Four and A half lim domains

Overview
NameFour and A half lim domains
Smed IDSMED30032774
Length (bp)1324
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Four and A half lim domains (SMED30032774) t-SNE clustered cells

Violin plots show distribution of expression levels for Four and A half lim domains (SMED30032774) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Four and A half lim domains (SMED30032774) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Four and A half lim domains (SMED30032774) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032774

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30032774h1SMcG0007825 Contig48704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032774h1SMcG0007825 Contig48704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30032774h1SMcG0007825 dd_Smed_v4_5014_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032774h1SMcG0007825 dd_Smed_v4_5014_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 339.347 bits (869), Expect = 6.983e-115
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 339.347 bits (869), Expect = 6.983e-115
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 339.347 bits (869), Expect = 6.983e-115
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 339.347 bits (869), Expect = 6.983e-115
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Human
Match: FHL2 (four and a half LIM domains 2 [Source:HGNC Symbol;Acc:HGNC:3703])

HSP 1 Score: 339.347 bits (869), Expect = 6.983e-115
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 1.136e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 363.614 bits (932), Expect = 1.316e-124
Identity = 164/273 (60.07%), Postives = 209/273 (76.56%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C ++LTG RYI++D+ P+C+ CYE+ FAN+CD C   IG DSKDLS+K++HWHE CFLCS C  SLVD PF +K+D +FC +CY+  FATRCD C  IF+AG +K EY+G+QWH+ CF CA C+  IG KSFIP+++   C  CYE KFA RC+KC  VI  GGVTYK EPWH+ECF CT C+  LA  +FTSKD+KP+CA+CY +LF+K+C  CTKPITG GG KFIS +DRHWH++CF C++C TSLVG+GF+TD   I+CPEC +
Sbjct:   10 FCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 282          

HSP 2 Score: 82.8037 bits (203), Expect = 1.617e-17
Identity = 40/100 (40.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFAT 543
            +E F C NC  SL G R+  KD+ P+C  CY + FA +C+ C   I     +K +SF++RHWH  CF+C+ C+ SLV K F T    + CP+C +++   
Sbjct:  188 RECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARLMA 287          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 367.851 bits (943), Expect = 1.883e-123
Identity = 164/273 (60.07%), Postives = 209/273 (76.56%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C ++LTG RYI++D+ P+C+ CYE+ FAN+CD C   IG DSKDLS+K++HWHE CFLCS C  SLVD PF +K+D +FC +CY+  FATRCD C  IF+AG +K EY+G+QWH+ CF CA C+  IG KSFIP+++   C  CYE KFA RC+KC  VI  GGVTYK EPWH+ECF CT C+  LA  +FTSKD+KP+CA+CY +LF+K+C  CTKPITG GG KFIS +DRHWH++CF C++C TSLVG+GF+TD   I+CPEC +
Sbjct:  206 FCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 478          

HSP 2 Score: 141.739 bits (356), Expect = 4.388e-37
Identity = 72/217 (33.18%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH ACF C +C + LVD  +  KD+ ++C   Y      RC AC  +  AG    +   + WH + F C +C Q +  + +I RD Q  C+ CYE+ FA +C +C     I    ++YK + WH+ CFLC+ C   L  + F SK+D+ FC++CY   F+ +C  C +      G K +    + WH +CF C+ C  ++  + F+   D + C  C
Sbjct:  141 WHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYT-KAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFR--AGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPC 354          

HSP 3 Score: 82.8037 bits (203), Expect = 8.684e-17
Identity = 40/100 (40.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFAT 543
            +E F C NC  SL G R+  KD+ P+C  CY + FA +C+ C   I     +K +SF++RHWH  CF+C+ C+ SLV K F T    + CP+C +++   
Sbjct:  384 RECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARLMA 483          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 369.007 bits (946), Expect = 3.587e-122
Identity = 164/273 (60.07%), Postives = 209/273 (76.56%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C ++LTG RYI++D+ P+C+ CYE+ FAN+CD C   IG DSKDLS+K++HWHE CFLCS C  SLVD PF +K+D +FC +CY+  FATRCD C  IF+AG +K EY+G+QWH+ CF CA C+  IG KSFIP+++   C  CYE KFA RC+KC  VI  GGVTYK EPWH+ECF CT C+  LA  +FTSKD+KP+CA+CY +LF+K+C  CTKPITG GG KFIS +DRHWH++CF C++C TSLVG+GF+TD   I+CPEC +
Sbjct:  339 FCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 611          

HSP 2 Score: 140.198 bits (352), Expect = 6.594e-36
Identity = 72/217 (33.18%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH ACF C +C + LVD  +  KD+ ++C   Y      RC AC  +  AG    +   + WH + F C +C Q +  + +I RD Q  C+ CYE+ FA +C +C     I    ++YK + WH+ CFLC+ C   L  + F SK+D+ FC++CY   F+ +C  C +      G K +    + WH +CF C+ C  ++  + F+   D + C  C
Sbjct:  274 WHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYT-KAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFR--AGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPC 487          

HSP 3 Score: 82.8037 bits (203), Expect = 9.786e-17
Identity = 40/98 (40.82%), Postives = 59/98 (60.20%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKF 537
            +E F C NC  SL G R+  KD+ P+C  CY + FA +C+ C   I     +K +SF++RHWH  CF+C+ C+ SLV K F T    + CP+C +++ 
Sbjct:  517 RECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARL 614          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 367.081 bits (941), Expect = 4.045e-122
Identity = 164/273 (60.07%), Postives = 209/273 (76.56%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C ++LTG RYI++D+ P+C+ CYE+ FAN+CD C   IG DSKDLS+K++HWHE CFLCS C  SLVD PF +K+D +FC +CY+  FATRCD C  IF+AG +K EY+G+QWH+ CF CA C+  IG KSFIP+++   C  CYE KFA RC+KC  VI  GGVTYK EPWH+ECF CT C+  LA  +FTSKD+KP+CA+CY +LF+K+C  CTKPITG GG KFIS +DRHWH++CF C++C TSLVG+GF+TD   I+CPEC +
Sbjct:  284 FCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 556          

HSP 2 Score: 140.969 bits (354), Expect = 1.992e-36
Identity = 72/217 (33.18%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH ACF C +C + LVD  +  KD+ ++C   Y      RC AC  +  AG    +   + WH + F C +C Q +  + +I RD Q  C+ CYE+ FA +C +C     I    ++YK + WH+ CFLC+ C   L  + F SK+D+ FC++CY   F+ +C  C +      G K +    + WH +CF C+ C  ++  + F+   D + C  C
Sbjct:  219 WHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYT-KAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFR--AGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPC 432          

HSP 3 Score: 82.4185 bits (202), Expect = 1.247e-16
Identity = 40/100 (40.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFAT 543
            +E F C NC  SL G R+  KD+ P+C  CY + FA +C+ C   I     +K +SF++RHWH  CF+C+ C+ SLV K F T    + CP+C +++   
Sbjct:  462 RECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARLMA 561          
BLAST of Four and A half lim domains vs. Ensembl Celegans
Match: lim-9 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EDJ5])

HSP 1 Score: 367.081 bits (941), Expect = 4.045e-122
Identity = 164/273 (60.07%), Postives = 209/273 (76.56%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C ++LTG RYI++D+ P+C+ CYE+ FAN+CD C   IG DSKDLS+K++HWHE CFLCS C  SLVD PF +K+D +FC +CY+  FATRCD C  IF+AG +K EY+G+QWH+ CF CA C+  IG KSFIP+++   C  CYE KFA RC+KC  VI  GGVTYK EPWH+ECF CT C+  LA  +FTSKD+KP+CA+CY +LF+K+C  CTKPITG GG KFIS +DRHWH++CF C++C TSLVG+GF+TD   I+CPEC +
Sbjct:  284 FCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFRAGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPCYEEKFATRCSKCKKVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAK 556          

HSP 2 Score: 140.969 bits (354), Expect = 1.992e-36
Identity = 72/217 (33.18%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH ACF C +C + LVD  +  KD+ ++C   Y      RC AC  +  AG    +   + WH + F C +C Q +  + +I RD Q  C+ CYE+ FA +C +C     I    ++YK + WH+ CFLC+ C   L  + F SK+D+ FC++CY   F+ +C  C +      G K +    + WH +CF C+ C  ++  + F+   D + C  C
Sbjct:  219 WHPACFTCQACEQLLVDLTYCVKDNQIYCERHYAELHKPRCSACDELIFAGEYT-KAMNKDWHSDHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKPIGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNEIFR--AGMKKMEYKGKQWHDKCFCCAHCKLAIGTKSFIPKNDDVFCGPC 432          

HSP 3 Score: 82.4185 bits (202), Expect = 1.247e-16
Identity = 40/100 (40.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFAT 543
            +E F C NC  SL G R+  KD+ P+C  CY + FA +C+ C   I     +K +SF++RHWH  CF+C+ C+ SLV K F T    + CP+C +++   
Sbjct:  462 RECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTKPITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARLMA 561          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302783)

HSP 1 Score: 357.836 bits (917), Expect = 1.595e-121
Identity = 161/276 (58.33%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*L 1086
            F C  C +SLTG RY+++D  P+C+ CYE  FAN C+ C   IG DSKDLS+K++HWHEACFLC  C  SLVDK F  K D ++C +CY+++FA+RCD CG +F+AG +K EY+ RQWHENCF C  C+  IG KSFIPR+ +  C  CYE KFA RC KCN VI  GGVTYK EPWH+ECF CT C+  LA  +FTS+D+KP+CA+C+  LF+K+CT C KPITG GG +FIS +DRHWH +CF C+ C  SLVGRGF+TD   I+CP+C +  L
Sbjct:   63 FCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 338          

HSP 2 Score: 80.1073 bits (196), Expect = 3.576e-16
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKF 537
            +E F+C +C  +L G R+  +D+ P+C  C+ E FA +C  C   I     ++ +SF++RHWH  CF+C+SC  SLV + F T    + CPDC + K 
Sbjct:  241 RECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 338          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0346965)

HSP 1 Score: 355.525 bits (911), Expect = 2.033e-121
Identity = 161/276 (58.33%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*L 1086
            F C  C +SLTG RY+++D  P+C+ CYE  FAN C+ C   IG DSKDLS+K++HWHEACFLC  C  SLVDK F  K D ++C +CY+++FA+RCD CG +F+AG +K EY+ RQWHENCF C  C+  IG KSFIPR+ +  C  CYE KFA RC KCN VI  GGVTYK EPWH+ECF CT C+  LA  +FTS+D+KP+CA+C+  LF+K+CT C KPITG GG +FIS +DRHWH +CF C+ C  SLVGRGF+TD   I+CP+C +  L
Sbjct:   10 FCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 285          

HSP 2 Score: 98.9821 bits (245), Expect = 5.655e-23
Identity = 53/170 (31.18%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  220 RKSEMENQNTQE-IFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKA--GARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKF 720
            +K E + +   E  F C  C+ ++    +I +++  +C  CYEEKFA +C +C   I   S  +++K   WH  CF C+ C+ +L  + F ++D+  +C +C+   FA RC AC        G R   +  R WH +CFVCA C+  +  + FI      +C  C + K 
Sbjct:  118 KKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 285          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302778)

HSP 1 Score: 355.525 bits (911), Expect = 2.033e-121
Identity = 161/276 (58.33%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*L 1086
            F C  C +SLTG RY+++D  P+C+ CYE  FAN C+ C   IG DSKDLS+K++HWHEACFLC  C  SLVDK F  K D ++C +CY+++FA+RCD CG +F+AG +K EY+ RQWHENCF C  C+  IG KSFIPR+ +  C  CYE KFA RC KCN VI  GGVTYK EPWH+ECF CT C+  LA  +FTS+D+KP+CA+C+  LF+K+CT C KPITG GG +FIS +DRHWH +CF C+ C  SLVGRGF+TD   I+CP+C +  L
Sbjct:   10 FCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 285          

HSP 2 Score: 98.9821 bits (245), Expect = 5.655e-23
Identity = 53/170 (31.18%), Postives = 86/170 (50.59%), Query Frame = 1
Query:  220 RKSEMENQNTQE-IFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKA--GARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKF 720
            +K E + +   E  F C  C+ ++    +I +++  +C  CYEEKFA +C +C   I   S  +++K   WH  CF C+ C+ +L  + F ++D+  +C +C+   FA RC AC        G R   +  R WH +CFVCA C+  +  + FI      +C  C + K 
Sbjct:  118 KKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVI--TSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 285          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0332703)

HSP 1 Score: 359.377 bits (921), Expect = 1.846e-119
Identity = 161/276 (58.33%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*L 1086
            F C  C +SLTG RY+++D  P+C+ CYE  FAN C+ C   IG DSKDLS+K++HWHEACFLC  C  SLVDK F  K D ++C +CY+++FA+RCD CG +F+AG +K EY+ RQWHENCF C  C+  IG KSFIPR+ +  C  CYE KFA RC KCN VI  GGVTYK EPWH+ECF CT C+  LA  +FTS+D+KP+CA+C+  LF+K+CT C KPITG GG +FIS +DRHWH +CF C+ C  SLVGRGF+TD   I+CP+C +  L
Sbjct:  253 FCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 528          

HSP 2 Score: 136.732 bits (343), Expect = 5.497e-35
Identity = 71/217 (32.72%), Postives = 108/217 (49.77%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH  CF CS+C+  LVD  +   DD ++C   Y      RC  C  +  +G    +   + WH   F C +C + +  + ++ RD+   C+ CYEN FA  C +CN +  I    ++YK + WH+ CFLC +CH  L   +F +K DK +C +CY   F+ +C  C +      G K +    R WH  CF C  C T++  + F+  +  I C  C
Sbjct:  188 WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYT-KAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFR--AGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGC 401          

HSP 3 Score: 79.7221 bits (195), Expect = 1.067e-15
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKF 537
            +E F+C +C  +L G R+  +D+ P+C  C+ E FA +C  C   I     ++ +SF++RHWH  CF+C+SC  SLV + F T    + CPDC + K 
Sbjct:  431 RECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 528          

HSP 4 Score: 68.9366 bits (167), Expect = 2.977e-12
Identity = 47/171 (27.49%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  637 ECQQPIGAKSFIPRDNQTVCVSCY--ENKFAQRCTKCNDVIRKGGVTYKGEP------WHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LG-------KVIGI 1104
            E Q     + F+   N+      Y  +  + + C  C++ I  G +            WH +CF C+ C+  L  L +   DDK +C   YA +   +C  C + I  F G ++    D+ WHS  F C +CD SL G+ ++   D   C +C +N          K+IGI
Sbjct:  130 EVQHEASFEDFVTARNEIALDIAYIKDAPYDEHCAHCDNEIAAGELVVAAPKFVESVMWHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELI--FSG-EYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGI 297          
BLAST of Four and A half lim domains vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302780)

