Dishevelled

Overview
NameDishevelled
Smed IDSMED30032757
Length (bp)3384
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dishevelled (SMED30032757) t-SNE clustered cells

Violin plots show distribution of expression levels for Dishevelled (SMED30032757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dishevelled (SMED30032757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dishevelled (SMED30032757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30032757SMESG000049876.1 SmedASXL_007637SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032757SMESG000049876.1 dd_Smed_v4_4639_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032757SMESG000049876.1 dd_Smed_v4_4639_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032757SMESG000049876.1 dd_Smed_v4_4639_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032757SMESG000049876.1 dd_Smed_v4_4639_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032757SMESG000049876.1 EU130787.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30032757SMESG000049876.1 dd_Smed_v4_4639_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dishevelled vs. Ensembl Human
Match: DVL2 (dishevelled segment polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:3086])

HSP 1 Score: 292.352 bits (747), Expect = 1.071e-84
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  257 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 542          

HSP 2 Score: 119.783 bits (299), Expect = 6.676e-27
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. Ensembl Human
Match: DVL2 (dishevelled segment polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:3086])

HSP 1 Score: 292.352 bits (747), Expect = 1.386e-84
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  263 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 548          

HSP 2 Score: 119.783 bits (299), Expect = 7.047e-27
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. Ensembl Human
Match: DVL3 (dishevelled segment polarity protein 3 [Source:HGNC Symbol;Acc:HGNC:3087])

HSP 1 Score: 275.404 bits (703), Expect = 8.499e-79
Identity = 157/330 (47.58%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPI 1962
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+TL VAK WDP+P G + LP+ +   PI P                           I    ++ +  AM+        + S    +S             R D+     L+ + + + I++AMA  +SGL +RDR+WLKITI NAFIGSD+VDWLY +V+GFTDR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D+ G ++ ++L     S    A  Q +   L H  PG    P+
Sbjct:  245 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSE---PIRP---------------------------IDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFH---LSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSG--ASDQDTLAPLPH--PGAAPWPM 534          

HSP 2 Score: 132.109 bits (331), Expect = 8.715e-31
Identity = 59/84 (70.24%), Postives = 71/84 (84.52%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D +ETPYL+K   P E++TL DFK  L RP+YKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVVSWLV +EGS
Sbjct:    1 MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGS 84          
BLAST of Dishevelled vs. Ensembl Human
Match: DVL1 (dishevelled segment polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:3084])

HSP 1 Score: 175.252 bits (443), Expect = 1.118e-48
Identity = 98/244 (40.16%), Postives = 136/244 (55.74%), Query Frame = 1
Query: 1141 DMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLES 1872
            DM+L+VN ++FEN+SN++AVR LRE V + GP++L VAK W  +PT              PR++            P   PV    + I    +L +  A++                                 E   +PLT   + S ++R M   DSGL IRDR+WLKITI NA IG+D+VDWLY+HV+GF +R++ARK+A++LLK GF+RHTVNK +FSEQCYYV  D+   L+ +NL S
Sbjct:    1 DMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCW--DPT--------------PRSY---------FTVPRADPV----RPIDPAAWLSHTAALTGALPRY---------------------------ELEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNS 188          
BLAST of Dishevelled vs. Ensembl Human
Match: DVL1 (dishevelled segment polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:3084])

HSP 1 Score: 179.489 bits (454), Expect = 2.697e-46
Identity = 85/132 (64.39%), Postives = 104/132 (78.79%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAP 1368
            LNI+TVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V + GP++L VAK WDP P  Y  +P+ DPVRPIDP AW+ HT A+    P
Sbjct:  247 LNIVTVTLNMERHHFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALP 375          

HSP 2 Score: 147.517 bits (371), Expect = 7.339e-36
Identity = 63/105 (60.00%), Postives = 83/105 (79.05%), Query Frame = 1
Query: 1558 SPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLES 1872
            +PLT   + S ++R M   DSGL IRDR+WLKITI NA IG+D+VDWLY+HV+GF +R++ARK+A++LLK GF+RHTVNK +FSEQCYYV  D+   L+ +NL S
Sbjct:  382 APLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNS 486          

HSP 3 Score: 128.257 bits (321), Expect = 1.101e-29
Identity = 68/125 (54.40%), Postives = 84/125 (67.20%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSF 435
            M ET+IIY++D+EETPYL+K    PE++TL DFKN L NRP   YKFFFKS+D DFGVVKEEI DD+AKLP  NGRVVSWLV++EG+     HS +G +     +D            D + PSF
Sbjct:    1 MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGA-----HSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF 120          
BLAST of Dishevelled vs. Ensembl Celegans
Match: dsh-1 (DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU4])

