTA
GCTGGCCACGATTACGGATTTCGAATTTTATTGGAAGTTCTTGATCATCA
ACCTGGAATGTTTTTAAGTTTGATTAAAAGGGTCAATGAAACATTTAGTG
CAGATAATCCAGATTGTCAAGTTAGCTTGTTGACAGCTTTATCTTTACTG
CAGGCTCTTGTTGTAAAGCAAGATAATAGTGATGAGCCAGTTCAATATCA
TTTACCATCTCGAACTCTGAATCTCAGTGATTCACATGTCAAACAAATGT
TGCAATGGATGGGAAACAAAGAAGCAAACAGTGCACATCCAGTAACGGAA
TTACATGGACTACTCAAGATTGTTTCGGAAGAGGAAGAATCATTACAAAT
ATTACGAGATGGAATGGAGAGTTTAATAGAACTACTGTCGAAAAATGATT
TGATCCCTGGTAATACAGATGGAATTGAGGGTACAACAGGAAACATGCCT
AATCCTCAAAGTTTAGAAGAAATGTATCAGTCTAGAGGTGTATGGCAACG
AGTCCAAGGTGAAGAGTGTAGATTAAGCGAAATTTATAGGGAATGGTTAG
GACCAGTAAAGGTCACAGAAAGGGAACCACCGGAATTATCAAGATGTGAT
TTAGAAAATTTAGCGTATGTTTGTTGCAATGGTTTCAATCTTCACGACGA
GCTTGCACGGGGAAGACAACAAGATGATGAAGCTATACGTCACAAACGTA
GAAGACGAGGTCATGATGCAATAATCCATACTGGTCGCACCAGTAAAAAA
TTTGTGGCTCCAATGAGGGGTAGAGGCTTTGGTGTGAGAAGCAATACACT
AGTATCGACAAATAATGGCGACAGATATGATTCATTCCGTTCGAGACCTC
CAAACACCAGTCGACCACCAAGTATGCATGTTGATGATTTCCAGAAATTA
CAGAAAGATGAAAAATTAGATGAAGAAATAATGATACGTGAAAGGAATCT
TAGAAACTTAAGAGGAGGCAGATCAGGTTTACGAAATATCAACCATGGAA
GTCGAACTTTTAACAGCATCCAGAAAGGCAACTCGACTGGCGACCAATCG
AGAATGCCACCCCCTTCCAGCAGTAGTAGCAGTAGTTCTCGTAATCGGCA
AATGAAATAGACACTCTCATTGATTTTTCG
back to top

protein sequence of SMED30032777-orf-1

>SMED30032777-orf-1 ID=SMED30032777-orf-1|Name=SMED30032777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1904bp
MDENNYMLVFFDTFSHGIKPEMQVDSIRFSQPVKIGLIRIIPFGIAIESE
IDSEARLGVTNPQNFNVKFFAHNHADSPSFEKIGEMEFDERNGVNSISFP
SMPLASMLAISGCYNMLSIAVFGIISPHSINPIKNPLNQPGQTLPLFTMT
APPGYGSNPLGMRAILGQSNALNLGSLNTQMQSQPLNTGPTNQAATNMLM
SLAIAAGQQATIDSQLANISQSNDGSQIKEDQHDDLVKSDQTLGLYEDGE
IQEIDYEDVSSNEDLLFGMDDDADYVTMESEQMIKEGEVAIQSVINGTTA
TSIKKISTGFPDLDKRLMTERWRFLPKRIVSQGQLISELKVLPNSCKTLF
EVELDRLCREERESNGKRFYKEHSLTEISNNIKKEAFETLSEKSGTQDDA
INIVEDIPDSADRLINLVSTYGETNLNSEWVEDMEELPKNLAQGLAYLTY
ADKDTADYIIESLVTWVKVGLSMEAALQQSENMYILRHIKGGITMGGYIC
SLNTDIAMKVLSTNPSEINVQHSLIDLLENKMIATPLKLQIIRALDLSTR
LRIGLDSFIGVQRKTKNNEERTPYQRLVYFLIDKNTYNYTARVSMACSRL
LNKLHLFELLINFEVIINKLKKNIIDKKDMIKLKYEANMLLKEIIRYFIH
AKDIIANPRRTMPCSTIFDDVTHKPHNPYPNLLCMMESTNILSSMDWILS
QSTYYTETDDQDEIQSKTLTSAALRLIWEFVQHHESLIHLLVAPNGITTT
ILKRLFGLSPDNGGTDCASDQSYHQEQWLDLGLEIAFKLEALRCIDELLV
WSAQSGGISGLAENSELLEDAQLAGILLGLAKLTGERRGAAWIAQVITMD
DNLAPILPLFEALEKKTLAAMIHWYEYINPDDLPESDTKQESDSAITNEK
TRVPLPHSICLHYLPNLLTAIVRHADNPTYLGKYGSRLAALGKDTVNSPF
AEARDWLQPLQDLPSSSPLSLDCVSHLTESMKVAFCELDAAIVPPGLVTV
LRLLKYQMVSKNTNRPHYLLDSDSDSTQNQYDLPINQGVDYIRYKYAINE
FFHHDGLTVLNRLIQQISDHHQLSWQCGIEPIDNRYPLLLCVAEPATAMV
CAITQRLIQSRVNQFKDVTGLLPLFSCYTVFCSGLAIGHYISSTRYKSQI
ESIRHSIIDTVLTYTQSQLPDEENEKAFDKSLWTCMLRELLNFTQSAPFA
FAGGLTLLIELLPLPLPLLANSPLTDEETSQIQSARTLWSAHVLCVRQEL
KGLIHTIGCTSNYNLIALLNRLLNLISTLGPSTALMLAQNSLETLIEVWD
RACKEMASHNEYVQSLKAAETGETSEPSNKESTSKQSEDTNKENTGGTGI
SNSLNQTLIRADSFLGIDAKIKLYPDSLELTRTWAMLKLLLNVPPCKHAF
LKLIGQKPYQDNSESEQTLGTIFFSIMSDILEASKENHTATQENMIACLQ
LLLDARVTMLSVVPEAITMDEAIFEGCQDTIASPNRVLTNQEIINSLPTN
TQCLTIVGWLARHCVNPDQDMSTIPGALRPLVILAGHDYGFRILLEVLDH
QPGMFLSLIKRVNETFSADNPDCQVSLLTALSLLQALVVKQDNSDEPVQY
HLPSRTLNLSDSHVKQMLQWMGNKEANSAHPVTELHGLLKIVSEEEESLQ
ILRDGMESLIELLSKNDLIPGNTDGIEGTTGNMPNPQSLEEMYQSRGVWQ
RVQGEECRLSEIYREWLGPVKVTEREPPELSRCDLENLAYVCCNGFNLHD
ELARGRQQDDEAIRHKRRRRGHDAIIHTGRTSKKFVAPMRGRGFGVRSNT
LVSTNNGDRYDSFRSRPPNTSRPPSMHVDDFQKLQKDEKLDEEIMIRERN
LRNLRGGRSGLRNINHGSRTFNSIQKGNSTGDQSRMPPPSSSSSSSSRNR
QMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0016604nuclear body
GO:0016607nuclear speck
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR031801VIR_N
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0080009mRNA methylation