Lipopolysaccharide choline phosphotransferase protein

Overview
NameLipopolysaccharide choline phosphotransferase protein
Smed IDSMED30032771
Length (bp)1014
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30032771SMESG000079142.1 dd_Smed_v4_22064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30032771SMESG000079142.1 dd_Smed_v6_22064_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Human
Match: FKRP (fukutin related protein [Source:HGNC Symbol;Acc:HGNC:17997])

HSP 1 Score: 55.4546 bits (132), Expect = 7.782e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI---KLVYTEYHDKIYFENE-SISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKD 718
            V  +L+  G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L   +  S +     V+ +  +  +F  + S S +++   WP     FY  N     D    + +   FP+  + PL   PF  F    P +
Sbjct:  329 VVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWP-----FYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNN 464          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Human
Match: FKRP (fukutin related protein [Source:HGNC Symbol;Acc:HGNC:17997])

HSP 1 Score: 55.4546 bits (132), Expect = 7.782e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI---KLVYTEYHDKIYFENE-SISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKD 718
            V  +L+  G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L   +  S +     V+ +  +  +F  + S S +++   WP     FY  N     D    + +   FP+  + PL   PF  F    P +
Sbjct:  329 VVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWP-----FYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNN 464          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Zebrafish
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 50.0618 bits (118), Expect = 2.682e-6
Identity = 39/155 (25.16%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYG 748
            V  IL+ +G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + + L    + S +        + V  +++   Y E   +  ++    WP     FY  N     D    + +   F +  + PL   PF       P +  A+    +G
Sbjct:  366 VINILESSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGIYLEDVPNCDYLKNLDSGSLVDANGYVWERAVEGDFYRVQYSETNHLHVDL----WP-----FYPRNGVMTRDTWTEHKQDVEFSEHFLQPLVPMPFAGITTYGPNNHRAFLELKFG 511          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Zebrafish
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 50.0618 bits (118), Expect = 2.682e-6
Identity = 39/155 (25.16%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYG 748
            V  IL+ +G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + + L    + S +        + V  +++   Y E   +  ++    WP     FY  N     D    + +   F +  + PL   PF       P +  A+    +G
Sbjct:  366 VINILESSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGIYLEDVPNCDYLKNLDSGSLVDANGYVWERAVEGDFYRVQYSETNHLHVDL----WP-----FYPRNGVMTRDTWTEHKQDVEFSEHFLQPLVPMPFAGITTYGPNNHRAFLELKFG 511          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Xenopus
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:100145309])

HSP 1 Score: 55.4546 bits (132), Expect = 5.717e-8
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 2
Query:  281 RIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKL---VYTEYHDKIYFENE-SISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPF 688
            R        V K+L+ +G++Y+L GG+LLG+ R  D IPWD D D+ I +       +L   Q+ S +     V+    +  +F  + S S +++   WP     FY  +     D    + +   FP+S + PL T PF
Sbjct:  310 RALRTTTHHVIKVLEASGVRYWLEGGSLLGAARNGDIIPWDYDVDLGIYLEDVTLCTELRGAQSGSLVDAEGYVWERAVEGDFFRVQYSQSNHLHVDLWP-----FYPRDGVMTRDSWTGHPQDVEFPESFLQPLQTLPF 444          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Xenopus
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:100145309])

HSP 1 Score: 55.4546 bits (132), Expect = 6.577e-8
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 2
Query:  281 RIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKL---VYTEYHDKIYFENE-SISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPF 688
            R        V K+L+ +G++Y+L GG+LLG+ R  D IPWD D D+ I +       +L   Q+ S +     V+    +  +F  + S S +++   WP     FY  +     D    + +   FP+S + PL T PF
Sbjct:  364 RALRTTTHHVIKVLEASGVRYWLEGGSLLGAARNGDIIPWDYDVDLGIYLEDVTLCTELRGAQSGSLVDAEGYVWERAVEGDFFRVQYSQSNHLHVDLWP-----FYPRDGVMTRDSWTGHPQDVEFPESFLQPLQTLPF 498          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Mouse
Match: Fkrp (fukutin related protein [Source:MGI Symbol;Acc:MGI:2447586])