HSP 1 Score: 239.58 bits (610), Expect = 2.553e-69
Identity = 134/290 (46.21%), Postives = 174/290 (60.00%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLP---QQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            L++ITV LNMDTV FLGISIVGQT+     GD GIYV +IMKGGAVALDGRIE GDMIL+VN  SFEN +N++AV  LRE V + GP+ L VAKS++   + + +P   +++PVRPID +AW+ HT AM  M              ++     P  G                 S+      N QN  +G     I   L  + +   ++  MA   SGL I++R WLKI I  +F+GSDLV+WL  HV+G  +RK AR FA +LLK+ +I H VNK +F+EQCYYVL D
Sbjct:  103 LDVITVNLNMDTVNFLGISIVGQTS---NCGDNGIYVANIMKGGAVALDGRIEAGDMILQVNETSFENFTNDQAVDVLREAVSRRGPIKLTVAKSFENGQSCFTIPRNSREEPVRPIDTQAWIQHTNAMRGMP-----------SIVEESAPTPIPGEW-------PHGRPPSSSTVTSNGSNGQNTVVGGGAHII---LDIHTDKKKVVEIMAMPGSGLDIKNRTWLKIPIPMSFLGSDLVEWLLDHVEGLRERKTARNFAADLLKLKYIAHVVNKVTFTEQCYYVLGD 368          
BLAST of Dishevelled vs. Ensembl Celegans
Match: dsh-1 (DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU4])

HSP 1 Score: 240.35 bits (612), Expect = 7.693e-69
Identity = 134/290 (46.21%), Postives = 174/290 (60.00%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLP---QQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            L++ITV LNMDTV FLGISIVGQT+     GD GIYV +IMKGGAVALDGRIE GDMIL+VN  SFEN +N++AV  LRE V + GP+ L VAKS++   + + +P   +++PVRPID +AW+ HT AM  M              ++     P  G                 S+      N QN  +G     I   L  + +   ++  MA   SGL I++R WLKI I  +F+GSDLV+WL  HV+G  +RK AR FA +LLK+ +I H VNK +F+EQCYYVL D
Sbjct:  103 LDVITVNLNMDTVNFLGISIVGQTS---NCGDNGIYVANIMKGGAVALDGRIEAGDMILQVNETSFENFTNDQAVDVLREAVSRRGPIKLTVAKSFENGQSCFTIPRNSREEPVRPIDTQAWIQHTNAMRGMP-----------SIVEESAPTPIPGEW-------PHGRPPSSSTVTSNGSNGQNTVVGGGAHII---LDIHTDKKKVVEIMAMPGSGLDIKNRTWLKIPIPMSFLGSDLVEWLLDHVEGLRERKTARNFAADLLKLKYIAHVVNKVTFTEQCYYVLGD 368          
BLAST of Dishevelled vs. Ensembl Celegans
Match: dsh-1 (DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU4])

HSP 1 Score: 241.121 bits (614), Expect = 8.843e-68
Identity = 134/290 (46.21%), Postives = 174/290 (60.00%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLP---QQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            L++ITV LNMDTV FLGISIVGQT+     GD GIYV +IMKGGAVALDGRIE GDMIL+VN  SFEN +N++AV  LRE V + GP+ L VAKS++   + + +P   +++PVRPID +AW+ HT AM  M              ++     P  G                 S+      N QN  +G     I   L  + +   ++  MA   SGL I++R WLKI I  +F+GSDLV+WL  HV+G  +RK AR FA +LLK+ +I H VNK +F+EQCYYVL D
Sbjct:  299 LDVITVNLNMDTVNFLGISIVGQTS---NCGDNGIYVANIMKGGAVALDGRIEAGDMILQVNETSFENFTNDQAVDVLREAVSRRGPIKLTVAKSFENGQSCFTIPRNSREEPVRPIDTQAWIQHTNAMRGMP-----------SIVEESAPTPIPGEW-------PHGRPPSSSTVTSNGSNGQNTVVGGGAHII---LDIHTDKKKVVEIMAMPGSGLDIKNRTWLKIPIPMSFLGSDLVEWLLDHVEGLRERKTARNFAADLLKLKYIAHVVNKVTFTEQCYYVLGD 564          

HSP 2 Score: 78.9518 bits (193), Expect = 1.014e-14
Identity = 44/94 (46.81%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   79 TRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGV-VKEEITDDDAKL-PYVNGRVVSWLVVSEGSTQSDNHSSSGK 354
            T++  ++DDE  PY+++ H PP+ ITLGD K  L R N+K++ K+LD D G  VK EI DD  +L P  N     +L+  EGST SD   SSGK
Sbjct:   72 TKVYCHIDDETDPYMLEVHVPPDLITLGDLKRVLMRTNFKYYRKALDPDSGYEVKAEIRDDSQRLTPSPNNLFELFLLTIEGSTHSD--GSSGK 163          
BLAST of Dishevelled vs. Ensembl Celegans
Match: dsh-1 (DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU4])

HSP 1 Score: 241.121 bits (614), Expect = 2.499e-67
Identity = 134/290 (46.21%), Postives = 174/290 (60.00%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLP---QQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            L++ITV LNMDTV FLGISIVGQT+     GD GIYV +IMKGGAVALDGRIE GDMIL+VN  SFEN +N++AV  LRE V + GP+ L VAKS++   + + +P   +++PVRPID +AW+ HT AM  M              ++     P  G                 S+      N QN  +G     I   L  + +   ++  MA   SGL I++R WLKI I  +F+GSDLV+WL  HV+G  +RK AR FA +LLK+ +I H VNK +F+EQCYYVL D
Sbjct:  299 LDVITVNLNMDTVNFLGISIVGQTS---NCGDNGIYVANIMKGGAVALDGRIEAGDMILQVNETSFENFTNDQAVDVLREAVSRRGPIKLTVAKSFENGQSCFTIPRNSREEPVRPIDTQAWIQHTNAMRGMP-----------SIVEESAPTPIPGEW-------PHGRPPSSSTVTSNGSNGQNTVVGGGAHII---LDIHTDKKKVVEIMAMPGSGLDIKNRTWLKIPIPMSFLGSDLVEWLLDHVEGLRERKTARNFAADLLKLKYIAHVVNKVTFTEQCYYVLGD 564          