HSP 1 Score: 358.992 bits (920), Expect = 6.667e-119
Identity = 161/276 (58.33%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*L 1086
            F C  C +SLTG RY+++D  P+C+ CYE  FAN C+ C   IG DSKDLS+K++HWHEACFLC  C  SLVDK F  K D ++C +CY+++FA+RCD CG +F+AG +K EY+ RQWHENCF C  C+  IG KSFIPR+ +  C  CYE KFA RC KCN VI  GGVTYK EPWH+ECF CT C+  LA  +FTS+D+KP+CA+C+  LF+K+CT C KPITG GG +FIS +DRHWH +CF C+ C  SLVGRGF+TD   I+CP+C +  L
Sbjct:  282 FCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 557          

HSP 2 Score: 136.732 bits (343), Expect = 7.038e-35
Identity = 71/217 (32.72%), Postives = 108/217 (49.77%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDV--IRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH  CF CS+C+  LVD  +   DD ++C   Y      RC  C  +  +G    +   + WH   F C +C + +  + ++ RD+   C+ CYEN FA  C +CN +  I    ++YK + WH+ CFLC +CH  L   +F +K DK +C +CY   F+ +C  C +      G K +    R WH  CF C  C T++  + F+  +  I C  C
Sbjct:  217 WHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELIFSGEYT-KAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFR--AGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGC 430          

HSP 3 Score: 79.337 bits (194), Expect = 1.560e-15
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKF 537
            +E F+C +C  +L G R+  +D+ P+C  C+ E FA +C  C   I     ++ +SF++RHWH  CF+C+SC  SLV + F T    + CPDC + K 
Sbjct:  460 RECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKL 557          

HSP 4 Score: 69.3218 bits (168), Expect = 2.657e-12
Identity = 47/171 (27.49%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  637 ECQQPIGAKSFIPRDNQTVCVSCY--ENKFAQRCTKCNDVIRKGGVTYKGEP------WHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LG-------KVIGI 1104
            E Q     + F+   N+      Y  +  + + C  C++ I  G +            WH +CF C+ C+  L  L +   DDK +C   YA +   +C  C + I  F G ++    D+ WHS  F C +CD SL G+ ++   D   C +C +N          K+IGI
Sbjct:  159 EVQHEASFEDFVTARNEIALDIAYIKDAPYDEHCAHCDNEIAAGELVVAAPKFVESVMWHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYAEMLKPRCAGCDELI--FSG-EYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCEECNKIIGI 326          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 337.035 bits (863), Expect = 3.436e-114
Identity = 149/276 (53.99%), Postives = 200/276 (72.46%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L++  P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWHE CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C  C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLTD+D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKD 278          

HSP 2 Score: 130.568 bits (327), Expect = 2.199e-34
Identity = 67/219 (30.59%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            ++ F C  C++SL    +  KD+   C  CY  ++++KC  CK  I   S+ +  K   WHE CF C  C + +  K F  KD+  +C  CYE +FA +C  C      G     Y  + WH++CF+C  C+Q +  + F  RD+   C++C+ N +A++C  C   I   G    ++++   WH +CF C +C   L    F +  D   C +C  ++
Sbjct:   63 EDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGG--VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 337.035 bits (863), Expect = 3.436e-114
Identity = 149/276 (53.99%), Postives = 200/276 (72.46%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L++  P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWHE CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C  C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLTD+D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKD 278          

HSP 2 Score: 130.568 bits (327), Expect = 2.199e-34
Identity = 67/219 (30.59%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            ++ F C  C++SL    +  KD+   C  CY  ++++KC  CK  I   S+ +  K   WHE CF C  C + +  K F  KD+  +C  CYE +FA +C  C      G     Y  + WH++CF+C  C+Q +  + F  RD+   C++C+ N +A++C  C   I   G    ++++   WH +CF C +C   L    F +  D   C +C  ++
Sbjct:   63 EDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGG--VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2a (four and a half LIM domains 2a [Source:ZFIN;Acc:ZDB-GENE-040808-49])

HSP 1 Score: 337.035 bits (863), Expect = 3.436e-114
Identity = 149/276 (53.99%), Postives = 200/276 (72.46%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L++  P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWHE CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C  C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLTD+D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKD 278          

HSP 2 Score: 130.568 bits (327), Expect = 2.199e-34
Identity = 67/219 (30.59%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            ++ F C  C++SL    +  KD+   C  CY  ++++KC  CK  I   S+ +  K   WHE CF C  C + +  K F  KD+  +C  CYE +FA +C  C      G     Y  + WH++CF+C  C+Q +  + F  RD+   C++C+ N +A++C  C   I   G    ++++   WH +CF C +C   L    F +  D   C +C  ++
Sbjct:   63 EDCFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGG--VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTDRDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2b (four and a half LIM domains 2b [Source:ZFIN;Acc:ZDB-GENE-041010-121])

HSP 1 Score: 337.035 bits (863), Expect = 3.915e-114
Identity = 149/276 (53.99%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L+D+ P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWH+ CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C +C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD P+C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKD 278          

HSP 2 Score: 146.747 bits (369), Expect = 1.897e-40
Identity = 74/224 (33.04%), Postives = 113/224 (50.45%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            + C  C ESL  K +  +D+  +C  CYES ++  C+ C       +R   Y+ R WH++CF C +C + +  K F  +D Q +C  CY N+++ +C +C   I  G   + +KG  WH+ CF C  C Q + +  F  KD+  +C  CY   F+ +C +C KPIT  G    ++  D+ WH +CF C+ C   L G+ F +  D   C  C  N   K    C
Sbjct:    5 YDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGG----VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAAC 224          

HSP 3 Score: 73.9442 bits (180), Expect = 2.791e-14
Identity = 38/93 (40.86%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            ++ F C  C++ L+G R+  +D  P+CL C+   +A KC  C   I     SK +SF+ER WH  CF C  CS SLV + F T+ D + CP+C
Sbjct:  183 KDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Match: fhl2b (four and a half LIM domains 2b [Source:ZFIN;Acc:ZDB-GENE-041010-121])

HSP 1 Score: 337.035 bits (863), Expect = 3.915e-114
Identity = 149/276 (53.99%), Postives = 203/276 (73.55%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L+D+ P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWH+ CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C +C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD P+C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKD 278          

HSP 2 Score: 146.747 bits (369), Expect = 1.897e-40
Identity = 74/224 (33.04%), Postives = 113/224 (50.45%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            + C  C ESL  K +  +D+  +C  CYES ++  C+ C       +R   Y+ R WH++CF C +C + +  K F  +D Q +C  CY N+++ +C +C   I  G   + +KG  WH+ CF C  C Q + +  F  KD+  +C  CY   F+ +C +C KPIT  G    ++  D+ WH +CF C+ C   L G+ F +  D   C  C  N   K    C
Sbjct:    5 YDCHYCKESLFGKKYVLRDENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHDDCFHCFKCHRSLVDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNSNYCVPCYEKQFALQCVQCKKPITTGG----VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAAC 224          

HSP 3 Score: 73.9442 bits (180), Expect = 2.791e-14
Identity = 38/93 (40.86%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            ++ F C  C++ L+G R+  +D  P+CL C+   +A KC  C   I     SK +SF+ER WH  CF C  CS SLV + F T+ D + CP+C
Sbjct:  183 KDCFLCTGCKQQLSGQRFTSRDDFPYCLNCFCNLYAKKCAACTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPEC 275          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl2 (four and a half LIM domains 2 [Source:NCBI gene;Acc:100145283])

HSP 1 Score: 342.043 bits (876), Expect = 6.370e-116
Identity = 150/276 (54.35%), Postives = 204/276 (73.91%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C  C++SL G +Y+L+++ P+C+ CYE  ++N C+ CK  IGCD KDLS+K+RHWHE+CF C  C +SLVDKPFA KD+ L C +CY ++++++C  C      G RK EY+G  WHE CF+C+ CQQPIG KSFIP+DNQ  CV+CYE +FA  C +C   I  GGVTY+ +PWHKECF+CT C + L+  +FTS+D+  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WHS+CF C KC  SLVGRGFLT++D I+CPECG++
Sbjct:    3 ERFDCHYCKESLFGKKYLLREENPYCVKCYESLYSNSCEECKKPIGCDGKDLSYKDRHWHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTGGVTYRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPECGKD 278          

HSP 2 Score: 140.198 bits (352), Expect = 7.546e-38
Identity = 70/216 (32.41%), Postives = 111/216 (51.39%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            F C  C+KSL    +  KD+   C  CY  ++++KC  CK  I   ++ + +K   WHE CF+CS C + +  K F  KD+  FC  CYE +FA  C  C      G     YR + WH+ CF+C  C++P+  + F  RD    C++C+ N +A++C  C + I   G    ++++   WH +CF C +C   L    F ++ D   C +C  ++
Sbjct:   66 FHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSKCSECKKTIMPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQCKKAITTGG--VTYRDQPWHKECFICTGCKKPLSGQRFTSRDEFAYCLNCFCNLYAKKCAGCTNPISGLGGAKYISFEERQWHSDCFNCKKCAISLVGRGFLTERDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: shroom3 (shroom family member 3 [Source:Xenbase;Acc:XB-GENE-490224])

HSP 1 Score: 321.627 bits (823), Expect = 6.682e-108
Identity = 144/276 (52.17%), Postives = 198/276 (71.74%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C++SL G +YI  ++ P+C+PCY+  FAN CD CK+ IG D ++L +++RH+HE CF C  C  SL D+PF  +D+ L C DCY ++F+++C +C      G+RK EY G+ WHE+CF+C  CQQPIG++SFIP +    C+ CYE+K A RCT C   + KGGVTY+ EPWHKECF+CT C  QLA  +FTS+D+KP+C  C+ NL++KKC  CTKPITGFGG K++S ++RHWH  CF CS+C TSLVG+GF+ D + I+C  C  +
Sbjct:    3 EPFDCDSCKESLYGRKYIQMEEGPYCIPCYDSLFANTCDECKELIGHDCRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSLTKGGVTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRACNSD 278          

HSP 2 Score: 139.813 bits (351), Expect = 1.153e-37
Identity = 71/219 (32.42%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            F C SC ESL  + +   ++  +C  CY+S FA  CD C  +     R+  Y  R +HE+CF C  C   +  + F  +D + +C  CY N+F+ +C  C   +  G   + Y G+ WH+ CF+C  C Q + S  F  ++   +C  CY +  + +CT C K +T  G    ++  D  WH ECF C+ C T L G+ F +  +   C +C  N   K
Sbjct:    5 FDCDSCKESLYGRKYIQMEEGPYCIPCYDSLFANTCDECKELIGHDCRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSLTKGG----VTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAK 219          

HSP 3 Score: 126.331 bits (316), Expect = 1.014e-32
Identity = 70/231 (30.30%), Postives = 112/231 (48.48%), Query Frame = 1
Query:  217 CRKSEMENQNTQE-IFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            CR+   E+++  E  F C  C  SL    +  +D+   C  CY  +F++KC  C+  +   S+ L +  + WHE CF+C+SC + +  + F  ++   +C  CYESK A RC  C      G     YR   WH+ CFVC  C+  +  + F  +D +  C+ C+ N +A++C  C   I   G    V+++   WH  CF C+ C   L    F   ++   C  C ++L
Sbjct:   51 CRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSKCISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHCKKSLTKGG--VTYRDEPWHKECFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHWHHSCFNCSRCSTSLVGKGFIPDNEDILCRACNSDL 279          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl5 (four and a half LIM domains 5 [Source:NCBI gene;Acc:100144736])

HSP 1 Score: 318.931 bits (816), Expect = 7.655e-107
Identity = 140/275 (50.91%), Postives = 196/275 (71.27%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECG 1074
            +EIF C +C++SL G +Y LKD +P+C+ C+   FAN C+RCK  I C+SKDL++K+ HWHE CF C  C  SLV+KPFA KD+LL C +CY ++++++C  C      G+RK EY G  WHE CFVC  C++P+G K FIP++++  C+ CYE +FA +C  C   I KGG++++ + WH+ECF+CT C + L   K TS+D+ P+C DC+ NL++KKC  C KPITG GG K+IS +DR WHS+CFTC+KC  SLVG  F T++D ++CP CG
Sbjct:    3 KEIFDCFHCKESLYGKKYTLKDDIPYCIKCFNSLFANLCERCKKPIECNSKDLAYKDSHWHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEYSSKCFGCRATIMPGSRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQCKSCRKAITKGGLSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKPITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSCG 277          

HSP 2 Score: 140.969 bits (354), Expect = 4.021e-38
Identity = 72/224 (32.14%), Postives = 108/224 (48.21%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F C  C ESL  K +  KDD+ +C  C+ S FA  C+ C    +  ++   Y+   WHE CF C +C   +  K F  +D   +C+ CY  +++ +C  C   I  G   + Y G  WH+ CF+C  C + + +  F  K+ K +C  CY   F+ +C  C K IT  G    +S  ++ WH ECF C+ C  +LVG    +  +   C +C  N   K    C
Sbjct:    6 FDCFHCKESLYGKKYTLKDDIPYCIKCFNSLFANLCERCKKPIECNSKDLAYKDSHWHETCFKCDKCDHSLVEKPFAAKDELLLCIECYSTEYSSKCFGCRATIMPGSRKMEYNGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCYEKQFANQCKSCRKAITKGG----LSFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAAC 225          

HSP 3 Score: 76.2554 bits (186), Expect = 7.216e-15
Identity = 39/101 (38.61%), Postives = 60/101 (59.41%), Query Frame = 1
Query:  226 SEMENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCD--SKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            S  E Q  +E F C +C+K+L G +   +D+ P+C+ C++  +A KC  C   I     +K +SF++R WH  CF C+ CS+SLV + F T +D + CP C
Sbjct:  176 SFQEQQWHRECFVCTSCKKNLVGEKSTSRDESPYCVDCFDNLYAKKCAACAKPITGQGGAKYISFEDRQWHSDCFTCAKCSKSLVGEKFHTNEDDVLCPSC 276          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl1 (four and a half LIM domains 1 [Source:NCBI gene;Acc:448334])

HSP 1 Score: 249.595 bits (636), Expect = 1.529e-79
Identity = 113/276 (40.94%), Postives = 164/276 (59.42%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFG-GCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            E F C  C+  L G +YI KD    C+ C+++  AN C  C+  IG DSK+L +K R+WH+ CF C+ C   L ++ F  KD+ + C  C   + + RC  C    + G R  EY+G  WHE CF C+ C+Q IG+ SF P+     CV+C+E KFA+ C KCN+ I  GG+TY+ +PWH +CF+C  CH++LA  +FT+ +D  +C DCY +  +KKC  C  PITGFG G   ++ +   WH  CFTC KC  +L  + F+   + + C +C +
Sbjct:   19 ERFDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAK 294          

HSP 2 Score: 144.821 bits (364), Expect = 2.313e-39
Identity = 76/219 (34.70%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            F C  C   L  K +  KD    C  C++   A  C  C       +++  Y+ R WH+NCF CA+C  P+  + FI +DN+ +C  C   + + RC+ C+  I+ GG  V YKG  WH+ECF C+ C Q + S  F  K    +C  C+   F+K C KC  PIT  G    I+  D+ WH +CF C  C   L G+ F   +D   C +C ++ + K
Sbjct:   21 FDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGG----ITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAK 235          