HSP 1 Score: 56.225 bits (134), Expect = 2.587e-8
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKD 718
            V  +L+  G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L   +  S +        K V  ++    Y EN  +  ++    WP     FY  N     D    + +   FP+  + PL   PF  F    P +
Sbjct:  329 VVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSENNHLHVDL----WP-----FYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNN 464          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Match: sp|Q8CG64|FKRP_MOUSE (Fukutin-related protein OS=Mus musculus OX=10090 GN=Fkrp PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.809e-7
Identity = 41/145 (28.28%), Postives = 64/145 (44.14%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKD 718
            V  +L+  G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L   +  S +        K V  ++    Y EN  +  ++    WP     FY  N     D    + +   FP+  + PL   PF  F    P +
Sbjct:  329 VVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSENNHLHVDL----WP-----FYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNN 464          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Match: sp|Q9ZCN5|Y688_RICPR (Uncharacterized protein RP688 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP688 PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.635e-7
Identity = 32/90 (35.56%), Postives = 52/90 (57.78%), Query Frame = 2
Query:  254 QFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLF-KFQNDSNIKLVYTEYHDKIY 520
            ++RISE +    Y+L+    ++L +N I+Y++  GTLLG+ R+   IP+DDD DI I       L+ +  +F+     +L Y   H+KIY
Sbjct:   96 KYRISEKKALSLYQLMKDTHELLTKNNIKYWIESGTLLGAVRHQGIIPFDDDLDIGIMHEDEIHLQQILPQFE-----QLGYRVKHNKIY 180          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Match: sp|Q9H9S5|FKRP_HUMAN (Fukutin-related protein OS=Homo sapiens OX=9606 GN=FKRP PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.737e-7
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI---KLVYTEYHDKIYFENE-SISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKD 718
            V  +L+  G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L   +  S +     V+ +  +  +F  + S S +++   WP     FY  N     D    + +   FP+  + PL   PF  F    P +
Sbjct:  329 VVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWP-----FYPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNN 464          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Match: sp|Q68W49|Y683_RICTY (Uncharacterized protein RT0683 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0683 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 6.179e-7
Identity = 34/92 (36.96%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  254 QFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICI---GMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIY 520
            ++RISE +    Y+L+    ++L +N I+Y++  GTLLG+ R+   IP+DDD DI I     I  Q +   FK       +L Y   H+KIY
Sbjct:   96 RYRISEKKALSLYQLMKDTHELLTKNNIKYWIESGTLLGAVRHQGIIPFDDDLDIGIMHEDEIHFQQILPQFK-------QLGYRIKHNKIY 180          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Match: sp|Q9ZCN4|Y689_RICPR (Uncharacterized protein RP689 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP689 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.625e-6
Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  254 QFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICI 424
            ++RIS  +    Y+L+    ++L +N I+Y++  GTLLG+ R+   IP+DDD DI I
Sbjct:   47 KYRISGKKALSLYQLMKDTHELLTKNNIKYWIESGTLLGAVRHQGIIPFDDDLDIGI 103          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Match: A0A1I8J1S0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 9.254e-48
Identity = 94/274 (34.31%), Postives = 141/274 (51.46%), Query Frame = 2
Query:  209 ELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEY--HDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRR--------YNSSDGIIEELIYKNKVIQ-KIKVNEPIYAISDELSLLLKKGYEIP 997
            +L   R R+     F+  +++ ER +  RL+ R+D + ++  + Y + GGTLLGS+R+H  +PWDDD D+ +    R+ L         +  +LV  E   HDKIY    S  T+ Y W+WPY+DVSF+  N TH++D   TY+    +PK +V P   RPF    LP P+D  A+    YG    C+   YSHM E  GMP  +  C  L    PF  R          +   ++E L+  N+ ++  + V EP +AI++  SL L  G+  P
Sbjct:   69 DLAKARERVKNVKLFKPFVTKQERWVMLRLLKRIDHVFRKYNVTYIIYGGTLLGSHRHHGLVPWDDDVDLLVNKTVRRHLP---AMLAAAAPELVLQEAGGHDKIYDGGLSRRTSTYPWRWPYLDVSFFEENSTHLWDHMATYSHWFVYPKWLVLPTHARPFEHLRLPVPRDTLAFLQLTYGRTGTCLTSAYSHMIE-DGMPSGRRPCLSLNGSVPFVHRKPCTTSSNQRTDSCVLETLVLGNRQLKPAVAVAEPSFAINEPFSLKLVHGFTQP 338          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Match: A0A1I8G4T0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.697e-47