HSP 2 Score: 78.9518 bits (193), Expect = 1.187e-14
Identity = 44/94 (46.81%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   79 TRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGV-VKEEITDDDAKL-PYVNGRVVSWLVVSEGSTQSDNHSSSGK 354
            T++  ++DDE  PY+++ H PP+ ITLGD K  L R N+K++ K+LD D G  VK EI DD  +L P  N     +L+  EGST SD   SSGK
Sbjct:   72 TKVYCHIDDETDPYMLEVHVPPDLITLGDLKRVLMRTNFKYYRKALDPDSGYEVKAEIRDDSQRLTPSPNNLFELFLLTIEGSTHSDG--SSGK 163          
BLAST of Dishevelled vs. Ensembl Celegans
Match: dsh-1 (DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWU4])

HSP 1 Score: 243.817 bits (621), Expect = 8.265e-67
Identity = 134/290 (46.21%), Postives = 174/290 (60.00%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLP---QQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            L++ITV LNMDTV FLGISIVGQT+     GD GIYV +IMKGGAVALDGRIE GDMIL+VN  SFEN +N++AV  LRE V + GP+ L VAKS++   + + +P   +++PVRPID +AW+ HT AM  M              ++     P  G                 S+      N QN  +G     I   L  + +   ++  MA   SGL I++R WLKI I  +F+GSDLV+WL  HV+G  +RK AR FA +LLK+ +I H VNK +F+EQCYYVL D
Sbjct:  578 LDVITVNLNMDTVNFLGISIVGQTS---NCGDNGIYVANIMKGGAVALDGRIEAGDMILQVNETSFENFTNDQAVDVLREAVSRRGPIKLTVAKSFENGQSCFTIPRNSREEPVRPIDTQAWIQHTNAMRGMP-----------SIVEESAPTPIPGEW-------PHGRPPSSSTVTSNGSNGQNTVVGGGAHII---LDIHTDKKKVVEIMAMPGSGLDIKNRTWLKIPIPMSFLGSDLVEWLLDHVEGLRERKTARNFAADLLKLKYIAHVVNKVTFTEQCYYVLGD 843          
BLAST of Dishevelled vs. Ensembl Fly
Match: dsh (gene:FBgn0000499 transcript:FBtr0073454)

HSP 1 Score: 260.766 bits (665), Expect = 1.137e-74
Identity = 139/288 (48.26%), Postives = 181/288 (62.85%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLND 1836
            LNIITV++NM+ V FLGISIVGQ+N     GDGGIYVGSIMKGGAVALDGRIEPGDMIL+VN ++FEN++N+EAVR LRE VQK GP+ LVVAK WDPNP GY  +P+ +PVRPIDP                              G ++ +  A+++                        +  I    E I   L  N+    I++AM + DSGL IRDR+WLKITI NAFIG+D V+W+  +V+   DR++AR+  + +L+  +I+HTVNK +FSEQCYYV+N+
Sbjct:  248 LNIITVSINMEAVNFLGISIVGQSN---RGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDVNFENMTNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDP------------------------------GAWVAHTQALTS-----------------------HDSIIADIAEPIKERLDQNNLEE-IVKAMTKPDSGLEIRDRMWLKITIPNAFIGADAVNWVLENVEDVQDRREARRIVSAMLRSNYIKHTVNKLTFSEQCYYVVNE 478          

HSP 2 Score: 120.553 bits (301), Expect = 1.121e-27
Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 1
Query:   73 EETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPN--YKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHS 342
            +ET++IY++DDE TPYL+K   P  Q+TL DFK  LN+ N  YK+FFKS+D DFGVVKEEI DD   LP  NGRVVSWLV ++G+ QSDN S
Sbjct:    9 QETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTILPCFNGRVVSWLVSADGTNQSDNCS 100          
BLAST of Dishevelled vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0343764)

HSP 1 Score: 57.3806 bits (137), Expect = 8.973e-8
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1021 LGISIVGQTNGN----------------QENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQV-----QKLGPVTLVVAK 1257
            LG+S+ G+T  N                + +GD GI+V +++ GGA + DGR+   D +L VNG+S    +N EA+ TLR  +     +  G +TL+V +
Sbjct:  656 LGVSVKGKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGKHPGTITLLVGR 755          
BLAST of Dishevelled vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0111000)

HSP 1 Score: 57.3806 bits (137), Expect = 9.889e-8
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1021 LGISIVGQTNGN----------------QENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQV-----QKLGPVTLVVAK 1257
            LG+S+ G+T  N                + +GD GI+V +++ GGA + DGR+   D +L VNG+S    +N EA+ TLR  +     +  G +TL+V +
Sbjct:  656 LGVSVKGKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGKHPGTITLLVGR 755          
BLAST of Dishevelled vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0074388)