HSP 3 Score: 103.99 bits (258), Expect = 2.051e-24
Identity = 50/155 (32.26%), Postives = 82/155 (52.90%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNI---FKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSC 705
            +E F+C NC++++    +  K    +C+ C+E+KFA  C +C + I   S  ++++++ WH  CF+C +C + L  + F   +D  +C DCY+S  A +C  C N    F  G+    Y G  WHE CF C +C   +  K F+  + Q  C  C
Sbjct:  140 EECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPI--TSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDC 292          
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Match: fhl1 (four and a half LIM domains 1 [Source:NCBI gene;Acc:448334])

HSP 1 Score: 249.21 bits (635), Expect = 1.904e-79
Identity = 113/276 (40.94%), Postives = 164/276 (59.42%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFG-GCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            E F C  C+  L G +YI KD    C+ C+++  AN C  C+  IG DSK+L +K R+WH+ CF C+ C   L ++ F  KD+ + C  C   + + RC  C    + G R  EY+G  WHE CF C+ C+Q IG+ SF P+     CV+C+E KFA+ C KCN+ I  GG+TY+ +PWH +CF+C  CH++LA  +FT+ +D  +C DCY +  +KKC  C  PITGFG G   ++ +   WH  CFTC KC  +L  + F+   + + C +C +
Sbjct:   14 ERFDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDCAK 289          

HSP 2 Score: 144.436 bits (363), Expect = 2.366e-39
Identity = 76/219 (34.70%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            F C  C   L  K +  KD    C  C++   A  C  C       +++  Y+ R WH+NCF CA+C  P+  + FI +DN+ +C  C   + + RC+ C+  I+ GG  V YKG  WH+ECF C+ C Q + S  F  K    +C  C+   F+K C KC  PIT  G    I+  D+ WH +CF C  C   L G+ F   +D   C +C ++ + K
Sbjct:   16 FDCHYCRAPLQGKKYIEKDGHNTCVKCFDKICANTCAECRKPIGVDSKELHYKNRYWHDNCFRCAKCYHPLANEQFIAKDNKIMCAKCTTREDSLRCSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPITSGG----ITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAK 230          

HSP 3 Score: 103.605 bits (257), Expect = 2.150e-24
Identity = 50/155 (32.26%), Postives = 82/155 (52.90%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNI---FKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSC 705
            +E F+C NC++++    +  K    +C+ C+E+KFA  C +C + I   S  ++++++ WH  CF+C +C + L  + F   +D  +C DCY+S  A +C  C N    F  G+    Y G  WHE CF C +C   +  K F+  + Q  C  C
Sbjct:  135 EECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKCNNPI--TSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITGFGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDC 287          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl2 (four and a half LIM domains 2 [Source:MGI Symbol;Acc:MGI:1338762])

HSP 1 Score: 340.502 bits (872), Expect = 1.800e-115
Identity = 150/276 (54.35%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YILK++ PHC+ C+EE +AN C+ C   IGCD KDLS+K+RHWHE CF CS C  SLVDKPFA K++ L C DCY ++++++C  C      G RK EY+G  WHE CF C  CQQPIG KSFIP++NQ  CV CYE ++A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++D+ P+C  C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 79.7221 bits (195), Expect = 2.825e-16
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D+ P+CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl2 (four and a half LIM domains 2 [Source:MGI Symbol;Acc:MGI:1338762])

HSP 1 Score: 340.502 bits (872), Expect = 1.800e-115
Identity = 150/276 (54.35%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YILK++ PHC+ C+EE +AN C+ C   IGCD KDLS+K+RHWHE CF CS C  SLVDKPFA K++ L C DCY ++++++C  C      G RK EY+G  WHE CF C  CQQPIG KSFIP++NQ  CV CYE ++A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++D+ P+C  C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 79.7221 bits (195), Expect = 2.825e-16
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D+ P+CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl3 (four and a half LIM domains 3 [Source:MGI Symbol;Acc:MGI:1341092])

HSP 1 Score: 312.383 bits (799), Expect = 1.933e-104
Identity = 136/275 (49.45%), Postives = 190/275 (69.09%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            E F C  C +SL G +YI  D  P+C+PCY+  FAN C  C+  IG DS++L +++RH+HE CF C  C  SL D+PF  +D  L C +CY + F+++C ACG     G+RK EY G+ WHE+CF+C+ C+QP+G++SF+P      CV CYENKFA RC +C+  + +GGVTY+ +PWH+EC +CT C   LA  +FTS+DD P+C  C+  LF+ KC+ C +PITG GG K++S +DRHWH  CF+C++C TSLVG+GF+ D D ++C  C Q
Sbjct:    3 EAFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 2 Score: 103.605 bits (257), Expect = 1.613e-24
Identity = 57/168 (33.93%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  220 RKSEMENQNTQE-IFSCQNCQKSLTGNRYILKDKLPH-CLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGN-IFKAGARKY-EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYE 711
            RK E   Q   E  F C  C++ L G+R  + DK  H C+PCYE KFA +C RC   +      ++++++ WH  C +C+ C   L  + F ++DD  +C  C+   FA +C +C   I   G  KY  +  R WH +CF CA C   +  + F+P  +Q +C  C +
Sbjct:  113 RKLEYGGQTWHEHCFLCSGCEQPL-GSRSFVPDKGAHYCVPCYENKFAPRCARCSKTL--TQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 3 Score: 93.2041 bits (230), Expect = 6.092e-21
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  625 FVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            F CA+C + +  + +I  D+   CV CY+N FA  C +C  +I      + Y+   +H+ CF C  C + LA   FT +D +  C +CY   FS +C+ C + +    G + +    + WH  CF CS C+  L  R F+ DK    C  C +N
Sbjct:    5 FDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETV--MPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYEN 156          

HSP 4 Score: 72.7886 bits (177), Expect = 7.555e-14
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYES 531
            +E   C  C+  L G ++  +D  P+C+ C+ E FA KC  CK  I      K +SF++RHWH +CF C+ CS SLV + F    D + C  C ++
Sbjct:  183 RECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQA 278          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl5 (four and a half LIM domains 5 [Source:MGI Symbol;Acc:MGI:1913192])

HSP 1 Score: 302.753 bits (774), Expect = 1.591e-100
Identity = 143/278 (51.44%), Postives = 181/278 (65.11%), Query Frame = 1
Query:  247 TQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            T   F CQ C  SL G +Y+LKD   +C+ CY+  F+N C++CK+ I  DSKDL +K RHWHE CF C+ C  SLV+KPF  KDD L C DCY ++ +++C  C      G+RK E++G  WHE CFVC  C+QPIG K  I +++   CV C+E +FA  C  C  VI  GG+T++ + WHKECFLC+ C ++L    F SKDD PFC DCY +L++KKC  CTKPITG  G KFI   DR WHSECF C KC  SLVG GFLT    I+C +CG  
Sbjct:    2 TSSQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCGSG 279          

HSP 2 Score: 142.51 bits (358), Expect = 1.004e-38
Identity = 73/224 (32.59%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F C  C+ SL+ K +  KDD L+C  CY+  F+  C+ C    ++ ++   Y+ R WHE CF C +C   +  K F+ +D++ +C  CY N+ + +C  C   I  G   + +KG  WH+ CF+C  C Q + +    SK+   +C  C+   F+  C  C K IT  G    I+  D+ WH ECF CS C   L    F++  D   C +C  +   K    C
Sbjct:    6 FDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGG----ITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAAC 225          
BLAST of Four and A half lim domains vs. Ensembl Mouse
Match: Fhl5 (four and a half LIM domains 5 [Source:MGI Symbol;Acc:MGI:1913192])

HSP 1 Score: 302.753 bits (774), Expect = 1.591e-100
Identity = 143/278 (51.44%), Postives = 181/278 (65.11%), Query Frame = 1
Query:  247 TQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            T   F CQ C  SL G +Y+LKD   +C+ CY+  F+N C++CK+ I  DSKDL +K RHWHE CF C+ C  SLV+KPF  KDD L C DCY ++ +++C  C      G+RK E++G  WHE CFVC  C+QPIG K  I +++   CV C+E +FA  C  C  VI  GG+T++ + WHKECFLC+ C ++L    F SKDD PFC DCY +L++KKC  CTKPITG  G KFI   DR WHSECF C KC  SLVG GFLT    I+C +CG  
Sbjct:    2 TSSQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCGSG 279          

HSP 2 Score: 142.51 bits (358), Expect = 1.004e-38
Identity = 73/224 (32.59%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F C  C+ SL+ K +  KDD L+C  CY+  F+  C+ C    ++ ++   Y+ R WHE CF C +C   +  K F+ +D++ +C  CY N+ + +C  C   I  G   + +KG  WH+ CF+C  C Q + +    SK+   +C  C+   F+  C  C K IT  G    I+  D+ WH ECF CS C   L    F++  D   C +C  +   K    C
Sbjct:    6 FDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGG----ITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAAC 225          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|O70433|FHL2_MOUSE (Four and a half LIM domains protein 2 OS=Mus musculus OX=10090 GN=Fhl2 PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 1.259e-114
Identity = 150/276 (54.35%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YILK++ PHC+ C+EE +AN C+ C   IGCD KDLS+K+RHWHE CF CS C  SLVDKPFA K++ L C DCY ++++++C  C      G RK EY+G  WHE CF C  CQQPIG KSFIP++NQ  CV CYE ++A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++D+ P+C  C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYREQPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 79.7221 bits (195), Expect = 1.976e-15
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D+ P+CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|O35115|FHL2_RAT (Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.697e-114
Identity = 149/276 (53.99%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YILK++ PHC+ C+EE +AN C+ C   IGCD KDLS+K+RHWHE CF CS C  SLVDKPFA K++ L C DCY ++++++C  C      G RK EY+G  WHE CF C  CQQPIG KSFIP++NQ  CV CYE ++A +C +C   I  GGVTY+ +PWH+ECF+CT C +QL+  +FT++D+ P+C  C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLYGKKYILKEENPHCVACFEELYANTCEECGTPIGCDCKDLSYKDRHWHEGCFHCSRCGSSLVDKPFAAKEEQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYALQCVQCKKPITTGGVTYRDQPWHRECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 79.7221 bits (195), Expect = 2.092e-15
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D+ P+CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 RECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q14192|FHL2_HUMAN (Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3)

HSP 1 Score: 339.347 bits (869), Expect = 3.353e-114
Identity = 151/276 (54.71%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C +SL G +YIL+++ P+C+ C+E  FAN C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY ++++++C  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+DNQ  CV CYE + A +C +C   I  GGVTY+ +PWHKECF+CT C +QL+  +FT++DD  +C +C+ +L++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.485 bits (184), Expect = 5.458e-14
Identity = 39/93 (41.94%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D   +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 KECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q2KI95|FHL2_BOVIN (Four and a half LIM domains protein 2 OS=Bos taurus OX=9913 GN=FHL2 PE=2 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 6.256e-110
Identity = 145/276 (52.54%), Postives = 199/276 (72.10%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C +C+ SL G +Y+L+++ P+C+ C+E  FA+ C+ C   IGCD KDLS+K+RHWHEACF CS C  SLVDKPFA K+D L C DCY  ++++RC  C      G RK EY+G  WHE CF+C  CQQPIG KSFIP+D++  CV CYE ++A +C +C   I  GGVTY+ +PWH+ECF+CT C + L+  +FTS+D+  +C  C+ +L++KKC  C  PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CP+CG++
Sbjct:    3 ERFDCHHCEDSLFGRKYVLREEQPYCVACFEALFASTCEECGKLIGCDCKDLSYKDRHWHEACFHCSRCRGSLVDKPFAAKEDQLLCTDCYSQEYSSRCQECKKSIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDSENFCVPCYERQYALQCVQCKKPITTGGVTYREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKD 278          

HSP 2 Score: 75.8702 bits (185), Expect = 4.439e-14
Identity = 39/93 (41.94%), Postives = 56/93 (60.22%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            +E F C  C+K L+G R+  +D+  +CL C+ + +A KC  C + I     +K +SF+ER WH  CF C  CS SLV + F T+ D + CPDC
Sbjct:  183 RECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCAGCANPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275          
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Match: sp|Q3ZBI6|FHL3_BOVIN (Four and a half LIM domains protein 3 OS=Bos taurus OX=9913 GN=FHL3 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 3.836e-104
Identity = 137/275 (49.82%), Postives = 190/275 (69.09%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            E F C  C +SL G +YI  D  P+C+PCY+  FAN C  C+  IG DS++L +++RH+HE CF C  C  SL D+PF  +D  L C DCY S F+++C ACG     G+RK EY G+ WHE+CF+C+ C+QP+G++SF+P      CV CYENKFA RC +C+  + +GGVTY+ +PWH+EC +CT C   LA  +FTS++D P+C  C+  LF+ KC+ C +PITG GG K++S +DRHWH  CF+C++C TSLVG+GF+ D D ++C  C Q
Sbjct:    3 EAFDCAKCSESLYGRKYIQTDDGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 2 Score: 102.449 bits (254), Expect = 2.911e-23
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query:  220 RKSEMENQNTQE-IFSCQNCQKSLTGNRYILKDKLPH-CLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGN-IFKAGARKY-EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYE 711
            RK E   Q   E  F C  C++ L G+R  + DK  H C+PCYE KFA +C RC   +      ++++++ WH  C +C+ C   L  + F +++D  +C  C+   FA +C +C   I   G  KY  +  R WH +CF CA C   +  + F+P  +Q +C  C +
Sbjct:  113 RKLEYGGQTWHEHCFLCSGCEQPL-GSRSFVPDKGAHYCVPCYENKFAPRCARCSKTL--TQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQ 277          

HSP 3 Score: 95.1301 bits (235), Expect = 1.011e-20
Identity = 51/154 (33.12%), Postives = 78/154 (50.65%), Query Frame = 1
Query:  625 FVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            F CA+C + +  + +I  D+   CV CY+N FA  C +C  +I      + Y+   +H+ CF C  C + LA   FT +D +  C DCY + FS +C+ C + +    G + +    + WH  CF CS C+  L  R F+ DK    C  C +N
Sbjct:    5 FDCAKCSESLYGRKYIQTDDGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETV--MPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYEN 156          