Identity = 94/274 (34.31%), Postives = 141/274 (51.46%), Query Frame = 2
Query:  209 ELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEY--HDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRR--------YNSSDGIIEELIYKNKVIQ-KIKVNEPIYAISDELSLLLKKGYEIP 997
            +L   R R+     F+  +++ ER +  RL+ R+D + ++  + Y + GGTLLGS+R+H  +PWDDD D+ +    R+ L         +  +LV  E   HDKIY    S  T+ Y W+WPY+DVSF+  N TH++D   TY+    +PK +V P   RPF    LP P+D  A+    YG    C+   YSHM E  GMP  +  C  L    PF  R          +   ++E L+  N+ ++  + V EP +AI++  SL L  G+  P
Sbjct:  111 DLAKARERVKNVKLFKPFVTKQERWVMLRLLKRIDHVFRKYNVTYIIYGGTLLGSHRHHGLVPWDDDVDLLVNKTVRRHLP---AMLAAAAPELVLQEAGGHDKIYDGGLSRRTSTYPWRWPYLDVSFFEENSTHLWDHMATYSHWFVYPKWLVLPTHARPFEHLRLPVPRDTLAFLQLTYGRTGTCLTSAYSHMIE-DGMPSGRRPCLSLNGSVPFVHRKPCTTSSNQRTDSCVLETLVLGNRQLKPAVAVAEPSFAINEPFSLKLVHGFTQP 380          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Match: A0A2R2MJL0 (uncharacterized protein LOC112041423 OS=Lingula unguis OX=7574 GN=LOC112041423 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.149e-34
Identity = 88/260 (33.85%), Postives = 138/260 (53.08%), Query Frame = 2
Query:  251 FQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHD------KIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITE--TYNRVET-------FPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYA-KVKCKELANLFPFTRRYNSSD--GIIEELIYKNKVIQKIKVNEPIYAISDELSLLL 976
            FQ  ++  ++ IF  ++  +D++ +EN I YF+  GTLLGSYR+H  IPWD D DI   +  +  L + F       +  V+T  H       K+Y++  +I+ +   WKWP +D+  Y  N+THI+DI    + N V +       F K V+FPL  RPF    L  P+D+FAY    Y  +  C+  ++          YA ++ CKEL N+ PF  R   ++  G+ E+L+  N V+Q+  ++EP YA++   SL L
Sbjct:  125 FQSELTAEDKEIFTNILGTIDRVCRENNITYFMSAGTLLGSYRHHGMIPWDVDADIHCSVRGKAKLTEAFSKHAPDYV--VHTPLHTRYPGLLKVYYKWSNITVD--EWKWPAVDIFLYAENQTHIWDIPRNLSGNTVPSSSKLYRRFEKRVLFPLHRRPFGNIFLNAPRDSFAYLKLFYD-STGCLKQLHRQ--------YAIQIPCKELENVVPFVYREGVANGSGVKEKLMMGNTVLQEFIIDEPSYAVTKRYSLEL 371          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Match: A0A1S3HKI0 (uncharacterized protein LOC106156013 OS=Lingula unguis OX=7574 GN=LOC106156013 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.064e-34
Identity = 87/250 (34.80%), Postives = 134/250 (53.60%), Query Frame = 2
Query:  251 FQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKI-YFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKV-KCKELANLFPFTRRYNSSD---GIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKG 985
            FQ ++S+ E+ +   +++ +D+   ++ I Y L GG+LLGSYR+HD IPWDDD D+   +   Q+   LFK  +    +    +   ++ +F   S  T  Y W+WPY+D+ FY  N+THI+D +  + R   + KS VFPL  RPF       P D++A     Y  +  C    YSH +E+      +V  C++L++L PF  R  S D   G+ E L    + +Q + V+EP YAIS    L L +G
Sbjct:  123 FQQQVSQSEKELLMEMLAVLDRACSKHNITYLLYGGSLLGSYRHHDLIPWDDDVDLLFNI---QEKAILFKALSQFAPEYYVNKAGPRLKFFSKNSNFTTKYSWRWPYLDLHFYKENQTHIWDSSYEF-RNYIYKKSNVFPLHRRPFGNVYANAPYDSYAVLRKTYK-SSKCQTYFYSHKKEVGTSARMRVIPCEDLSDLIPFVHR-TSVDFGIGVKETLKLGQETLQVVIVDEPSYAISKPYKLELVEG 366          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Match: A0A1S3JFP2 (uncharacterized protein LOC106172818 OS=Lingula unguis OX=7574 GN=LOC106172818 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.477e-34
Identity = 87/260 (33.46%), Postives = 138/260 (53.08%), Query Frame = 2
Query:  251 FQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHD------KIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITE--TYNRVET-------FPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYA-KVKCKELANLFPFTRRYNSSD--GIIEELIYKNKVIQKIKVNEPIYAISDELSLLL 976
            FQ  ++  ++ IF  ++  +D++ +EN I YF+  GTLLGSYR+H  IPWD D DI   +  +  L + F       +  V+T  H       K+Y++  +I+ +   WKWP +D+  Y  N+THI+DI    + N V +       F K V+FPL  RPF    L  P+D+FAY    Y  +  C+  ++          YA ++ CKEL N+ PF  R   ++  G+ E+L+  + V+Q+  ++EP YA++   SL L
Sbjct:  125 FQSELTAEDKEIFTNILGTIDRVCRENNITYFMSAGTLLGSYRHHGMIPWDVDADIHCSVRGKAKLTEAFSKHAPDYV--VHTPLHTRYPGLLKVYYKWSNITVD--EWKWPAVDIFLYAENQTHIWDIPRNLSGNTVPSSSKLYRRFEKRVLFPLHRRPFGNIFLNAPRDSFAYLKLFYD-STGCLKQLHRQ--------YAIQIPCKELENVVPFVYREGVANGSGVKEKLMMGDTVLQEFIIDEPSYAVTKRYSLEL 371          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Cavefish
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:103033897])