HSP 1 Score: 56.9954 bits (136), Expect = 1.060e-7
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1021 LGISIVGQTNGN----------------QENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQV-----QKLGPVTLVVAK 1257
            LG+S+ G+T  N                + +GD GI+V +++ GGA + DGR+   D +L VNG+S    +N EA+ TLR  +     +  G +TL+V +
Sbjct:  635 LGVSVKGKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGKHPGTITLLVGR 734          
BLAST of Dishevelled vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0343763)

HSP 1 Score: 56.9954 bits (136), Expect = 1.083e-7
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1021 LGISIVGQTNGN----------------QENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQV-----QKLGPVTLVVAK 1257
            LG+S+ G+T  N                + +GD GI+V +++ GGA + DGR+   D +L VNG+S    +N EA+ TLR  +     +  G +TL+V +
Sbjct:  635 LGVSVKGKTCSNLNASGSSASSGSNGLMKHDGDLGIFVKNVIHGGAASRDGRLRMNDQLLSVNGVSLRGQNNAEAMETLRRAMVNTPGKHPGTITLLVGR 734          
BLAST of Dishevelled vs. Ensembl Zebrafish
Match: dvl3a (dishevelled segment polarity protein 3a [Source:ZFIN;Acc:ZDB-GENE-010319-1])

HSP 1 Score: 309.301 bits (791), Expect = 1.966e-91
Identity = 165/320 (51.56%), Postives = 210/320 (65.62%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNP-TGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVH 1932
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+ N++AVR LRE V K GPV+L VAK WDPNP + + LP+ +P+RPIDP AWV HT AM                   +G Y PY                S   S+V    +  +  I  T+      L+ + + + + +AMA  DSGL +RDR+WLKITI NAFIGSD+VDWL+ HV+GFTDR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D+ G ++ ++L+    S    A  Q +   L+H
Sbjct:  251 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMCNDDAVRVLREIVHKPGPVSLTVAKCWDPNPNSCFALPRSEPIRPIDPAAWVSHTAAM-------------------TGVYPPYG--------------MSPSMSTVTSTSSSISSSIPETERFDDYHLSVHSDMATVAKAMACPDSGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLSGNMAHLSLQDHDGSSG--ASDQDTLAPLLH 532          

HSP 2 Score: 134.42 bits (337), Expect = 7.922e-32
Identity = 67/122 (54.92%), Postives = 83/122 (68.03%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSF 435
            M ET++IY++DD+ETPYL+K   P E++TL D KNAL +PNYKFFFKS+DDDFGVVKEEITDD+AKLP  NGRV+ WLV S+GS       S G  V    S++           D + PSF
Sbjct:    1 MGETKVIYHLDDQETPYLVKLPIPAERVTLLDLKNALKKPNYKFFFKSMDDDFGVVKEEITDDNAKLPCYNGRVICWLVSSDGS------HSDGCSVAESQSERPPSHERSQGIGDSRPPSF 116          
BLAST of Dishevelled vs. Ensembl Zebrafish
Match: dvl1b (dishevelled segment polarity protein 1b [Source:ZFIN;Acc:ZDB-GENE-071004-1])

HSP 1 Score: 291.967 bits (746), Expect = 6.847e-85
Identity = 153/299 (51.17%), Postives = 192/299 (64.21%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNH-EPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y                               PQN+F    DE    PLT    + + I++ M   DSGL IRDR+WLKITI NA IG D+VDWLYS V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:  241 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRILREIVSKNGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWISHTTAL-------------------TGSY-------------------------------PQNEF----DEL---PLTMGKTDMATIVKVMQLPDSGLEIRDRMWLKITIANAVIGGDVVDWLYSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMATLNL 479          

HSP 2 Score: 128.257 bits (321), Expect = 9.055e-30
Identity = 59/87 (67.82%), Postives = 73/87 (83.91%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D+EETPYL+K    PE++TL DFKN L NRP  +YKFFFKS+D DFGVVKEE++DD+AKLP  NGRVVSWLV++E S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLSVAPEKVTLADFKNVLSNRPVNSYKFFFKSMDQDFGVVKEEVSDDNAKLPCFNGRVVSWLVLAESS 87          
BLAST of Dishevelled vs. Ensembl Zebrafish
Match: dvl1b (dishevelled segment polarity protein 1b [Source:ZFIN;Acc:ZDB-GENE-071004-1])

HSP 1 Score: 291.967 bits (746), Expect = 8.102e-85
Identity = 153/299 (51.17%), Postives = 192/299 (64.21%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNH-EPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y                               PQN+F    DE    PLT    + + I++ M   DSGL IRDR+WLKITI NA IG D+VDWLYS V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:  250 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRILREIVSKNGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWISHTTAL-------------------TGSY-------------------------------PQNEF----DEL---PLTMGKTDMATIVKVMQLPDSGLEIRDRMWLKITIANAVIGGDVVDWLYSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMATLNL 488          

HSP 2 Score: 127.872 bits (320), Expect = 1.065e-29
Identity = 59/87 (67.82%), Postives = 73/87 (83.91%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D+EETPYL+K    PE++TL DFKN L NRP  +YKFFFKS+D DFGVVKEE++DD+AKLP  NGRVVSWLV++E S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLSVAPEKVTLADFKNVLSNRPVNSYKFFFKSMDQDFGVVKEEVSDDNAKLPCFNGRVVSWLVLAESS 87          
BLAST of Dishevelled vs. Ensembl Zebrafish
Match: dvl1a (dishevelled segment polarity protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-40])