HSP 4 Score: 72.4034 bits (176), Expect = 5.857e-13
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGC--DSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYES 531
            +E   C  CQ  L G ++  ++  P+C+ C+ E FA KC  CK  I      K +SF++RHWH +CF C+ CS SLV + F    D + C  C ++
Sbjct:  183 RECLVCTGCQTPLAGQQFTSREDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQA 278          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A564Y216 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2074 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.366e-150
Identity = 202/282 (71.63%), Postives = 242/282 (85.82%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            M+ ++    F+C++C  SLTG RYIL+D+ PHCL CYE KFAN C++CK+KIGCDSKDLSFKERHWHE CF CS+C+ SL D+PFATKDD LFC DCY+ +FA RCD C  +FKAG RKYEYRG+QWHE CFVC EC+QPIGAKSFIPR+NQ VCV CYE K+AQRC+KC++VIR+GGVTYKG PWHKECF CT C +QLA LKFTSKD++P+CADC+ +LF+KKCTKC KPITGFGGCKFIS +DRHWHSECF CSKC+T+LVGRGFLT++D I+C +CG+
Sbjct:    1 MDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLFCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRENQVVCVPCYEQKYAQRCSKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCFGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCNTNLVGRGFLTNEDQIMCSDCGR 282          
BLAST of Four and A half lim domains vs. TrEMBL
Match: G4VSB7 (LIMPETin; Putative four and A half lim domains OS=Schistosoma mansoni OX=6183 GN=Smp_048560 PE=4 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 4.029e-150
Identity = 201/282 (71.28%), Postives = 237/282 (84.04%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            ME ++    F+C +C  SLTG RYIL+D  PHCL CYE KFAN C++CK+KIGCDSKDLSFKERHWHE CF CS+C+ SL D+PFATK++ L+C DCY+ +FA RCD C  +FKAG RKYEYRG+QWHE CF+C EC+QPIGAKSFIPR+NQ VCV CYE K+AQRCTKC++VIR+GGVTYKG PWHKECF CT C +QLA LKFTSKD++P+CADCY  LF+KKCTKCTKPITGFGGCKFIS +DRHWHSECF C KC+++LVGRGFLT  D I+C ECG+
Sbjct:    1 MEQEHHTGHFACHSCDVSLTGQRYILRDDEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACTTSLADRPFATKEEQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFLCVECKQPIGAKSFIPRENQVVCVPCYEAKYAQRCTKCSEVIRRGGVTYKGNPWHKECFTCTSCSKQLAGLKFTSKDEQPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEDRHWHSECFLCGKCNSNLVGRGFLTSDDMIMCSECGR 282          
BLAST of Four and A half lim domains vs. TrEMBL
Match: A0A068Y1Z9 (Four and A half lim domains OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 3.325e-149
Identity = 204/282 (72.34%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            M+ ++    F+C++C  SLTG RYIL+D+ PHCL CYE KFAN C++CK+KIGCDSKDLSFKERHWHE CF CS+C+ SL D+PFATKDD L+C DCY+ +FA RCD C  +FKAG RKYEYRG+QWHE CFVC EC+QPIGAKSFIPRDNQ VCV CYE K+AQRCTKC++VIR+GGVTYKG PWHKECF CT C +QLA LKFTSKD++P+CADCY +LF+KKCTKC KPITGFGGCKFIS +DRHWHSECF CSKCD +LVGRGFLT++D I+C +CG+
Sbjct:  271 MDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRDNQVVCVPCYEAKYAQRCTKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCDCNLVGRGFLTNEDQIMCSDCGR 552          
BLAST of Four and A half lim domains vs. TrEMBL
Match: U6J6Y3 (Four and a half LIM domains protein 2 OS=Echinococcus granulosus OX=6210 GN=EGR_09187 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 3.398e-149
Identity = 204/282 (72.34%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            M+ ++    F+C++C  SLTG RYIL+D+ PHCL CYE KFAN C++CK+KIGCDSKDLSFKERHWHE CF CS+C+ SL D+PFATKDD L+C DCY+ +FA RCD C  +FKAG RKYEYRG+QWHE CFVC EC+QPIGAKSFIPRDNQ VCV CYE K+AQRCTKC++VIR+GGVTYKG PWHKECF CT C +QLA LKFTSKD++P+CADCY +LF+KKCTKC KPITGFGGCKFIS +DRHWHSECF CSKCD +LVGRGFLT++D I+C +CG+
Sbjct:  271 MDQEHHTGHFACRSCDVSLTGQRYILRDEEPHCLACYEAKFANTCEQCKEKIGCDSKDLSFKERHWHEKCFKCSACNTSLADRPFATKDDQLYCSDCYDERFAARCDGCQGVFKAGMRKYEYRGQQWHEECFVCVECKQPIGAKSFIPRDNQVVCVPCYEAKYAQRCTKCSEVIRRGGVTYKGNPWHKECFTCTSCGKQLAGLKFTSKDEQPYCADCYGDLFAKKCTKCGKPITGFGGCKFISFEDRHWHSECFACSKCDCNLVGRGFLTNEDQIMCSDCGR 552          
BLAST of Four and A half lim domains vs. TrEMBL
Match: I1ZII2 (Four and a half LIM domains-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 7.009e-149
Identity = 201/273 (73.63%), Postives = 237/273 (86.81%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F+C+NC  SLTG+RYILK++ PHC+ CYE KFAN C++CK+KIGCDSKDLSFK+RHWHE CF C  C  SLVD+PFATKD+ LFC +CY++KFA RCD C  +FKAG RKYEYRG+QWHE CF+C EC+QPIGAKSFIPRD Q +CV CYENK+AQ+C+KC +VIR+GGVTYKG PWHKECF CT C +QLA +KFTSKDDKP+CADCY  LF+KKCTKCTKPITGFGGCKFIS + RHWHSECFTCSKC T+LVGRGFLT++D I+CP+CG+
Sbjct:    1 FACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDCGR 273          

HSP 2 Score: 146.362 bits (368), Expect = 5.130e-37
Identity = 71/215 (33.02%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADC 882
            ++ F C  C  SL    +  KD+   C  CY+ KFA +CD C        +   ++ + WHE CFLC  C + +  K F  +D  + C  CYE+K+A +C  C  + + G     Y+G  WH+ CF C  C + +    F  +D++  C  CY   FA++CTKC   I   G    ++++G  WH ECF C++C   L    F + +D   C DC
Sbjct:   59 EKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGG--VTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDC 271          

HSP 3 Score: 99.3673 bits (246), Expect = 9.125e-20
Identity = 51/154 (33.12%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  625 FVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVI--RKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            F C  C   +    +I ++    C+ CYE KFA  C +C + I      +++K   WH++CF C ECH  L    F +KD+  FC++CY N F+ +C  CTK      G +      + WH ECF C +C   +  + F+     IIC  C +N
Sbjct:    1 FACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKA--GMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYEN 152          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl2a (four and a half LIM domains protein 2 [Source:NCBI gene;Acc:103031012])

HSP 1 Score: 336.65 bits (862), Expect = 5.183e-114
Identity = 148/276 (53.62%), Postives = 201/276 (72.83%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L+++ P+C+ CYE  ++N C+ CK  IGC+S+DLS+K+RHWHE CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C  C   I  GGVTY  +PWHK+CFLCT C QQL+  +FTS+DD  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEECFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPITTGGVTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKD 278          

HSP 2 Score: 131.724 bits (330), Expect = 5.787e-35
Identity = 68/219 (31.05%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            +E F C  C++SL    +  KD+   C  CY  ++++KC  CK  I   S+ +  K   WHE CF C  C + +  K F  KD+  +C  CYE +FA +C  C      G     Y  + WH++CF+C  C+Q +  + F  RD+   C++C+ N +A++C  C   I   G    ++++   WH +CF C +C   L    F ++ D   C +C  ++
Sbjct:   63 EECFHCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGNSWHETCFTCKRCQQPIGTKSFIPKDNNNYCVPCYEKQFAMQCVHCKKPITTGG--VTYHDQPWHKDCFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYAKKCASCTSPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:103023824])

HSP 1 Score: 330.102 bits (845), Expect = 1.499e-111
Identity = 152/276 (55.07%), Postives = 196/276 (71.01%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C NC++SL G +YI  +  P+C+PCY+  FAN CD CK+ IG D+++L +++RH+HE CF C  C  SL D+PF ++DD L C DCY ++F+++C AC      G RK EY G  WHE CF+C  C+QPIG+KSFIP  +   CV CYENKFA RCT+C  V+ KGGVTY+ EPWHKECFLCT C  QLA   FTS+DD P+C  C+ NL++KKC  C+KPITGFGG K+IS ++R WH  CFTCS+C  SLVG GF  ++D I+C +C  N
Sbjct:    3 ERFDCDNCKESLYGRKYIQAEDNPYCIPCYDSLFANTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLAKGGVTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDCNSN 278          

HSP 2 Score: 143.28 bits (360), Expect = 2.944e-39
Identity = 75/219 (34.25%), Postives = 111/219 (50.68%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            F C +C ESL  + +   +D  +C  CY+S FA  CD C  +    AR+  Y  R +HE+CF C  C + +  + F  +D+  +C  CY N+F+ +C  C+  +  G   + Y G  WH+ CF+C  C Q + S  F    D  +C  CY N F+ +CT+C K +   GG   ++  D  WH ECF C+ C   L G+ F +  D   C +C  N   K
Sbjct:    5 FDCDNCKESLYGRKYIQAEDNPYCIPCYDSLFANTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRC-KQVLAKGG---VTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAK 219          

HSP 3 Score: 134.035 bits (336), Expect = 9.198e-36
Identity = 69/216 (31.94%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            F C  C +SL    +  +D    C  CY  +F++KC  C   +   ++ L +    WHE CF+C+SC + +  K F    D  +C  CYE+KFA RC  C  +   G     YR   WH+ CF+C  C+  +  + F  RD+   C+ C+ N +A++C  C+  I   G    ++++   WH+ CF C+ C   L    F  + D+  C DC +NL
Sbjct:   66 FRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYGGSTWHEGCFICNSCEQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQVLAKGG--VTYRDEPWHKECFLCTGCKVQLAGQHFTSRDDSPYCLKCFGNLYAKKCEACSKPITGFGGGKYISFEERQWHQTCFTCSRCSVSLVGAGFFPERDEILCRDCNSNL 279          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl2b (four and a half LIM domains 2b [Source:ZFIN;Acc:ZDB-GENE-041010-121])

HSP 1 Score: 271.552 bits (693), Expect = 7.045e-89
Identity = 127/276 (46.01%), Postives = 184/276 (66.67%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L+++ P+C+ CYE  ++N C+ CK  I C+S+DLS+K+RHWH+ CF C  C+ SLVDKPF+TK++ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV C+E +FA +C +C  V      T        +CFLCT C +QL+  +FTS+DD P+C +C+ NL++KKC+ CT PI+G GG K+IS ++R WH++CF C KC             D I+CP+CG+N
Sbjct:    3 ERYDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPICCNSRDLSYKDRHWHDDCFHCFKCNRSLVDKPFSTKNEELLCTECYSNEYSSKCYECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNANYCVPCFEKQFALQCVQCKKVHTVYNST--------DCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSCTSPISGLGGSKYISFEERQWHNDCFNCKKCSI-----------DDILCPDCGKN 259          

HSP 2 Score: 120.168 bits (300), Expect = 6.661e-31
Identity = 64/224 (28.57%), Postives = 106/224 (47.32%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            + C  C ESL  K +  +++  +C  CYES ++  C+ C       +R   Y+ R WH++CF C +C + +  K F  ++ + +C  CY N+++ +C +C   I  G   + +KG  WH+ CF C  C Q + +  F  KD+  +C  C+   F+ +C +C K  T +              ++CF C+ C   L G+ F +  D   C  C  N   K    C
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPICCNSRDLSYKDRHWHDDCFHCFKCNRSLVDKPFSTKNEELLCTECYSNEYSSKCYECKKTIMPGSRKMEHKGNSWHETCFTCQRCQQPIGTKSFIPKDNANYCVPCFEKQFALQCVQCKKVHTVYNS------------TDCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSC 216          

HSP 3 Score: 61.2326 bits (147), Expect = 3.376e-10
Identity = 37/95 (38.95%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  244 NTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIG--CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            N+ + F C  C++ L+G R+  +D  P+CL C+   +A KC  C   I     SK +SF+ER WH  CF C  CS           DD+L CPDC
Sbjct:  173 NSTDCFLCTGCKEQLSGQRFTSRDDFPYCLNCFCNLYAKKCSSCTSPISGLGGSKYISFEERQWHNDCFNCKKCS----------IDDIL-CPDC 256          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl1b (four and a half LIM domains protein 1 [Source:NCBI gene;Acc:103032814])

HSP 1 Score: 233.802 bits (595), Expect = 7.600e-74
Identity = 112/274 (40.88%), Postives = 160/274 (58.39%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFG-GCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C+  L G +YI KD  P C+ C+E+  AN C  C+  IG DSK+L  K R+WHE CF C  C ++L  + F+TKDD + C  C   + A RC  C     AG    EY+G  +HE CF C +C++PI ++SF+ +++   C SC+E KFA++C  C   I  GGV Y+ +PWH  CF+C  C + LA  +FTS +D+ +C DCY N  +KKC+ C  PITGFG     ++ +   WH  CF C KC  +L  + F++    + C +C +
Sbjct:    5 FDCFYCRDHLGGKKYIKKDDRPVCVRCFEKFCANTCTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDRILCGKCSSREDAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQCAGCKKAITSGGVNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKKCSACQNPITGFGKATNVVNYEGGTWHDYCFNCRKCSLNLSDKRFVSKNGDVYCSDCSK 278          

HSP 2 Score: 137.502 bits (345), Expect = 5.545e-37
Identity = 71/216 (32.87%), Postives = 111/216 (51.39%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG-----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADC 882
            ++ F C  C K+L    +  KD    C  C   + A +C  C   I   ++++ +K   +HE CF C  C + +  + F TK+D ++C  C+E KFA +C  C     +G     Y+ + WH  CFVCA CQ+P+    F   +++  CV CY+N  A++C+ C + I   G     V Y+G  WH  CF C +C   L+  +F SK+   +C+DC
Sbjct:   63 EDCFRCYKCYKNLAKESFSTKDDRILCGKCSSREDAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQCAGCKKAITSGG--VNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKKCSACQNPITGFGKATNVVNYEGGTWHDYCFNCRKCSLNLSDKRFVSKNGDVYCSDC 276          

HSP 3 Score: 136.346 bits (342), Expect = 1.084e-36
Identity = 75/224 (33.48%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKG--GVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F C  C + L  K +  KDD   C  C+E   A  C  C       +++  ++GR WHE+CF C +C + +  +SF  +D++ +C  C   + A RC  C   I  G   V YKG  +H+ECF C +C + ++S  F +K+D  +C  C+   F+K+C  C K IT  G    ++  D+ WHS CF C+ C   L G  F + +D + C +C +N + K    C
Sbjct:    5 FDCFYCRDHLGGKKYIKKDDRPVCVRCFEKFCANTCTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDRILCGKCSSREDAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQCAGCKKAITSGG----VNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKKCSAC 224          
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Match: fhl1b (four and a half LIM domains protein 1 [Source:NCBI gene;Acc:103032814])