HSP 1 Score: 50.0618 bits (118), Expect = 2.180e-6
Identity = 40/155 (25.81%), Postives = 66/155 (42.58%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYG 748
            V  IL  +G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L    + S +        + V  +++   Y E   +  ++    WP     FY  N     D    + +   FP+  + PL    F       P +  A+    +G
Sbjct:  372 VINILDSSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGIYLEDVSNCEYLKNLDSGSLVDANGYVWERAVEGDFYRIQYSEANHLHVDL----WP-----FYPRNGVMTKDTWTDHKQDVEFPEHFLQPLVPMTFVGITAYGPNNHRAFLELKFG 517          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Cavefish
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:103033897])

HSP 1 Score: 49.6766 bits (117), Expect = 2.475e-6
Identity = 40/155 (25.81%), Postives = 66/155 (42.58%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNI--------KLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYG 748
            V  IL  +G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + E L    + S +        + V  +++   Y E   +  ++    WP     FY  N     D    + +   FP+  + PL    F       P +  A+    +G
Sbjct:  336 VINILDSSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGIYLEDVSNCEYLKNLDSGSLVDANGYVWERAVEGDFYRIQYSEANHLHVDL----WP-----FYPRNGVMTKDTWTDHKQDVEFPEHFLQPLVPMTFVGITAYGPNNHRAFLELKFG 481          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Sea Lamprey
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 49.2914 bits (116), Expect = 6.640e-7
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 2
Query:  281 RIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICI 424
            R     ++RV + L+  G++Y+L GG+LLG+ R+ D IPWD D D+ +
Sbjct:  244 RALRTTVARVVRELERAGVRYWLEGGSLLGAARHGDIIPWDYDADLGL 291          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Nematostella
Match: EDO35576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL37])