HSP 1 Score: 282.722 bits (722), Expect = 5.342e-83
Identity = 146/298 (48.99%), Postives = 190/298 (63.76%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+                   SG Y                               P  +F     + +P  ++     +++ + M   DSGL IRDR+WLKITI NA IG+D+VDWL+S V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:   90 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEVNFENMSNDDAVRILREIVSKPGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWITHTTAL-------------------SGPY-------------------------------PHYEF-----DDLPLSVSKTDMATIV-KVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLFSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMASLNL 328          
BLAST of Dishevelled vs. Ensembl Zebrafish
Match: dvl1a (dishevelled segment polarity protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-40])

HSP 1 Score: 268.47 bits (685), Expect = 6.676e-79
Identity = 138/284 (48.59%), Postives = 187/284 (65.85%), Query Frame = 1
Query: 1018 FLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+                   SG Y P+ G +                  ++   + ++ F     + +P  ++   + + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWL+S V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:   38 FLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEVNFENMSNDDAVRILREIVSKPGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWITHTTAL-------------------SGPY-PHYGMI------------------LLVTSHKRSSF-----DDLPLSVSKT-DMATIVKVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLFSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMASLNL 274          
BLAST of Dishevelled vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 300.056 bits (767), Expect = 1.482e-87
Identity = 157/298 (52.68%), Postives = 200/298 (67.11%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN  +FEN+SN++AVR LRE V K GP+TL VAK WDP+P   + LP+ +P+RPIDP AWV HT AM                   +G Y  Y  + S    T T++S +          + Q              L+ + +   I++AM   +SGL +RDR+WLKITI NAFIGSD+VDWLY HV+GFTDR++ARK+A+NLLK G+IRHTVNK +FSEQCYY+  D+ G ++ ++L
Sbjct:  244 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDTNFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRNCFTLPRSEPIRPIDPAAWVSHTAAM-------------------TGSYPAYGMSPSMSTITSTSSSITSSIPETERFDDFQ--------------LSIHSDMVTIVKAMRSPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHVEGFTDRREARKYASNLLKAGYIRHTVNKITFSEQCYYIFGDLCGNMANLSL 505          

HSP 2 Score: 138.272 bits (347), Expect = 8.653e-33
Identity = 62/88 (70.45%), Postives = 77/88 (87.50%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSD 333
            M ET++IY++D++ETPYL+K   P E++TLGDFKN LN+PNYKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVV WLV ++GS QSD
Sbjct:    1 MGETKVIYHLDEQETPYLVKLPVPAEKVTLGDFKNVLNKPNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWLVSADGS-QSD 87          
BLAST of Dishevelled vs. Ensembl Xenopus
Match: dvl1 (dishevelled segment polarity protein 1 [Source:NCBI gene;Acc:100144639])

HSP 1 Score: 294.664 bits (753), Expect = 3.658e-87
Identity = 151/298 (50.67%), Postives = 201/298 (67.45%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y  Y  + S    T T++S +       + ++              SPL+   + + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWLY+HV+GF +R++ARK+A+++LK G++RHTVNK +FSEQCYYV  D+ G ++ +NL
Sbjct:  249 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPVRPIDPAAWITHTSAL-------------------TGAYPRYGMSPSMSIITCTSSSLTSSKPESEKQED--------------SPLSVKSDMATIVKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGYLRHTVNKITFSEQCYYVFGDLCGNVAALNL 510          

HSP 2 Score: 131.339 bits (329), Expect = 5.028e-31
Identity = 65/96 (67.71%), Postives = 79/96 (82.29%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSS 348
            M ET+IIY++D+EETPYL+K   PPE++TL DFKN L NRP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S+ SD  S S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLPVPPEKVTLADFKNVLSNRPVHHYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAE-SSHSDGGSQS 95          
BLAST of Dishevelled vs. Ensembl Xenopus
Match: dvl1 (dishevelled segment polarity protein 1 [Source:NCBI gene;Acc:100144639])

HSP 1 Score: 294.664 bits (753), Expect = 8.498e-86
Identity = 151/298 (50.67%), Postives = 201/298 (67.45%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y  Y  + S    T T++S +       + ++              SPL+   + + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWLY+HV+GF +R++ARK+A+++LK G++RHTVNK +FSEQCYYV  D+ G ++ +NL
Sbjct:  249 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPVRPIDPAAWITHTSAL-------------------TGAYPRYGMSPSMSIITCTSSSLTSSKPESEKQED--------------SPLSVKSDMATIVKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGYLRHTVNKITFSEQCYYVFGDLCGNVAALNL 510          

HSP 2 Score: 132.109 bits (331), Expect = 8.477e-31
Identity = 65/96 (67.71%), Postives = 79/96 (82.29%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSS 348
            M ET+IIY++D+EETPYL+K   PPE++TL DFKN L NRP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S+ SD  S S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLPVPPEKVTLADFKNVLSNRPVHHYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAE-SSHSDGGSQS 95          
BLAST of Dishevelled vs. Ensembl Xenopus
Match: dvl1 (dishevelled segment polarity protein 1 [Source:NCBI gene;Acc:100144639])