HSP 1 Score: 234.187 bits (596), Expect = 3.282e-73
Identity = 112/274 (40.88%), Postives = 160/274 (58.39%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFG-GCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            F C  C+  L G +YI KD  P C+ C+E+  AN C  C+  IG DSK+L  K R+WHE CF C  C ++L  + F+TKDD + C  C   + A RC  C     AG    EY+G  +HE CF C +C++PI ++SF+ +++   C SC+E KFA++C  C   I  GGV Y+ +PWH  CF+C  C + LA  +FTS +D+ +C DCY N  +KKC+ C  PITGFG     ++ +   WH  CF C KC  +L  + F++    + C +C +
Sbjct:   65 FDCFYCRDHLGGKKYIKKDDRPVCVRCFEKFCANTCTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDRILCGKCSSREDAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQCAGCKKAITSGGVNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKKCSACQNPITGFGKATNVVNYEGGTWHDYCFNCRKCSLNLSDKRFVSKNGDVYCSDCSK 338          

HSP 2 Score: 135.961 bits (341), Expect = 6.200e-36
Identity = 75/224 (33.48%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKG--GVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F C  C + L  K +  KDD   C  C+E   A  C  C       +++  ++GR WHE+CF C +C + +  +SF  +D++ +C  C   + A RC  C   I  G   V YKG  +H+ECF C +C + ++S  F +K+D  +C  C+   F+K+C  C K IT  G    ++  D+ WHS CF C+ C   L G  F + +D + C +C +N + K    C
Sbjct:   65 FDCFYCRDHLGGKKYIKKDDRPVCVRCFEKFCANTCTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDRILCGKCSSREDAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQCAGCKKAITSGG----VNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKKCSAC 284          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl5 (four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB-GENE-040822-3])

HSP 1 Score: 189.504 bits (480), Expect = 1.134e-58
Identity = 84/174 (48.28%), Postives = 117/174 (67.24%), Query Frame = 1
Query:  247 TQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFK-AGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG 765
              E + C  C++SL G +Y+L+++ P+C+ CYE  + + C+ CK  IGCDSKDLS+K+RHWHE CF C++C  SL DK F+ +D+ L C +C+ + ++ +C     +F   G RK E+RG  WHE CF CA CQQPIG+KSF+PR+    CV CYE +FAQ CT C  V  +GG
Sbjct:    9 ASERYDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEGG 182          

HSP 2 Score: 111.694 bits (278), Expect = 3.121e-29
Identity = 52/171 (30.41%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG---VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGG 945
            + C  C ESL+ K +  +++  +C  CYE+ +   C++C       ++   Y+ R WHE CF CA C++ +  K+F  RD + +C  C+ N ++ +C   + +    G   + ++G  WH+ CF C  C Q + S  F  ++   +C  CY   F++ CT C K + G GG
Sbjct:   13 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKK-VGGEGG 182          

HSP 3 Score: 87.4261 bits (215), Expect = 2.138e-20
Identity = 50/175 (28.57%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  559 GNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIR--KGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLT---DKDCIICPE 1068
            G+I K  + +Y+            C  C++ +  K ++ R+    CV CYE  +   C  C   I      ++YK   WH+ CF C  C + LA   F+++D+K  C +C+AN +S KC   +K  +  G  K +      WH  CF C++C   +  + F+    D+ C+ C E
Sbjct:    3 GDIIKMASERYD------------CHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAGISKLFSPVGTRK-MEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYE 164          

HSP 4 Score: 67.3958 bits (163), Expect = 1.660e-13
Identity = 34/97 (35.05%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  796 ECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGC--KFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C + L   K+  +++ P+C  CY  L++  C  C +PI    GC  K +S  DRHWH  CF C+ C+ SL  + F    + ++C EC  N
Sbjct:   11 ERYDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPI----GCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHAN 103          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl5 (four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB-GENE-040822-3])

HSP 1 Score: 189.119 bits (479), Expect = 1.773e-58
Identity = 86/175 (49.14%), Postives = 118/175 (67.43%), Query Frame = 1
Query:  247 TQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVT 771
              E + C  C++SL G +Y+L+++ P+C+ CYE  + + C+ CK  IGCDSKDLS+K+RHWHE CF C++C  SL DK F+ +D+ L C +C+ + ++ +C A  N    G RK E+RG  WHE CF CA CQQPIG+KSF+PR+    CV CYE +FAQ CT C  V  +GG T
Sbjct:    2 ASERYDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAA--NPNPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKKVGGEGGPT 174          

HSP 2 Score: 113.62 bits (283), Expect = 8.791e-30
Identity = 52/171 (30.41%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  448 CSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFIS 960
            C  C ESL+ K +  +++  +C  CYE+ +   C++C       ++   Y+ R WHE CF CA C++ +  K+F  RD + +C  C+ N ++ +C    + +    + ++G  WH+ CF C  C Q + S  F  ++   +C  CY   F++ CT C K + G GG   +S
Sbjct:    8 CHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPVGTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYEKQFAQHCTLCKK-VGGEGGPTRLS 177          

HSP 3 Score: 86.2705 bits (212), Expect = 5.211e-20
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  625 FVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIR--KGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLT---DKDCIICPE 1068
            + C  C++ +  K ++ R+    CV CYE  +   C  C   I      ++YK   WH+ CF C  C + LA   F+++D+K  C +C+AN +S KC     P+    G + +      WH  CF C++C   +  + F+    D+ C+ C E
Sbjct:    6 YDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPIGCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHANHYSAKCAANPNPV----GTRKMEFRGSSWHETCFGCARCQQPIGSKSFVPREKDQYCVPCYE 154          

HSP 4 Score: 67.3958 bits (163), Expect = 2.381e-13
Identity = 34/97 (35.05%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  796 ECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGC--KFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C + L   K+  +++ P+C  CY  L++  C  C +PI    GC  K +S  DRHWH  CF C+ C+ SL  + F    + ++C EC  N
Sbjct:    4 ERYDCHYCKESLLGKKYVLREENPYCVRCYETLYTHACESCKQPI----GCDSKDLSYKDRHWHEGCFKCATCERSLADKAFSARDEKLLCTECHAN 96          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: fhl3b (four and a half LIM domains 3b [Source:ZFIN;Acc:ZDB-GENE-030131-8356])

HSP 1 Score: 178.718 bits (452), Expect = 5.853e-54
Identity = 86/229 (37.55%), Postives = 121/229 (52.84%), Query Frame = 1
Query:  406 LSFKERHWHEACFLCSSCSESL-VDKPFATKDDLLFCPDCYESK---FATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            LS    HWHE CF CS C+  +     +  +   + C  C  S        C +C    + G  K  Y+GR WHE CF CA C + IG KSF+P  ++  CVSC E K A RC  C+  + + GV YK   +H+EC +C  C+  LA +   ++ +  +C  C+   +SKKCT C KPIT   G KF++ D   WH+ECF C +C  ++ G+GF+   D I C +C   
Sbjct:    2 LSLDNLHWHEGCFKCSECATPIGAATEYLLEGKEIVCKTCATSPAGDMGDSCVSCKRGIREGVAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHKPVTEKGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCANQ 230          

HSP 2 Score: 111.694 bits (278), Expect = 9.778e-29
Identity = 68/233 (29.18%), Postives = 99/233 (42.49%), Query Frame = 1
Query:  223 KSEMENQNTQE-IFSCQNCQKSL-TGNRYILKDKLPHCLPCYEEK---FANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            K  ++N +  E  F C  C   +     Y+L+ K   C  C         + C  CK  I      +++K R WHE CF C+ C E++  K F    D ++C  C E K ATRC  C        +   Y+   +H  C VC  C  P+   +   R     C  C+E K++++CT C   I        +T+    WH ECF C  C   +A   F ++ D  FC DC   +
Sbjct:    1 KLSLDNLHWHEGCFKCSECATPIGAATEYLLEGKEIVCKTCATSPAGDMGDSCVSCKRGIREGVAKVAYKGRTWHERCFACARCMETIGTKSFVPHGDEIYCVSCNEKKTATRCFTCHK--PVTEKGVVYKEHTYHRECLVCIGCNTPLAGMNMCTRGELLYCEPCFEKKYSKKCTSCRKPITSAAGAKFLTHDSLEWHTECFKCKRCGLNMAGKGFVARGDDIFCGDCANQI 231          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 113.235 bits (282), Expect = 2.398e-29
Identity = 67/217 (30.88%), Postives = 92/217 (42.40%), Query Frame = 1
Query:  421 RHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            R WH   F+C  C   +  + F  KD   +C + Y S F+ RC  C        R      R WH   F CA+C +P G + F  RD +  C   Y   FA +C  C+  I +  ++     WH ECF+C EC     +  F   + +P+C   Y       C+ C KPITG    + IS   + +H E F C+ C   L    F    D   C  C
Sbjct:    8 RTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITG----RCISAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQPC 220          

HSP 2 Score: 106.686 bits (265), Expect = 6.098e-27
Identity = 60/217 (27.65%), Postives = 96/217 (44.24%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKY-EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFS 900
            E F C +CQ  +    +  KD  P+C   Y   F+ +C  C + +  + + ++  +R WH   F C+ C     ++ F  +D   +C   Y   FA +C+ C    +A  + Y       WH  CF+C EC  P    SF   + Q  C   Y  +    C+ C   I    ++   + +H E F+C  C +QL    F  ++DKP+C  C+  LF 
Sbjct:   13 EHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCS---RAIMQNYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITGRCISAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQPCFIKLFG 226          

HSP 3 Score: 100.523 bits (249), Expect = 9.221e-25
Identity = 51/156 (32.69%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  601 GRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVI--RKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIIC 1062
            GR WH   FVC  CQ  IG+++F  +D Q  C   Y + F+ RC  CN+ +   +  VT     WH E F C +C +      F  +D KP+C   Y  +F+ KC  C++ I       ++S  +  WH ECF C +C T  +   F   +    C
Sbjct:    7 GRTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVMDNQRVVTALDRTWHPEHFFCAQCGRPFGEEGFHERDGKPYCRQDYYGMFAPKCNGCSRAIMQ----NYLSALNTVWHPECFICRECFTPFINGSFFEHEGQPYC 158          

HSP 4 Score: 65.4698 bits (158), Expect = 1.404e-12
Identity = 31/90 (34.44%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  766 VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGF 1035
            VT  G  WH E F+C  C  ++ S  F  KD +P+C + Y +LFS +C  C + +      + ++  DR WH E F C++C       GF
Sbjct:    3 VTAMGRTWHPEHFVCVHCQVEIGSRNFFEKDGQPYCEEDYHSLFSPRCAYCNEAVM--DNQRVVTALDRTWHPEHFFCAQCGRPFGEEGF 90          
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Match: PXN (paxillin [Source:HGNC Symbol;Acc:HGNC:9718])

HSP 1 Score: 101.293 bits (251), Expect = 2.078e-23
Identity = 54/146 (36.99%), Postives = 69/146 (47.26%), Query Frame = 1
Query:  601 GRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFL 1038
            GR WH   FVC ECQ+ IGA++F  RD    C   Y   F+ RC  C+  I    VT   + WH E F C +C        F  KD KP+C   Y  +F+ KC  C++ I       +IS     WH ECF C +C T  +   F 
Sbjct:  338 GRTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPILDKVVTALDKTWHPEHFFCVQCGHFFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCSRAIV----ENYISALSALWHPECFVCRECFTPFINGSFF 479          

HSP 2 Score: 98.5969 bits (244), Expect = 1.913e-22
Identity = 65/217 (29.95%), Postives = 92/217 (42.40%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKY-EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFS 900
            E F C  CQ+ +    +  +D LP+C   Y   F+ +C  C   I    K ++  ++ WH   F C  C     D+ F  KD   +C   Y   FA +C  C    +A    Y       WH  CFVC EC  P    SF   + Q  C   Y  +    C+ C   I    +T   + +H E F+C  C +QL    F  ++DKP+C  C+  LF 
Sbjct:  344 EHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPI--LDKVVTALDKTWHPEHFFCVQCGHFFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCS---RAIVENYISALSALWHPECFVCRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPCFIKLFG 555          

HSP 3 Score: 93.5893 bits (231), Expect = 8.894e-21
Identity = 63/218 (28.90%), Postives = 92/218 (42.20%), Query Frame = 1
Query:  421 RHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDAC-GNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            R WH   F+C+ C E +  + F  +D L +C   Y   F+ RC  C G I        +   + WH   F C +C    G + F  +D +  C   Y   FA +C  C+  I +  ++     WH ECF+C EC     +  F   + +P+C   Y       C+ C KPITG    + I+   + +H E F C+ C   L    F    D   C  C
Sbjct:  339 RTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPILDKVVTALD---KTWHPEHFFCVQCGHFFGDEGFHEKDGKPYCRQDYFEMFAPKCGGCSRAIVENYISALSALWHPECFVCRECFTPFINGSFFEHEGQPYCEVHYHERRGSLCSGCQKPITG----RCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPC 549          

HSP 4 Score: 68.9366 bits (167), Expect = 8.678e-13
Identity = 36/103 (34.95%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  727 RCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGF 1035
            +C  C   I    VT  G  WH E F+CTEC +++ +  F  +D  P+C   Y  LFS +C  C+ PI      K ++  D+ WH E F C +C       GF
Sbjct:  321 QCAACLKPIAGQVVTAMGRTWHPEHFVCTECQEEIGARNFFERDGLPYCEKDYHFLFSPRCAYCSGPILD----KVVTALDKTWHPEHFFCVQCGHFFGDEGF 419          
BLAST of Four and A half lim domains vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 47.3654 bits (111), Expect = 3.629e-6
Identity = 45/160 (28.12%), Postives = 64/160 (40.00%), Query Frame = 1
Query:  364 CDRCKDKIGCDSK----DLSFKERHWHEACFLCSSCSESLVDKPFA-----TKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTY-KGEP---WHKECF 804
            C RC   +  DS+     L    +++HE+CF C  C + L  K F      T + +L C   Y  +    C  C    +     Y   G ++ E  F C  C  P G K      NQ  C   +   F++RC  C   I    + + KGE    WH EC+
Sbjct:   28 CARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYFRRHNLLCHVCDTPLRG--LYYTAFGYRYDEEHFSCTICATPCGVKKCFMYGNQLYCKYHFLKYFSKRCKGCEFPISDQYIEFPKGEEIHCWHPECY 185          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO41100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D2])

HSP 1 Score: 224.172 bits (570), Expect = 1.346e-67
Identity = 107/274 (39.05%), Postives = 164/274 (59.85%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKE-RHWHEACFLCSSCSESL-VDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECG 1074
            F CQ C  S+TG ++I++   P C  C+++ +A++C+ C  KIG +S+D+S  + RHWH+ CF+C  C   L  +    + +    C  CY + +   C ACG I  +GA + EY G  WHENCF CA C + IG   F+P+D+   C  CY++KF++RC  C + + +GGV Y GE WHK CF C  CH+ LAS  F+ +D   +C +CY   ++K+C  C K I G    ++ +L++ ++H ECF CS+C  SL   GF+ + D ++C +C 
Sbjct:  257 FQCQTCDHSITGRQFIVRGDKPVCTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTETKSCCNKCYVANYQKECCACGQIIDSGASRLEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSKRCASCGEPLLEGGVLYNGETWHKACFSCYFCHRSLASAAFSVRDGCRYCMECYGKFYAKQCEICLKAIVGG---EYYTLEESNFHKECFMCSRCGRSLASEGFVREGDELLCGDCA 527          