HSP 1 Score: 56.6102 bits (135), Expect = 4.850e-9
Identity = 44/141 (31.21%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  110 IKYNYSEKCPKPLNSEPYFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFK-FQNDSNIKLVYTEYHDKIYFEN 529
            +K  + E CP+          +  EL    N+ + G     I  T S   R S+    +  R++   D+I + NG++Y+L  GTLLG+ R+  FIPWD D DI         LED  K F N S       E+   ++F+N
Sbjct:   81 MKIPFGEMCPR----------SYRELGGKCNLGKEGFDCPDIRHTGSSSVRCSQ---LVLTRMLRIFDQIARSNGLKYWLTSGTLLGAVRHRGFIPWDGDADI------EMPLEDYIKLFTNHSQ------EFPRDVFFQN 196          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Nematostella
Match: EDO45781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL8])

HSP 1 Score: 52.7582 bits (125), Expect = 3.807e-8
Identity = 21/56 (37.50%), Postives = 32/56 (57.14%), Query Frame = 2
Query:  281 RIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDL 448
            +  Y++   +D++  E+ I Y+  GGT LG  R+   IPWDDD D+CI     Q +
Sbjct:   22 KTLYQMAGDLDQLFTEHQINYWTDGGTTLGCVRHKGLIPWDDDIDLCISKNDEQKV 77          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Nematostella
Match: EDO43590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY81])

HSP 1 Score: 49.2914 bits (116), Expect = 1.357e-6
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 2
Query:  314 KILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLF 460
            ++L  +G+ Y+L GG+LLG+ R+ D IPWD D DI I   Q +  + LF
Sbjct:  355 EVLDNSGVSYWLEGGSLLGAVRHSDIIPWDYDVDIGIYQSQIRKCKPLF 403          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Nematostella
Match: EDO32420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV38])

HSP 1 Score: 48.9062 bits (115), Expect = 1.780e-6
Identity = 42/159 (26.42%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  266 SEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFK------FQNDSNIKLVYTEYHDKIYFENES--ISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVF-PLSTRPFFVFNLPTPK 715
             E ER     L S++  IL   G+Q++L  G+++G+ RY   +PWD D D+     +R+D + L +      FQ+   I   +      I F  E   +S +++ ++  Y  + +    E  +F +   Y    TFP +++  PL  R F    L  P+
Sbjct:  295 GEKERTKLIELTSQIHSILNSIGLQHWLMYGSIIGALRYGSPLPWDHDVDLG---ARREDFDKLDRKAIIETFQSAGLIVHDFILRRGSITFSKEGGKLSVDLFLFQ-DYNGIIWRTGAEPWLFFL--HYKYYHTFPVNLIQPPLPKRKFGPIELSVPR 447          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Medaka
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:101164830])

HSP 1 Score: 54.6842 bits (130), Expect = 7.152e-8
Identity = 40/151 (26.49%), Postives = 67/151 (44.37%), Query Frame = 2
Query:  308 VDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQN----DSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYG 748
            V  IL+ +G++Y+L GG+LLG+ R+ D IPWD D D+ I +    + + L    +    D+N  +         Y    S + +++   WP     FY+ N     D    + +   FP+  + PL   PF       P +  A+    +G
Sbjct:  365 VINILESSGVRYWLEGGSLLGAVRHQDIIPWDYDVDLGIYLEDVPNCDHLKNLDSGSLVDANGYVWERAVEGDFYRVQYSEANHLHVDLWP-----FYSRNGVMTKDTWTDHKQDVEFPEHFLQPLVPMPFAGITAFGPNNHKAFLELKFG 510          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Match: SMESG000079142.1 (SMESG000079142.1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 320/324 (98.77%), Postives = 323/324 (99.69%), Query Frame = 2
Query:   41 MKNRXXXXXXXXXXXWSFVFLTYIKYNYSEKCPKPLNSEPYFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTVEF 1012
            MKNRLLIIEILILIIWSFVFLTYIKYNYS+KCPKPLNSE YFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESIST+IYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKT+EF
Sbjct:    1 MKNRLLIIEILILIIWSFVFLTYIKYNYSKKCPKPLNSEHYFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESISTSIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTIEF 324          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Match: SMESG000079138.1 (SMESG000079138.1)