HSP 1 Score: 294.278 bits (752), Expect = 1.038e-85
Identity = 151/298 (50.67%), Postives = 201/298 (67.45%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y  Y  + S    T T++S +       + ++              SPL+   + + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWLY+HV+GF +R++ARK+A+++LK G++RHTVNK +FSEQCYYV  D+ G ++ +NL
Sbjct:  234 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPVRPIDPAAWITHTSAL-------------------TGAYPRYGMSPSMSIITCTSSSLTSSKPESEKQED--------------SPLSVKSDMATIVKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGYLRHTVNKITFSEQCYYVFGDLCGNVAALNL 495          

HSP 2 Score: 133.265 bits (334), Expect = 3.053e-31
Identity = 66/96 (68.75%), Postives = 79/96 (82.29%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNAL-NRP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSS 348
            M ETRIIY++D+EETPYL+K   PPE++TL DFKN L NRP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S+ SD  S S
Sbjct:    1 MAETRIIYHIDEEETPYLVKLPVPPEKVTLADFKNVLSNRPVHHYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAE-SSHSDGGSQS 95          
BLAST of Dishevelled vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 281.952 bits (720), Expect = 3.821e-81
Identity = 147/284 (51.76%), Postives = 189/284 (66.55%), Query Frame = 1
Query: 1018 FLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN  +FEN+SN++AVR LRE V K GP+TL VAK WDP+P   + LP+ +P+RPIDP AWV HT AM                   +G Y  Y  + S    T T++S +          + Q              L+ + +   I++AM   +SGL +RDR+WLKITI NAFIGSD+VDWLY HV+GFTDR++ARK+A+NLLK G+IRHTVNK +FSEQCYY+  D+ G ++ ++L
Sbjct:  252 FLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDTNFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRNCFTLPRSEPIRPIDPAAWVSHTAAM-------------------TGSYPAYGMSPSMSTITSTSSSITSSIPETERFDDFQ--------------LSIHSDMVTIVKAMRSPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHVEGFTDRREARKYASNLLKAGYIRHTVNKITFSEQCYYIFGDLCGNMANLSL 499          

HSP 2 Score: 138.272 bits (347), Expect = 8.821e-33
Identity = 62/88 (70.45%), Postives = 77/88 (87.50%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSD 333
            M ET++IY++D++ETPYL+K   P E++TLGDFKN LN+PNYKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVV WLV ++GS QSD
Sbjct:    1 MGETKVIYHLDEQETPYLVKLPVPAEKVTLGDFKNVLNKPNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWLVSADGS-QSD 87          
BLAST of Dishevelled vs. Ensembl Mouse
Match: Dvl2 (dishevelled segment polarity protein 2 [Source:MGI Symbol;Acc:MGI:106613])

HSP 1 Score: 292.738 bits (748), Expect = 7.205e-85
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  263 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 548          

HSP 2 Score: 119.783 bits (299), Expect = 4.435e-27
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. Ensembl Mouse
Match: Dvl2 (dishevelled segment polarity protein 2 [Source:MGI Symbol;Acc:MGI:106613])

HSP 1 Score: 292.738 bits (748), Expect = 7.205e-85
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  263 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 548          

HSP 2 Score: 119.783 bits (299), Expect = 4.435e-27
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. Ensembl Mouse
Match: Dvl2 (dishevelled segment polarity protein 2 [Source:MGI Symbol;Acc:MGI:106613])

HSP 1 Score: 292.738 bits (748), Expect = 7.205e-85
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  263 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 548          

HSP 2 Score: 119.783 bits (299), Expect = 4.435e-27
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. Ensembl Mouse
Match: Dvl3 (dishevelled segment polarity protein 3 [Source:MGI Symbol;Acc:MGI:108100])

HSP 1 Score: 275.789 bits (704), Expect = 5.566e-79
Identity = 157/330 (47.58%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPI 1962
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+TL VAK WDP+P G + LP+ +   PI P                           I    ++ +  AM+        + S    +S             R D+     L+ + + + I++AMA  +SGL +RDR+WLKITI NAFIGSD+VDWLY +V+GFTDR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D+ G ++ ++L     S    A  Q +   L H  PG    P+
Sbjct:  245 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSE---PIRP---------------------------IDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFH---LSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSG--ASDQDTLAPLPH--PGAAPWPM 534          

HSP 2 Score: 132.109 bits (331), Expect = 5.248e-31
Identity = 59/84 (70.24%), Postives = 71/84 (84.52%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D +ETPYL+K   P E++TL DFK  L RP+YKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVVSWLV +EGS
Sbjct:    1 MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGS 84          
BLAST of Dishevelled vs. Ensembl Mouse
Match: Dvl3 (dishevelled segment polarity protein 3 [Source:MGI Symbol;Acc:MGI:108100])

HSP 1 Score: 275.789 bits (704), Expect = 5.665e-79
Identity = 157/330 (47.58%), Postives = 203/330 (61.52%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPI 1962
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+TL VAK WDP+P G + LP+ +   PI P                           I    ++ +  AM+        + S    +S             R D+     L+ + + + I++AMA  +SGL +RDR+WLKITI NAFIGSD+VDWLY +V+GFTDR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D+ G ++ ++L     S    A  Q +   L H  PG    P+
Sbjct:  245 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSE---PIRP---------------------------IDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFH---LSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSG--ASDQDTLAPLPH--PGAAPWPM 534          