HSP 2 Score: 133.65 bits (335), Expect = 2.746e-34
Identity = 78/275 (28.36%), Postives = 124/275 (45.09%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEY-RGRQWHENCFVCAECQQPIGAK-SFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            F+C+ C + L    Y       +C   + E   ++C  C + I      ++   ++WH   F C +C  S+  + F  + D   C DC++  +A  C+AC       +R       R WH+ CF+C  C++P+ ++ S    + ++ C  CY   + + C  C  +I  G   + Y G  WH+ CF C  C + + +  F  KDD  FC  CY + FSK+C  C +P+   G    +  +   WH  CF+C  C  SL    F     C  C EC
Sbjct:  197 FTCETCNELLVELTYFQHADKVYCGRHFAELQKSRCGGCDELIFTGEYTVAMN-KNWHLGHFQCQTCDHSITGRQFIVRGDKPVCTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTETKSCCNKCYVANYQKECCACGQIIDSGASRLEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSKRCASCGEPLLEGG----VLYNGETWHKACFSCYFCHRSLASAAFSVRDGCRYCMEC 466          

HSP 3 Score: 102.064 bits (253), Expect = 2.209e-23
Identity = 63/229 (27.51%), Postives = 96/229 (41.92%), Query Frame = 1
Query:  418 ERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEP---WHKECFLCTECHQQLASL-KFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            E  +H  CF C +C+E LV+  +    D ++C   +     +RC  C  +   G        + WH   F C  C   I  + FI R ++ VC  C+++ +A  C  C+  I         +    WH +CF+C  C + L S     S + K  C  CY   + K+C  C + I    G   +      WH  CF C+ C  ++   GF+   D   CP C Q+   K
Sbjct:  189 EASFHPGCFTCETCNELLVELTYFQHADKVYCGRHFAELQKSRCGGCDELIFTGEYTVAMN-KNWHLGHFQCQTCDHSITGRQFIVRGDKPVCTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTETKSCCNKCYVANYQKECCACGQIID--SGASRLEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSK 414          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: LIMPET (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX6])

HSP 1 Score: 218.009 bits (554), Expect = 4.513e-65
Identity = 106/269 (39.41%), Postives = 158/269 (58.74%), Query Frame = 1
Query:  265 CQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            C  C +SL+  +++  +  P C  CY+E FAN+C+ C + IG  SKD+  + +HWHE CF CS CS+ L+++ F  KD+ L C  C     +  C AC   F  G +K  Y+ + +H+ CF+C EC+QPIG+K FI RD + +C +C+++KFA+ C KCN VI+   V + G  +H ECF C  C + LA   FT ++ +  C +CY   ++K+C  C   I   G  KF++ D++++H ECFTC KC+  L G  F       IC  C
Sbjct:  285 CSYCDESLSNQKFVTVEGSPSCFRCYDENFANRCEACGEPIGPGSKDVDVRSKHWHEGCFKCSQCSKQLMNEGFTLKDEKLICHGCRGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKVCVKCNQVIKTSSVQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQNCYRERYAKRCGACHNLIE--GNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRIRDGEKICLPC 551          

HSP 2 Score: 145.591 bits (366), Expect = 2.315e-38
Identity = 87/285 (30.53%), Postives = 137/285 (48.07%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKG--GVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            F+C+   + L    Y  KD   +C   + EK   +C  C++ I       +  E++WH     CS C ESL ++ F T +    C  CY+  FA RC+ACG     G++  + R + WHE CF C++C + +  + F  +D + +C  C     ++ C  CN     G   V Y+ + +H +CF+C EC Q + S +F  +D++  C +C+ + F+K C KC + I        +      +HSECFTC  CD  L G  F   +   +C  C +    K  G C
Sbjct:  223 FTCEEDGELLVDLIYCSKDDEIYCCRHWGEKLKPRCAGCEELIYVGEYSQAL-EKNWHPGHLCCSYCDESLSNQKFVTVEGSPSCFRCYDENFANRCEACGEPIGPGSKDVDVRSKHWHEGCFKCSQCSKQLMNEGFTLKDEKLICHGCRGINPSKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKVCVKCNQVIKTSS----VQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQNCYRERYAKRCGAC 502          

HSP 3 Score: 108.227 bits (269), Expect = 1.777e-25
Identity = 72/251 (28.69%), Postives = 107/251 (42.63%), Query Frame = 1
Query:  364 CDRCKDKIGCDSKDLSFKERH-----WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKV 1095
            C RC   +      L F ER      WH  CF C    E LVD  + +KDD ++C   +  K   RC  C  +   G        + WH     C+ C + +  + F+  +    C  CY+  FA RC  C + I  G   V  + + WH+ CF C++C +QL +  FT KD+K  C  C     SK C  C        G K +    + +H +CF C +C   +  + F+   +  +C  C  +   KV
Sbjct:  193 CKRCNGPVNPGDMAL-FAERLGPDSCWHVKCFTCEEDGELLVDLIYCSKDDEIYCCRHWGEKLKPRCAGCEELIYVGEYSQALE-KNWHPGHLCCSYCDESLSNQKFVTVEGSPSCFRCYDENFANRCEACGEPIGPGSKDVDVRSKHWHEGCFKCSQCSKQLMNEGFTLKDEKLICHGCRGINPSKVCAACNGDFA--PGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKFAKV 439          

HSP 4 Score: 55.8398 bits (133), Expect = 1.877e-8
Identity = 27/90 (30.00%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDC 522
            E F+C +C K L G+ +  ++    C  CY E++A +C  C + I  ++K +++ E+++H  CF C  C++ L  + F  +D    C  C
Sbjct:  462 ECFTCHHCDKPLAGSPFTKQEGRNVCQNCYRERYAKRCGACHNLIEGNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRIRDGEKICLPC 551          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO41181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S548])

HSP 1 Score: 111.309 bits (277), Expect = 4.568e-28
Identity = 53/146 (36.30%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  601 GRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFL 1038
            G+ WH   F C  C+ P+G ++F  RD +  C   Y + FA RC  CN  I    VT   + WH E F+C EC        F  +D KPFC + Y  +F+ +C  C +PI       +IS    HWH+ECF C++C     G  F 
Sbjct:   42 GKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPIMD----NYISALSAHWHAECFICTECRQPFPGGSFF 183          

HSP 2 Score: 110.923 bits (276), Expect = 6.427e-28
Identity = 67/216 (31.02%), Postives = 94/216 (43.52%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFS 900
            E F+C  C+  L    +  +D  P+C   Y + FA +C  C   I  DS  ++  ++ WH   F+C+ C     D  F  +D   FC + Y + FA RC  CG                WH  CF+C EC+QP    SF   D +  C   Y  K    C  C   I    +T     +H E F+C  C +QL    F  ++DKP+C  C+  LF 
Sbjct:   48 EHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPI-LDSC-VTALDQTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPIMD--NYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYCEMHYHAKRGTLCYSCQKPITGRCITAMHRKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPCFVKLFG 259          

HSP 3 Score: 110.538 bits (275), Expect = 8.773e-28
Identity = 72/216 (33.33%), Postives = 89/216 (41.20%), Query Frame = 1
Query:  427 WHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDAC-GNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            WH   F C +C   L  + F  +D   +C   Y   FA RC  C G I  +     +   + WH   FVCAEC  P G   F  RD +  C   Y   FA RC  C   I    ++     WH ECF+CTEC Q      F   D +P+C   Y       C  C KPITG    + I+   R +H E F C+ C   L    F    D   C  C
Sbjct:   45 WHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILDSCVTALD---QTWHPEHFVCAECGNPFGDTGFHERDGKPFCREDYYAMFAPRCGGCGQPIMDNYISALSAHWHAECFICTECRQPFPGGSFFDHDGRPYCEMHYHAKRGTLCYSCQKPITG----RCITAMHRKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCHPC 253          

HSP 4 Score: 62.003 bits (149), Expect = 7.464e-11
Identity = 33/102 (32.35%), Postives = 45/102 (44.12%), Query Frame = 1
Query:  730 CTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGF 1035
            C  CN  I     T  G+ WH E F C  C   L +  F  +D KP+C   Y + F+ +C  C  PI        ++  D+ WH E F C++C       GF
Sbjct:   26 CAACNKPIIGQVCTALGKTWHPEHFACVACEAPLGTQNFFERDGKPYCERDYHDTFAPRCAYCNGPILD----SCVTALDQTWHPEHFVCAECGNPFGDTGF 123          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO43201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ98])

HSP 1 Score: 99.7525 bits (247), Expect = 8.607e-24
Identity = 70/240 (29.17%), Postives = 105/240 (43.75%), Query Frame = 1
Query:  391 CDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFI---------------PRDNQTVCVSCY---------ENKFAQ-RCTKCNDVIRKGGVTYKGE-PWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRG 1032
            C  + L  +  ++HE C  CS C + L  KPF    +  +C D Y++++  +CD+C  ++  G       G+ +HE CF C  C+QP      I               P+   T   S Y          N  A   C  C + I+        E  WH  CF CT+CH  L SL++   D KP+C   Y  LF   C  C   ITG    K +   ++H+H +C  C++C+ ++ G G
Sbjct:   14 CSGEALLHENAYYHENCLCCSVCGQGLRSKPFYVMGEQYYCKDDYQNQYGKKCDSC-QLYLEG-EIISIHGKNFHEACFACNSCRQPFPPSDKIIFTGTDYLCQTCNNAPKAPTTKVSSPYLHTGMVLPRTNGMANVACAGCGEAIKGSQALLALEKQWHLWCFSCTKCH-CLLSLEYMGMDGKPYCEKDYQELFGVTCAACNGYITG----KVLQAGNKHYHPKCSRCARCN-NIFGEG 245          
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Match: EDO34191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ31])

HSP 1 Score: 93.5893 bits (231), Expect = 1.152e-22
Identity = 50/164 (30.49%), Postives = 80/164 (48.78%), Query Frame = 1
Query:  406 LSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCT--ECHQQLASLKFTSKDD-KPFCADC 882
            + ++ +  H  CF+C  C   L  K F  +DD   C DC    +A RC AC    +   +        +H +CFVC+ C++P+  K+F   +   VC  CY +++A+RC  C+  +      V Y  + +H ECF+C    C + L+  KF  K D +  C +C
Sbjct:    1 MRYQNKPHHSECFVCFHCRTPLAGKTFQMRDDRKVCKDCNRIHYAKRCVACRQYIEGTVKFVTRDEGTYHSDCFVCSRCRKPLAGKTFTEHEGSWVCDDCYHDRYAKRCNMCHQSLEANVEFVKYDEKLYHNECFVCQNPRCRKPLSGAKFALKSDGRRMCLNC 164          

HSP 2 Score: 93.2041 bits (230), Expect = 1.600e-22
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  592 EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCS--KCDTSLVGRGFLTDKD 1050
             Y+ +  H  CFVC  C+ P+  K+F  RD++ VC  C    +A+RC  C   I      VT     +H +CF+C+ C + LA   FT  +    C DCY + ++K+C  C + +      +F+  D++ +H+ECF C   +C   L G  F    D
Sbjct:    2 RYQNKPHHSECFVCFHCRTPLAGKTFQMRDDRKVCKDCNRIHYAKRCVACRQYIEGTVKFVTRDEGTYHSDCFVCSRCRKPLAGKTFTEHEGSWVCDDCYHDRYAKRCNMCHQSLE--ANVEFVKYDEKLYHNECFVCQNPRCRKPLSGAKFALKSD 156          

HSP 3 Score: 83.1889 bits (204), Expect = 5.999e-19
Identity = 50/164 (30.49%), Postives = 79/164 (48.17%), Query Frame = 1
Query:  232 MENQNT---QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVC--AECQQPI-GAKSFIPRDNQTVCVSC 705
            M  QN     E F C +C+  L G  + ++D    C  C    +A +C  C+  I    K ++  E  +H  CF+CS C + L  K F   +    C DCY  ++A RC+ C    +A     +Y  + +H  CFVC    C++P+ GAK  +  D + +C++C
Sbjct:    1 MRYQNKPHHSECFVCFHCRTPLAGKTFQMRDDRKVCKDCNRIHYAKRCVACRQYIEGTVKFVTRDEGTYHSDCFVCSRCRKPLAGKTFTEHEGSWVCDDCYHDRYAKRCNMCHQSLEANVEFVKYDEKLYHNECFVCQNPRCRKPLSGAKFALKSDGRRMCLNC 164          

HSP 4 Score: 76.6406 bits (187), Expect = 1.181e-16
Identity = 38/114 (33.33%), Postives = 60/114 (52.63%), Query Frame = 1
Query:  766 VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            + Y+ +P H ECF+C  C   LA   F  +DD+  C DC    ++K+C  C + I   G  KF++ D+  +HS+CF CS+C   L G+ F   +   +C +C  +   K   +C
Sbjct:    1 MRYQNKPHHSECFVCFHCRTPLAGKTFQMRDDRKVCKDCNRIHYAKRCVACRQYIE--GTVKFVTRDEGTYHSDCFVCSRCRKPLAGKTFTEHEGSWVCDDCYHDRYAKRCNMC 112          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl2a (four and a half LIM domains protein 2 [Source:NCBI gene;Acc:101169645])

HSP 1 Score: 337.806 bits (865), Expect = 1.643e-114
Identity = 148/276 (53.62%), Postives = 202/276 (73.19%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E + C  C++SL G +Y+L+++ P+C+ CYE  ++N C+ CK  IGC+++DLS+K+RHWHE CF C  C  SLVDKPF+TKD+ L C +CY ++++++C  C      G+RK E++G  WHE CF C  CQQPIG KSFIP+DN   CV CYE +FA +C  C   I  GGVTY+ +PWHK+CFLCT C QQL+  +FTSKDD  +C +C+ NL++KKC  CT PI+G GG K+IS ++R WH++CF C KC  SLVGRGFLT++D I+CPECG++
Sbjct:    3 ERYDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNTRDLSYKDRHWHEDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGGVTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASCTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKD 278          

HSP 2 Score: 147.517 bits (371), Expect = 7.476e-41
Identity = 74/224 (33.04%), Postives = 112/224 (50.00%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKVIGIC 1107
            + C  C ESL  K +  +++  +C  CYES ++  C+ C        R   Y+ R WHE+CF C +C++ +  K F  +D Q +C  CY N+++ +C +C   I  G   + +KG  WH+ CF C  C Q + +  F  KD+  +C  CY   F+ +C  C KPIT  G    ++  D+ WH +CF C+ C   L G+ F +  D   C  C  N   K    C
Sbjct:    5 YDCHYCKESLFGKKYVLREENPYCVKCYESLYSNTCEECKKPIGCNTRDLSYKDRHWHEDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGG----VTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASC 224          