HSP 1 Score: 325.865 bits (834), Expect = 8.784e-111
Identity = 151/284 (53.17%), Postives = 203/284 (71.48%), Query Frame = 2
Query:  161 YFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTVEF 1012
            YFRA  ++LLNL+ IP+L +P  R+    +F ++IS+ ER+ FY+LIS  D+I+K++GI YF+ GGTLLGSYR HDF+PWDDD D+ + +  R+ +E +F   N  N+ L YT  HDK+YF+NES  +N + WKWPY+D+SFY+SN THI DI +TY R ET PKS++FPLSTRPFF+F+LP+P+DAFA C W +GF D C    YSH+ E     Y K KC    N +P+  RY +SDG+IEEL+YKN VIQ+I VNEP YAIS+  S+ LK G+  P  ++ 
Sbjct:   41 YFRANADQLLNLHQIPDLKNPIERMKTMKAFNYQISKTERQTFYKLISLFDRIMKQHGIPYFISGGTLLGSYRNHDFLPWDDDIDVYVNVGSRRQVEKVFTSLNRINVVLYYTTKHDKLYFDNESFFSNKFGWKWPYVDISFYDSNATHITDIAKTYGRYETVPKSIIFPLSTRPFFIFDLPSPRDAFANCAWMFGFTDMCSMHSYSHIIEAGYSGYGKEKCILFKNRYPYVNRYLNSDGVIEELVYKNTVIQRIIVNEPNYAISESFSIKLKYGFRFPSDIDL 324          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Match: SMESG000017956.1 (SMESG000017956.1)

HSP 1 Score: 320.472 bits (820), Expect = 2.548e-109
Identity = 142/270 (52.59%), Postives = 197/270 (72.96%), Query Frame = 2
Query:  203 IPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTVEF 1012
            +P+LG P+ RI     F+++I++ ER   YRL++  DK +KENGI +F+  GTLLGSYR HDFIPWDDD D+ + + +R  LE +F  +N SN+ L YT  HDKIYF N+S+S + Y W+WPYID+SFYN+N TH+FD++ TY + +T+PKS++FPL+ RP F  NLP+PKDA+AYCVW+YGF+D+C+   YSH+ E     Y KVKCK  AN +P+ +RY + + +IEEL++K +VIQ+IKVNEP+YAIS     +L+KGY  P  V  
Sbjct:    1 MPDLGVPKSRIGNIPPFEYQITKQERMTMYRLLAVFDKTMKENGIPFFIHSGTLLGSYRNHDFIPWDDDIDVFVSVAERSQLEKVFYNKNVSNLILYYTPTHDKIYFSNDSVSGSKYGWRWPYIDISFYNTNGTHLFDLSPTYGQYDTYPKSIIFPLTNRPLFTMNLPSPKDAYAYCVWSYGFSDDCVMNYYSHITENLMTKYVKVKCKVFANKYPYVKRYRTDNSVIEELLFKGRVIQRIKVNEPLYAISKSFGFVLQKGYPYPTDVSL 270          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Match: SMESG000079140.1 (SMESG000079140.1)