HSP 2 Score: 132.109 bits (331), Expect = 5.577e-31
Identity = 59/84 (70.24%), Postives = 71/84 (84.52%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D +ETPYL+K   P E++TL DFK  L RP+YKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVVSWLV +EGS
Sbjct:    1 MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGS 84          
BLAST of Dishevelled vs. UniProt/SwissProt
Match: sp|B1WAP7|DVL3_XENTR (Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus tropicalis OX=8364 GN=dvl3 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 7.852e-87
Identity = 157/298 (52.68%), Postives = 200/298 (67.11%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN  +FEN+SN++AVR LRE V K GP+TL VAK WDP+P   + LP+ +P+RPIDP AWV HT AM                   +G Y  Y  + S    T T++S +          + Q              L+ + +   I++AM   +SGL +RDR+WLKITI NAFIGSD+VDWLY HV+GFTDR++ARK+A+NLLK G+IRHTVNK +FSEQCYY+  D+ G ++ ++L
Sbjct:  244 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDTNFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRNCFTLPRSEPIRPIDPAAWVSHTAAM-------------------TGSYPAYGMSPSMSTITSTSSSITSSIPETERFDDFQ--------------LSIHSDMVTIVKAMRSPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHVEGFTDRREARKYASNLLKAGYIRHTVNKITFSEQCYYIFGDLCGNMANLSL 505          

HSP 2 Score: 138.272 bits (347), Expect = 4.584e-32
Identity = 62/88 (70.45%), Postives = 77/88 (87.50%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSD 333
            M ET++IY++D++ETPYL+K   P E++TLGDFKN LN+PNYKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVV WLV ++GS QSD
Sbjct:    1 MGETKVIYHLDEQETPYLVKLPVPAEKVTLGDFKNVLNKPNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWLVSADGS-QSD 87          
BLAST of Dishevelled vs. UniProt/SwissProt
Match: sp|Q6DKE2|DVL3_XENLA (Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.008e-86
Identity = 156/298 (52.35%), Postives = 202/298 (67.79%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTG-YMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN  +FEN+SN++AVR LR+ V K GP+TL VAK WDP+P   + LP+ +P+RPIDP AWV HT AM                   +G Y  Y  + S    T T++S +          + Q              L+ + +   I++AM+ ++SGL +RDR+WLKITI NAFIGSD+VDWLY HV+GFTDR++ARK+A+NLLK G+IRHTVNK +FSEQCYY+  D+ G ++ ++L
Sbjct:  244 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDTNFENMSNDDAVRVLRDIVHKPGPITLTVAKCWDPSPRNCFTLPRSEPIRPIDPAAWVSHTAAM-------------------TGTYPAYGMSPSMSTITSTSSSITSSIPETERFDDFQ--------------LSIHSDMVTIVKAMSSSESGLEVRDRMWLKITIPNAFIGSDVVDWLYHHVEGFTDRREARKYASNLLKAGYIRHTVNKITFSEQCYYIFGDLCGNMANLSL 505          

HSP 2 Score: 137.887 bits (346), Expect = 6.494e-32
Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSF 435
            M ET++IY++D++ETPYL+K   P E++TLGDFKN LN+PNYKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVV WLV ++GS QSD    +G     + SD            D + PSF
Sbjct:    1 MGETKVIYHLDEQETPYLVKLPVPAEKVTLGDFKNILNKPNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWLVSADGS-QSD----AGSVCADIQSDLPPPIERTGGIGDSRPPSF 117          
BLAST of Dishevelled vs. UniProt/SwissProt
Match: sp|P51142|DVL2_XENLA (Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 1.490e-85
Identity = 156/297 (52.53%), Postives = 202/297 (68.01%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMN 1863
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LR+ V K GP+ L VAK WDP+P GY  LP+ +P+ PIDP AWV H+ A+                   SG +  Y G+ S  + T +T+ +  + S  +    P + F           L+ + + + +++ MA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF DR++ARKFA+NLLK GFIRHTVNK +FSEQCYY+  D+ G  + M 
Sbjct:  250 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQGYFTLPRNEPIHPIDPAAWVSHSAAL-------------------SGSFPVYPGSASMSSMTSSTSVTETELSHALP---PVSLF----------SLSVHTDLASVVKVMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFQDRREARKFASNLLKAGFIRHTVNKITFSEQCYYIFGDLTGCENYMT 511          

HSP 2 Score: 114.775 bits (286), Expect = 1.308e-24
Identity = 53/84 (63.10%), Postives = 65/84 (77.38%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET++IY++D+EETPYL+K   P   I L DFK AL R + K+FFK++D DFGVVKEEI+DD+AKLP  N RVVSWL  SEGS
Sbjct:    1 MAETKVIYHLDEEETPYLVKVPVPATDIRLRDFKAALGRGHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNDRVVSWLASSEGS 84          
BLAST of Dishevelled vs. UniProt/SwissProt
Match: sp|Q05AS8|DVL2_XENTR (Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus tropicalis OX=8364 GN=dvl2 PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.270e-84
Identity = 155/296 (52.36%), Postives = 201/296 (67.91%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVM 1860
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LR+ V K GP+ L VAK WDP+P GY  LP+ +P++PIDP AWV H+ A+                   SG +  Y G+ S  + T +T+ +  + S  +    P + F           L+ + + + + + MA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF DR++ARKFA+NLLK G IRHTVNK +FSEQCYY+  D+ G  + M
Sbjct:  246 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIILTVAKCWDPSPQGYFTLPRNEPIQPIDPAAWVSHSAAL-------------------SGSFPVYPGSASMSSMTSSTSVTETELSHALP---PVSLF----------SLSVHTDLASVAKVMASPESGLEVRDRMWLKITIPNAFLGSDMVDWLYHHVEGFQDRREARKFASNLLKAGLIRHTVNKITFSEQCYYIFGDLTGCENYM 506          