HSP 3 Score: 132.109 bits (331), Expect = 5.085e-35
Identity = 67/219 (30.59%), Postives = 111/219 (50.68%), Query Frame = 1
Query:  250 QEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            ++ F C  C++SL    +  KD+   C  CY  ++++KC  CK  I   S+ +  K   WHE CF C  C + +  K F  KD+  +C  CYE +FA +C  C      G     YR + WH++CF+C  C+Q +  + F  +D+   C++C+ N +A++C  C   I   G    ++++   WH +CF C +C   L    F ++ D   C +C  ++
Sbjct:   63 EDCFKCFQCKRSLVDKPFSTKDEQLLCTECYSNEYSSKCHECKKTIMPGSRKMEHKGHSWHETCFTCKRCQQPIGTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPITTGG--VTYRDQPWHKDCFLCTSCKQQLSGQRFTSKDDFAYCLNCFCNLYAKKCASCTTPISGLGGSKYISFEERQWHNDCFNCKKCSVSLVGRGFLTERDDILCPECGKDI 279          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl5 (four and a half LIM domains protein 2-like [Source:NCBI gene;Acc:101156370])

HSP 1 Score: 326.25 bits (835), Expect = 5.963e-110
Identity = 146/279 (52.33%), Postives = 195/279 (69.89%), Query Frame = 1
Query:  241 QNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
             +T E F C  C+ SL G +YI+K+   +C  CYE  FAN C+ C   IGC+SKDLS+K+RHWHE CF C+ CS SL DK FA ++DLL C +CY   ++++C  C      G+RK EY+G  WHE CF+C  CQQP+G KSFIP++N   CV C+E +FA +C  C   I  GGVTY+ +PWH+ECFLC  C +QL+  +FTS+++ P+C +C++NL++KKC  CTKPIT   G K+IS ++R WHSECF C +C  SLVGRGFLT +D I+C ECG+
Sbjct:    1 MSTSERFDCHYCKDSLLGKKYIMKEDTQYCTKCYENLFANCCEECSTPIGCNSKDLSYKDRHWHEQCFKCAKCSRSLADKAFAAREDLLLCTECYALDYSSKCITCKKTILPGSRKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAITTGGVTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSNLYAKKCVGCTKPITSLAGAKYISFEERQWHSECFNCMQCSVSLVGRGFLTQRDDILCTECGR 279          

HSP 2 Score: 147.517 bits (371), Expect = 9.292e-41
Identity = 75/215 (34.88%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            F C  C +SL+ K +  K+D  +C  CYE+ FA  C+ C       ++   Y+ R WHE CF CA+C + +  K+F  R++  +C  CY   ++ +C  C   I  G   + YKG  WH+ CFLC  C Q L +  F  K++  FC  C+   F+ +C  C K IT  G    ++  D+ WH ECF C  C   L G+ F + ++   C EC  N
Sbjct:    7 FDCHYCKDSLLGKKYIMKEDTQYCTKCYENLFANCCEECSTPIGCNSKDLSYKDRHWHEQCFKCAKCSRSLADKAFAAREDLLLCTECYALDYSSKCITCKKTILPGSRKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAITTGG----VTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSN 217          

HSP 3 Score: 97.8265 bits (242), Expect = 1.437e-22
Identity = 50/169 (29.59%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  220 RKSEMENQNTQEI-FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFK--AGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENK 717
            RK E +  +  E  F C  CQ+ L    +I K+    C+PC+E++FA +C  CK  I   +  ++++++ WH  CFLC  C   L  + F ++++  +C +C+ + +A +C  C       AGA+   +  RQWH  CF C +C   +  + F+ + +  +C  C   K
Sbjct:  115 RKMEYKGNSWHETCFLCHRCQQPLGTKSFIPKENGYFCVPCFEKQFAYQCCACKKAI--TTGGVTYQDKPWHRECFLCIGCKRQLSGQRFTSRENYPYCLECFSNLYAKKCVGCTKPITSLAGAKYISFEERQWHSECFNCMQCSVSLVGRGFLTQRDDILCTECGREK 281          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:101174533])

HSP 1 Score: 325.094 bits (832), Expect = 9.076e-109
Identity = 146/283 (51.59%), Postives = 198/283 (69.96%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            ++     + F C NC++SL G +YI  +  P+C+PCY+  F+N CD CK+ IG D+++L +++RH+HE CF C  C  SL D+PF ++D+ L C DCY ++F+++C AC  I   G RK EY G  WHE CF+C  C+QPIG+KSFIP  ++  CV CYE+KFA RCT+C   + KGGVTY+ EPWHKECF+CT C  QLA   FTS+D+ P+C  C+++L++KKC  C KPITGFGG K+IS +DR WH  CFTCS+C  SLVG GF  + D I+C +C  N
Sbjct:   43 LKKTTMADRFDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSN 325          

HSP 2 Score: 132.494 bits (332), Expect = 9.596e-35
Identity = 69/216 (31.94%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            F C  C +SL    +  +D    C  CY  +F++KC  C   +   ++ L +    WHE CF+C SC + +  K F    D  +C  CYE KFA RC  C      G     YR   WH+ CFVC  C+  +  + F  RD    C+ C+ + +A++C  C   I   G    ++++   WH+ CF C++C   L    F    D+  C DC +NL
Sbjct:  113 FRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGG--VTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSNL 326          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: fhl3a (four and a half LIM domains 3 [Source:NCBI gene;Acc:101174533])

HSP 1 Score: 322.398 bits (825), Expect = 1.786e-108
Identity = 146/274 (53.28%), Postives = 195/274 (71.17%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            F C NC++SL G +YI  +  P+C+PCY+  F+N CD CK+ IG D+++L +++RH+HE CF C  C  SL D+PF ++D+ L C DCY ++F+++C AC  I   G RK EY G  WHE CF+C  C+QPIG+KSFIP  ++  CV CYE+KFA RCT+C   + KGGVTY+ EPWHKECF+CT C  QLA   FTS+D+ P+C  C+++L++KKC  C KPITGFGG K+IS +DR WH  CFTCS+C  SLVG GF  + D I+C +C  N
Sbjct:    5 FDCDNCKESLYGRKYIQSNDSPYCIPCYDSLFSNTCDECKELIGHDARELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGGVTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSN 278          

HSP 2 Score: 132.109 bits (331), Expect = 4.880e-35
Identity = 69/216 (31.94%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  259 FSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANL 894
            F C  C +SL    +  +D    C  CY  +F++KC  C   +   ++ L +    WHE CF+C SC + +  K F    D  +C  CYE KFA RC  C      G     YR   WH+ CFVC  C+  +  + F  RD    C+ C+ + +A++C  C   I   G    ++++   WH+ CF C++C   L    F    D+  C DC +NL
Sbjct:   66 FRCFRCDRSLADEPFTSQDNALLCNDCYCNEFSSKCVACDKIVMPGTRKLEYAGSTWHEGCFICHSCEQPIGSKSFIPDKDEHYCVPCYEDKFAPRCTRCKKALSKGG--VTYRDEPWHKECFVCTSCETQLAGQHFTSRDESPYCLKCFSSLYAKKCEACCKPITGFGGGKYISFEDRQWHQSCFTCSQCSVSLVGAGFFPNGDRILCRDCNSNL 279          
BLAST of Four and A half lim domains vs. Ensembl Medaka
Match: rragcb (Ras-related GTP binding Cb [Source:ZFIN;Acc:ZDB-GENE-070705-380])

HSP 1 Score: 291.197 bits (744), Expect = 6.612e-91
Identity = 130/276 (47.10%), Postives = 183/276 (66.30%), Query Frame = 1
Query:  253 EIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E F C+NC+ SL G +YI  +  PHC+ CY++  AN C  C + IG + K+L+FK+R++HE CF C  C  SL +  F + +D+L C DCY ++F+++C +C  I   G++  E+ G  WHE+CFVC  C++PIG +SF+P +NQ  CV CYE +F  RC+ CN  + KGGV+Y+G  WH+ECFLCT C   LA   FTS+ + P+C  C++NL++KKC  C   ITGFG  K+IS +DR WH  CF CS+C  SLVG GF   +D I+C +C  +
Sbjct:  447 ERFDCRNCKASLYGQQYIKVENEPHCINCYDQLHANTCQECTEIIGHNDKELTFKDRYYHEHCFRCFRCDRSLSNASFTSHEDVLLCNDCYCNEFSSKCVSCNKIVMPGSKILEFDGSSWHEDCFVCHSCEKPIGGESFVPNENQYYCVPCYEGRFTPRCSHCNKALTKGGVSYQGGVWHRECFLCTGCSAPLAGQPFTSQGETPYCVKCFSNLYAKKCAGCNSAITGFGDGKYISFEDREWHQPCFKCSRCSVSLVGSGFFPYRDQILCRDCNDD 722          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000074426.1 (SMESG000074426.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 282/283 (99.65%), Postives = 283/283 (100.00%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            MENQNTQEIFSCQNCQKSL+GNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN
Sbjct:    1 MENQNTQEIFSCQNCQKSLSGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 283          

HSP 2 Score: 154.836 bits (390), Expect = 1.114e-43
Identity = 77/219 (35.16%), Postives = 113/219 (51.60%), Query Frame = 1
Query:  442 FLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG--VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGK 1092
            F C +C +SL    +  KD L  C  CYE KFA +CD C +     ++   ++ R WHE CF+C+ C + +  K F  +D+   C  CYE+KFA RC  C ++ + G     Y+G  WH+ CF+C EC Q + +  F  +D++  C  CY N F+++CTKC   I   G    ++     WH ECF C++C   L    F +  D   C +C  N   K
Sbjct:   10 FSCQNCQKSLSGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGG----VTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSK 224          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000037769.1 (SMESG000037769.1)

HSP 1 Score: 436.802 bits (1122), Expect = 1.409e-153
Identity = 202/282 (71.63%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            M+ ++    F+C+NC  SLTG+RYILK++ PHC+ CYE KFAN C++CK+KIGCDSKDLSFK+RHWHE CF C  C  SLVD+PFATKD+ LFC +CY++KFA RCD C  +FKAG RKYEYRG+QWHE CF+C EC+QPIGAKSFIPRD Q +CV CYENK+AQ+C+KC +VIR+GGVTYKG PWHKECF CT C +QLA +KFTSKDDKP+CADCY  LF+KKCTKCTKPITGFGGCKFIS + RHWHSECFTCSKC T+LVGRGFLT++D I+CP+CG+
Sbjct:    1 MDQEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDCGR 282          

HSP 2 Score: 102.834 bits (255), Expect = 1.583e-24
Identity = 53/161 (32.92%), Postives = 80/161 (49.69%), Query Frame = 1
Query:  604 RQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVI--RKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            ++ H N F C  C   +    +I ++    C+ CYE KFA  C +C + I      +++K   WH++CF C ECH  L    F +KD+  FC++CY N F+ +C  CTK      G +      + WH ECF C +C   +  + F+     IIC  C +N
Sbjct:    3 QEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKA--GMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYEN 161          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000037769.1 (SMESG000037769.1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.564e-151
Identity = 202/282 (71.63%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            M+ ++    F+C+NC  SLTG+RYILK++ PHC+ CYE KFAN C++CK+KIGCDSKDLSFK+RHWHE CF C  C  SLVD+PFATKD+ LFC +CY++KFA RCD C  +FKAG RKYEYRG+QWHE CF+C EC+QPIGAKSFIPRD Q +CV CYENK+AQ+C+KC +VIR+GGVTYKG PWHKECF CT C +QLA +KFTSKDDKP+CADCY  LF+KKCTKCTKPITGFGGCKFIS + RHWHSECFTCSKC T+LVGRGFLT++D I+CP+CG+
Sbjct:  252 MDQEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKIGCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDNKFAARCDGCTKVFKAGMRKYEYRGKQWHEECFLCLECKQPIGAKSFIPRDQQIICVPCYENKYAQKCSKCTEVIRRGGVTYKGTPWHKECFTCTNCTKQLAGIKFTSKDDKPYCADCYGELFAKKCTKCTKPITGFGGCKFISFEGRHWHSECFTCSKCTTNLVGRGFLTNEDNIMCPDCGR 533          

HSP 2 Score: 91.6633 bits (226), Expect = 1.320e-19
Identity = 55/166 (33.13%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  592 EYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYK-GEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGC--KFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            E     WH  CF C+EC++ +    +    N+  C   Y  K   RC  C+++I     T    +  H   F C  C   L   ++  K++ P C  CY   F+  C +C + I    GC  K +S  DRHWH +CF C +C TSLV R F T  + + C EC  N
Sbjct:  190 ESGAHSWHPACFNCSECKELLVDYIYCWHLNKLYCARHYGEKIRPRCATCDELIFNEEYTRAMDQEHHPNHFACKNCDNSLTGHRYILKEENPHCIKCYETKFANTCEQCKEKI----GCDSKDLSFKDRHWHEKCFECFECHTSLVDRPFATKDESLFCSECYDN 351          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000072127.1 (SMESG000072127.1)

HSP 1 Score: 421.009 bits (1081), Expect = 9.984e-144
Identity = 193/282 (68.44%), Postives = 233/282 (82.62%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQ 1077
            ME ++    F+C++C  SLTG+RYILKD  P C+ CYE ++AN C +C  +IGCDSKDLSFK+RHWHE CF C  CS SLVD+PFATKD+ L+C DCY++KFATRCD C  +FKAG RKYEYRG+QWHE CF+C +C+QPIG KSFIPR+   VCV CYE K+AQ+CTKC  VIR+GGVTYKG PWHKECF CT C +QLA +KFTSK++KP+CA+CY  LF+KKC+KCTKPITGFGGCKFIS +DRHWHSECFTC KC+ SLVG+GFLT+ D IICP+CG+
Sbjct:  248 MEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRIGCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDNKFATRCDGCHKVFKAGMRKYEYRGKQWHEECFLCVDCRQPIGTKSFIPREQDIVCVPCYEEKYAQKCTKCVGVIRRGGVTYKGSPWHKECFTCTHCSKQLAGIKFTSKEEKPYCAECYGELFAKKCSKCTKPITGFGGCKFISFEDRHWHSECFTCYKCNISLVGKGFLTNDDKIICPDCGR 529          

HSP 2 Score: 91.6633 bits (226), Expect = 1.191e-19
Identity = 60/189 (31.75%), Postives = 87/189 (46.03%), Query Frame = 1
Query:  538 ATRCDACGNIFKAG--ARKYEYRGR---QWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKEC-FLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGC--KFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            A  C  C +  +AG  A + E+       WH  CF C EC + +    +    N+  CV  Y      RC  C+++I     T   E  H    F C  C   L   ++  KDD+P C  CY + ++  C +C+  I    GC  K +S  DRHWH +CF C +C +SLV + F T  + + C +C  N
Sbjct:  163 ALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELIFTEEYTRAMEQEHHPAHFACKSCDNSLTGHRYILKDDQPLCIGCYESQYANICQQCSGRI----GCDSKDLSFKDRHWHEKCFKCFECSSSLVDQPFATKDNNLYCSDCYDN 347          