HSP 1 Score: 263.077 bits (671), Expect = 3.977e-86
Identity = 120/284 (42.25%), Postives = 187/284 (65.85%), Query Frame = 2
Query:  146 LNSEPYFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLFKFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIP 997
            ++   Y+RA++ +L +L+ IP LG+P  R+   + F + +S+ ER I Y  +   D+ +K N I+YF+C GTLLGSYR+HDFIPW D+ D+ + +  R  L ++F+  ++S+  +      DK+Y +NE+  T+ + WKWPYID+ +Y+ N THIF I+    +    PKS+VFPLS RPF +++LP+P+DAF YC W++G+ D CI+  YSH+ E +      ++C+     +P+  RY   DGI+EELI+K+ V+Q+IKVNEP+YA++   S+ LK GY  P
Sbjct:   42 IDKSMYYRASEEQLSDLHEIPNLGNPIIRMRFANPFDYAMSKKERNILYNTLHFFDETMKNNKIKYFICCGTLLGSYRHHDFIPWADNIDVFVEVRNRIRLINIFRNVSESDYMIFKGRKSDKLYMKNETKYTSHFPWKWPYIDIRYYDFNRTHIFGISRNRGKRIILPKSIVFPLSIRPFNIYDLPSPRDAFGYCAWHFGYTDICISKSYSHVVEGETSSLGIIQCEAFIERYPYVHRYKIQDGIVEELIHKDIVVQRIKVNEPLYAVTQSFSIALKMGYLYP 325          
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Match: SMESG000065543.1 (SMESG000065543.1)

HSP 1 Score: 215.312 bits (547), Expect = 5.511e-67
Identity = 107/260 (41.15%), Postives = 159/260 (61.15%), Query Frame = 2
Query:  230 RIFKTDSFQFRISEPERRIFYRLISRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLEDLF-KFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNETHIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGFNDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIYKNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTV 1006
            R  K   FQ +++  ER++ YRL+   D+ +K N + Y + GGTLLGS+R+HD IPWDDD D+ I + QR  ++++F KF  +    +V    HDK +  ++S     + W WPY+D+S+YN N+THI DI +TY +  ++PK +VFPL  RP   ++LP+PKD FA+ VW Y +   C  G YSHM E  G P   ++CK +++ FPF       +G+ E L YK+  I  I + EP YA+S+   L LK G+ +PK +
Sbjct:  119 RNSKMKPFQIQMTFDERKMVYRLLELFDQTMKNNNVTYIMYGGTLLGSFRHHDLIPWDDDVDLIIPVKQRGKMKEIFEKFSPEYTFIVVGG--HDKFF--HKSGKKTRFSWSWPYLDLSYYNENDTHITDIVQTYGQWYSYPKEIVFPLHNRPLLNYSLPSPKDTFAFLVWTYNYGSPCKMGGYSHMVE-GGGPSGNIECKTVSDKFPFVEHLPHENGVREILKYKDIEITDIVIPEPKYAVSETFMLSLKPGFSMPKNI 373          
The following BLAST results are available for this feature:
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FKRP7.782e-828.37fukutin related protein [Source:HGNC Symbol;Acc:HG... [more]
FKRP7.782e-828.37fukutin related protein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkrp2.682e-625.16fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkrp2.682e-625.16fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkrp5.717e-829.29fukutin related protein [Source:NCBI gene;Acc:1001... [more]
fkrp6.577e-829.29fukutin related protein [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fkrp2.587e-828.28fukutin related protein [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CG64|FKRP_MOUSE1.809e-728.28Fukutin-related protein OS=Mus musculus OX=10090 G... [more]
sp|Q9ZCN5|Y688_RICPR2.635e-735.56Uncharacterized protein RP688 OS=Rickettsia prowaz... [more]
sp|Q9H9S5|FKRP_HUMAN3.737e-728.37Fukutin-related protein OS=Homo sapiens OX=9606 GN... [more]
sp|Q68W49|Y683_RICTY6.179e-736.96Uncharacterized protein RT0683 OS=Rickettsia typhi... [more]
sp|Q9ZCN4|Y689_RICPR2.625e-640.35Uncharacterized protein RP689 OS=Rickettsia prowaz... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J1S09.254e-4834.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G4T02.697e-4734.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2R2MJL01.149e-3433.85uncharacterized protein LOC112041423 OS=Lingula un... [more]