HSP 3 Score: 59.3066 bits (142), Expect = 3.495e-9
Identity = 43/141 (30.50%), Postives = 62/141 (43.97%), Query Frame = 1
Query:  676 RDNQTVCVS-CYE-NKFAQRCTKCNDVIRKGGVTYKGE-------PWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPEC 1071
            R+NQ + V   Y  +  A  CT+C   I+ G +  + E        WH  CF CTEC + L    +    +KP+C   YA L   +C  C + I  F      +++  H H   F C  CD SL G  ++   D  +C  C
Sbjct:  146 RNNQDLGVGHVYRLDMAALPCTQCQSSIQAGQLAVRVEHAANTQMSWHPRCFKCTECDEVLVDYIYCWYSNKPYCVRHYAQLIRPRCATCDELI--FTEEYTRAMEQEH-HPAHFACKSCDNSLTGHRYILKDDQPLCIGC 283          
BLAST of Four and A half lim domains vs. Planmine SMEST
Match: SMESG000009923.1 (SMESG000009923.1)

HSP 1 Score: 367.466 bits (942), Expect = 1.958e-122
Identity = 163/281 (58.01%), Postives = 214/281 (76.16%), Query Frame = 1
Query:  232 MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKDKIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECG 1074
            M+ +   E F+C  C  SLTG +YIL+D  P C+ C+E +F N C +C +KI CDSKDLSFKE HWHE CFLC  C +SLVD+ F TKD+ L+CP+C++ KF++ CD CG IF+ G +KYEY G+QWHE+CF+CA+C Q IG KSFIP + +  C+ CYENK AQ+C KC+++IRK G+TYKG+PWHKECFLCT C + L+  KFTSK++KP+C +C+  LF K+C KCT+PI+GFGGCKFIS+ D HWH+ECF CSKC  S+VG+GF   +D ++C  CG
Sbjct:  261 MDQEFHVEHFACHVCDSSLTGTKYILRDDNPFCVKCFENQFGNTCHKCSEKISCDSKDLSFKEWHWHEKCFLCDICHDSLVDRSFTTKDNYLYCPNCFDEKFSSCCDGCGKIFRTGVKKYEYAGKQWHEDCFICADCNQSIGTKSFIPINGKISCIGCYENKHAQKCFKCSEIIRKSGITYKGDPWHKECFLCTSCQKMLSESKFTSKEEKPYCTECFIELFCKRCKKCTQPISGFGGCKFISVGDDHWHTECFNCSKCQASMVGKGFFLQEDQMVCGSCG 541          

HSP 2 Score: 107.457 bits (267), Expect = 7.110e-25
Identity = 67/221 (30.32%), Postives = 103/221 (46.61%), Query Frame = 1
Query:  430 HEACFLCSSCSESLVDKPFATKDD--LLFCPDCYESKFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIR--KGGVTYKGEPWHKECFLCTECHQQLASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN 1080
            H +CF C +C E LVD  +   +D   +FC   +      RC  C  +        +   +++H   F C  C   +    +I RD+   CV C+EN+F   C KC++ I      +++K   WH++CFLC  CH  L    FT+KD+  +C +C+   FS  C  C K      G K      + WH +CF C+ C+ S+  + F+     I C  C +N
Sbjct:  204 HISCFECKTCKEKLVDFHYCWSNDSKAIFCLRHFGELTYCRCAECDELI-VNKDFTKAMDQEFHVEHFACHVCDSSLTGTKYILRDDNPFCVKCFENQFGNTCHKCSEKISCDSKDLSFKEWHWHEKCFLCDICHDSLVDRSFTTKDNYLYCPNCFDEKFSSCCDGCGKIFRT--GVKKYEYAGKQWHEDCFICADCNQSIGTKSFIPINGKISCIGCYEN 421          

HSP 3 Score: 48.521 bits (114), Expect = 6.995e-6
Identity = 43/151 (28.48%), Postives = 63/151 (41.72%), Query Frame = 1
Query:  652 IGAKSFIPRDNQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGE-PWHKECFLCTECHQQLASLKFTSKDDKP--FCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWHSECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*LGKV 1095
            +G     P DNQ VC  C + +F      C   IR   +T+  E   H  CF C  C ++L    +   +D    FC   +  L   +C +C + I       F    D+ +H E F C  CD+SL G  ++   D   C +C +N  G  
Sbjct:  164 LGFGEIEPVDNQEVCSIC-DKQFEDEDIFC---IR---ITHSAEFASHISCFECKTCKEKLVDFHYCWSNDSKAIFCLRHFGELTYCRCAECDELIVNK---DFTKAMDQEFHVEHFACHVCDSSLTGTKYILRDDNPFCVKCFENQFGNT 304          
The following BLAST results are available for this feature:
BLAST of Four and A half lim domains vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FHL26.983e-11554.71four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL26.983e-11554.71four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL26.983e-11554.71four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL26.983e-11554.71four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
FHL26.983e-11554.71four and a half LIM domains 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lim-91.316e-12460.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-91.883e-12360.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-93.587e-12260.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-94.045e-12260.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
lim-94.045e-12260.07LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmpt1.595e-12158.33gene:FBgn0261565 transcript:FBtr0302783[more]
Lmpt2.033e-12158.33gene:FBgn0261565 transcript:FBtr0346965[more]
Lmpt2.033e-12158.33gene:FBgn0261565 transcript:FBtr0302778[more]
Lmpt1.846e-11958.33gene:FBgn0261565 transcript:FBtr0332703[more]
Lmpt6.667e-11958.33gene:FBgn0261565 transcript:FBtr0302780[more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl2a3.436e-11453.99four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2a3.436e-11453.99four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2a3.436e-11453.99four and a half LIM domains 2a [Source:ZFIN;Acc:ZD... [more]
fhl2b3.915e-11453.99four and a half LIM domains 2b [Source:ZFIN;Acc:ZD... [more]
fhl2b3.915e-11453.99four and a half LIM domains 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl26.370e-11654.35four and a half LIM domains 2 [Source:NCBI gene;Ac... [more]
shroom36.682e-10852.17shroom family member 3 [Source:Xenbase;Acc:XB-GENE... [more]
fhl57.655e-10750.91four and a half LIM domains 5 [Source:NCBI gene;Ac... [more]
fhl11.529e-7940.94four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
fhl11.904e-7940.94four and a half LIM domains 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhl21.800e-11554.35four and a half LIM domains 2 [Source:MGI Symbol;A... [more]
Fhl21.800e-11554.35four and a half LIM domains 2 [Source:MGI Symbol;A... [more]
Fhl31.933e-10449.45four and a half LIM domains 3 [Source:MGI Symbol;A... [more]
Fhl51.591e-10051.44four and a half LIM domains 5 [Source:MGI Symbol;A... [more]
Fhl51.591e-10051.44four and a half LIM domains 5 [Source:MGI Symbol;A... [more]
back to top
BLAST of Four and A half lim domains vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70433|FHL2_MOUSE1.259e-11454.35Four and a half LIM domains protein 2 OS=Mus muscu... [more]
sp|O35115|FHL2_RAT2.697e-11453.99Four and a half LIM domains protein 2 OS=Rattus no... [more]
sp|Q14192|FHL2_HUMAN3.353e-11454.71Four and a half LIM domains protein 2 OS=Homo sapi... [more]
sp|Q2KI95|FHL2_BOVIN6.256e-11052.54Four and a half LIM domains protein 2 OS=Bos tauru... [more]
sp|Q3ZBI6|FHL3_BOVIN3.836e-10449.82Four and a half LIM domains protein 3 OS=Bos tauru... [more]
back to top
BLAST of Four and A half lim domains vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y2161.366e-15071.63Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
G4VSB74.029e-15071.28LIMPETin; Putative four and A half lim domains OS=... [more]
A0A068Y1Z93.325e-14972.34Four and A half lim domains OS=Echinococcus multil... [more]
U6J6Y33.398e-14972.34Four and a half LIM domains protein 2 OS=Echinococ... [more]
I1ZII27.009e-14973.63Four and a half LIM domains-1 (Fragment) OS=Schmid... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl2a5.183e-11453.62four and a half LIM domains protein 2 [Source:NCBI... [more]
fhl3a1.499e-11155.07four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
fhl2b7.045e-8946.01four and a half LIM domains 2b [Source:ZFIN;Acc:ZD... [more]
fhl1b7.600e-7440.88four and a half LIM domains protein 1 [Source:NCBI... [more]
fhl1b3.282e-7340.88four and a half LIM domains protein 1 [Source:NCBI... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl51.134e-5848.28four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB... [more]
fhl51.773e-5849.14four and a half LIM domains 5 [Source:ZFIN;Acc:ZDB... [more]
fhl3b5.853e-5437.55four and a half LIM domains 3b [Source:ZFIN;Acc:ZD... [more]
PXN2.398e-2930.88paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
PXN2.078e-2336.99paxillin [Source:HGNC Symbol;Acc:HGNC:9718][more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LRG13.629e-628.13GTPase-activating protein (GAP); contains Rho1p-sp... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411001.346e-6739.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LIMPET4.513e-6539.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411814.568e-2836.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432018.607e-2429.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341911.152e-2230.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Four and A half lim domains vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhl2a1.643e-11453.62four and a half LIM domains protein 2 [Source:NCBI... [more]
fhl55.963e-11052.33four and a half LIM domains protein 2-like [Source... [more]
fhl3a9.076e-10951.59four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
fhl3a1.786e-10853.28four and a half LIM domains 3 [Source:NCBI gene;Ac... [more]
rragcb6.612e-9147.10Ras-related GTP binding Cb [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Four and A half lim domains vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074426.11.114e-4399.65SMESG000074426.1[more]
SMESG000037769.11.409e-15371.63SMESG000037769.1[more]
SMESG000037769.12.564e-15171.63SMESG000037769.1[more]
SMESG000072127.19.984e-14468.44SMESG000072127.1[more]
SMESG000009923.11.958e-12258.01SMESG000009923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032774 ID=SMED30032774|Name=Four and A half lim domains|organism=Schmidtea mediterranea sexual|type=transcript|length=1324bp
GGAAATTATTTGACTATTGATTGGTTAATAAAACATCTGTGTCTATTTGT
GTAATATTGATGTTTGGAATTTTTGTCGATTATTATTTCATACTTAAGGT
AAAATTCCTAAATCAACAAATTAATTTCAATTTTATCTCTTTCATATAAG
TTGTCGTTATCACCCTGCCAAGGATCATTAAGTATTATAAGATAACTGTA
GGGATTTTAAAACATTTGTAGAAAATCGGAAATGGAAAACCAGAATACTC
AAGAAATCTTTAGTTGTCAAAACTGTCAAAAATCTCTGACTGGTAACCGG
TATATATTAAAAGATAAATTGCCGCACTGTCTACCATGCTATGAAGAAAA
GTTTGCCAATAAGTGCGATAGGTGTAAAGATAAAATCGGATGTGACAGCA
AGGATTTGTCTTTTAAAGAAAGACACTGGCATGAGGCTTGCTTTCTATGC
AGTAGTTGCTCTGAGTCTTTGGTAGACAAACCTTTTGCTACCAAGGATGA
TTTATTATTCTGTCCGGACTGCTATGAAAGTAAATTTGCAACCCGATGTG
ACGCTTGTGGAAATATTTTTAAAGCCGGCGCCAGAAAATATGAATACAGA
GGACGGCAGTGGCATGAAAATTGTTTTGTTTGTGCCGAATGCCAACAACC
GATTGGAGCCAAAAGTTTCATTCCGAGAGATAATCAAACCGTTTGTGTTT
CGTGTTATGAAAATAAATTTGCCCAAAGGTGTACGAAATGTAATGACGTT
ATTCGCAAAGGAGGGGTGACTTATAAAGGTGAACCATGGCATAAAGAGTG
TTTCTTGTGCACAGAATGCCACCAACAATTGGCGTCTCTGAAATTCACAT
CGAAAGATGATAAGCCGTTTTGTGCGGATTGTTATGCCAATTTGTTTTCG
AAGAAGTGCACAAAGTGCACCAAGCCAATAACTGGATTTGGAGGTTGTAA
ATTTATCTCACTTGATGATCGCCATTGGCATTCAGAATGCTTCACCTGTA
GCAAGTGTGACACAAGTCTCGTGGGGAGAGGTTTTCTAACGGATAAAGAT
TGTATAATATGCCCAGAATGCGGTCAAAATTAACTTGGAAAAGTTATAGG
AATATGTTGAATTTCGTTTAACAATTAAAGATATGACAATTATATTTTCT
ACTGAAATTTTCAGTAGAATAATTATTTTAAATTTTATTATTGTCTTGTA
TTCATTGGAAATAATTTTTTAGCCATTATCAGCCTGAATATTATTTAAAC
ATTATGGATGGAATAATAATGTTATATTATTTGCCAGAAAATCAGAAAAT
CTATTTAACTATACTAGTTTATCA
back to top

protein sequence of SMED30032774-orf-1

>SMED30032774-orf-1 ID=SMED30032774-orf-1|Name=SMED30032774-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MENQNTQEIFSCQNCQKSLTGNRYILKDKLPHCLPCYEEKFANKCDRCKD
KIGCDSKDLSFKERHWHEACFLCSSCSESLVDKPFATKDDLLFCPDCYES
KFATRCDACGNIFKAGARKYEYRGRQWHENCFVCAECQQPIGAKSFIPRD
NQTVCVSCYENKFAQRCTKCNDVIRKGGVTYKGEPWHKECFLCTECHQQL
ASLKFTSKDDKPFCADCYANLFSKKCTKCTKPITGFGGCKFISLDDRHWH
SECFTCSKCDTSLVGRGFLTDKDCIICPECGQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR037987FHL2/3/5
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 105..158
e-value: 6.4E-15
score: 65.6
coord: 44..97
e-value: 3.6E-13
score: 59.7
coord: 166..217
e-value: 7.7E-16
score: 68.6
coord: 225..280
e-value: 5.3E-14
score: 62.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 167..221
e-value: 5.6E-13
score: 48.9
coord: 45..101
e-value: 1.1E-10
score: 41.6
coord: 226..280
e-value: 5.0E-8
score: 33.0
coord: 106..163
e-value: 6.1E-12
score: 45.6
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 226..263
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 45..80
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 106..141
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 225..283
score: 9.623
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 43..104
score: 12.821
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 165..224
score: 13.375
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 105..164
score: 8.702
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 101..159
e-value: 1.2E-20
score: 75.2
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 223..283
e-value: 1.0E-18
score: 68.9
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 160..222
e-value: 3.9E-23
score: 83.1
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 42..100
e-value: 1.1E-18
score: 68.8
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 2..41
e-value: 1.2E-7
score: 33.5
NoneNo IPR availablePANTHERPTHR24205:SF4LIM DOMAIN FAMILYcoord: 1..282
NoneNo IPR availableCDDcd09347LIM4_FHLcoord: 226..281
e-value: 8.9193E-25
score: 92.0219
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 134..196
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 193..260
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 12..76
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 73..137
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 256..282
IPR037987Four and a half LIM domains protein 2/3/5PANTHERPTHR24205FAMILY NOT NAMEDcoord: 1..282