A0A1S3HKI04.064e-3434.80uncharacterized protein LOC106156013 OS=Lingula un... [more]
A0A1S3JFP25.477e-3433.46uncharacterized protein LOC106172818 OS=Lingula un... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkrp2.180e-625.81fukutin related protein [Source:NCBI gene;Acc:1030... [more]
fkrp2.475e-625.81fukutin related protein [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fkrp6.640e-741.67fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO355764.850e-931.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457813.807e-837.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435901.357e-644.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324201.780e-626.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fkrp7.152e-826.49fukutin related protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Lipopolysaccharide choline phosphotransferase protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079142.10.000e+098.77SMESG000079142.1[more]
SMESG000079138.18.784e-11153.17SMESG000079138.1[more]
SMESG000017956.12.548e-10952.59SMESG000017956.1[more]
SMESG000079140.13.977e-8642.25SMESG000079140.1[more]
SMESG000065543.15.511e-6741.15SMESG000065543.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032771 ID=SMED30032771|Name=Lipopolysaccharide choline phosphotransferase protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1014bp
AAAAGTCATTATTTTTCTTTATATTTTATATTTTCATGAAATGAAAAACC
GACTGTTAATAATTGAAATTTTAATATTAATAATTTGGTCATTTGTATTT
TTAACCTATATTAAATACAACTACTCAGAAAAATGTCCTAAACCTTTAAA
TTCTGAGCCTTATTTTCGTGCCACCGACAACGAGTTGTTGAATCTATATA
ACATTCCAGAATTAGGAGATCCGAGACACAGAATATTTAAAACTGATTCA
TTTCAATTCAGAATCTCGGAACCTGAAAGAAGGATCTTTTACAGACTTAT
TTCTAGGGTTGATAAAATCTTAAAAGAAAATGGCATTCAATATTTCCTCT
GTGGGGGAACGCTGCTTGGTTCCTATCGGTATCACGATTTTATACCTTGG
GATGATGATTTCGATATTTGTATTGGCATGATTCAACGGCAAGATTTAGA
AGATCTTTTCAAATTTCAAAATGACTCAAATATTAAGCTTGTTTATACAG
AATACCACGACAAAATTTATTTTGAAAATGAAAGCATTTCAACAAATATT
TATTTTTGGAAATGGCCTTATATCGATGTAAGCTTTTATAATTCGAATGA
AACTCACATTTTTGACATAACTGAGACTTATAATAGAGTGGAAACCTTTC
CAAAATCAGTTGTCTTTCCACTGTCCACACGACCATTTTTCGTTTTTAAT
TTACCAACACCAAAAGACGCATTTGCCTATTGCGTTTGGAATTATGGGTT
TAATGACAATTGTATTGCTGGGGTATATTCCCATATGCGAGAAATGCAAG
GTATGCCTTATGCTAAAGTAAAATGCAAAGAACTCGCAAATTTATTTCCA
TTTACAAGACGATACAACTCAAGTGACGGCATCATTGAAGAATTGATATA
TAAAAATAAAGTTATTCAAAAAATAAAAGTAAATGAACCTATATATGCCA
TTTCAGATGAACTATCTCTTCTTTTGAAAAAAGGTTATGAAATACCAAAA
ACTGTAGAGTTCCC
back to top

protein sequence of SMED30032771-orf-1

>SMED30032771-orf-1 ID=SMED30032771-orf-1|Name=SMED30032771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
KVIIFLYILYFHEMKNRLLIIEILILIIWSFVFLTYIKYNYSEKCPKPLN
SEPYFRATDNELLNLYNIPELGDPRHRIFKTDSFQFRISEPERRIFYRLI
SRVDKILKENGIQYFLCGGTLLGSYRYHDFIPWDDDFDICIGMIQRQDLE
DLFKFQNDSNIKLVYTEYHDKIYFENESISTNIYFWKWPYIDVSFYNSNE
THIFDITETYNRVETFPKSVVFPLSTRPFFVFNLPTPKDAFAYCVWNYGF
NDNCIAGVYSHMREMQGMPYAKVKCKELANLFPFTRRYNSSDGIIEELIY
KNKVIQKIKVNEPIYAISDELSLLLKKGYEIPKTVEF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR007074LicD_fam
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007074LicD familyPFAMPF04991LicDcoord: 108..169
e-value: 3.8E-15
score: 56.6
NoneNo IPR availablePANTHERPTHR43404FAMILY NOT NAMEDcoord: 90..278
NoneNo IPR availableTMHMMTMhelixcoord: 20..37