HSP 2 Score: 118.242 bits (295), Expect = 9.904e-26
Identity = 55/89 (61.80%), Postives = 72/89 (80.90%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDN 336
            M ET++IY++D+EETPYL+K   P  +I L DFK AL R + K+FFK++D DFGVVKEEI+DD+AKLP  NGRVVSWLV SE ++Q+D+
Sbjct:    1 MAETKVIYHLDEEETPYLVKVPVPANEIRLRDFKAALGRGHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVSSE-TSQTDS 88          
BLAST of Dishevelled vs. UniProt/SwissProt
Match: sp|Q60838|DVL2_MOUSE (Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2)

HSP 1 Score: 292.738 bits (748), Expect = 5.040e-84
Identity = 161/333 (48.35%), Postives = 206/333 (61.86%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALS--VMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPIL 1965
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LR+ V K GP+ L VAK WDP+P  Y  LP+ +P++PIDP AWV H+ A+    P    P +S    I SG  LP                               +   GR        L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+VDWLY HV+GF +R++ARK+A+ LLK G IRHTVNK +FSEQCYYV  D+ G     ++NL    +  S  A  Q +   L    PG    P+L
Sbjct:  263 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAY--PGSSSMSTITSGSSLP-------------------------------DGCEGRG-------LSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPL----PGATPWPLL 548          

HSP 2 Score: 119.783 bits (299), Expect = 3.102e-26
Identity = 54/81 (66.67%), Postives = 68/81 (83.95%), Query Frame = 1
Query:   76 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            ET++IY++D+EETPYL+K   P E+ITLGDFK+ L RP   K+FFKS+D DFGVVKEEI+DD+A+LP  NGRVVSWLV S+
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSD 93          
BLAST of Dishevelled vs. TrEMBL
Match: Q589S6 (Dishevelled OS=Dugesia japonica OX=6161 GN=DjdshA PE=2 SV=1)

HSP 1 Score: 1088.56 bits (2814), Expect = 0.000e+0
Identity = 627/706 (88.81%), Postives = 651/706 (92.21%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIM---TMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSR 2178
            MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNK+PTKHSSSSKKQEE +K HRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSH N+++++N   +N+         KQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNG+QENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTL+EQVQKLGPVTLVVAKSWDPNP GYMLPQQDPVRPIDPRAWVLHTQAMGNMAPP QPP +SGDQFIQSGKYLPYAGAM               S+  +EVQNPQ KFI R DE+IPSPLT NHEP++IIRAMAQADSGL IRDRLWLKITIYNAFIGSDLVDWLYSHVQGF+DRK+ARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDM  ALSVMNLESEIDSVSVVAGQQQSK RL+HQDPGCKESPILSSGFQSACSNKWS +N QSNPGPEMYSQAQI+     NNN+ FKYQNFY D +Q QSQSLVKPLGLSSNLK SR
Sbjct:    1 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKVPTKHSSSSKKQEEGSKSHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHSNNSNNNNGTTNNA--------VKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGSQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLKEQVQKLGPVTLVVAKSWDPNPPGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPTQPP-SSGDQFIQSGKYLPYAGAM---------------STVAIEVQNPQGKFINRNDESIPSPLTVNHEPAIIIRAMAQADSGLLIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFSDRKEARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMTSALSVMNLESEIDSVSVVAGQQQSKARLMHQDPGCKESPILSSGFQSACSNKWSGFNPQSNPGPEMYSQAQILNINNNNNNSNFKYQNFYPDTIQQQSQSLVKPLGLSSNLKPSR 682          

HSP 2 Score: 179.104 bits (453), Expect = 1.709e-42
Identity = 85/94 (90.43%), Postives = 89/94 (94.68%), Query Frame = 1
Query: 2593 NVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD 2874
            NV RNI MPVYH+QN  PVIGSGIVLPDASQYP+HNSPPPSYQQSM+IGTILGKNQSIM GD+SSNQFSLAISNGILNENSSSGFFSDGVDKCD
Sbjct:  701 NVARNISMPVYHIQNQPPVIGSGIVLPDASQYPMHNSPPPSYQQSMSIGTILGKNQSIMTGDSSSNQFSLAISNGILNENSSSGFFSDGVDKCD 794          
BLAST of Dishevelled vs. TrEMBL
Match: F2WMR4 (Dvl-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 565/582 (97.08%), Postives = 565/582 (97.08%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQ 1815
            MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS                TDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSE 
Sbjct:    1 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKSR---------------TDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEH 567          

HSP 2 Score: 132.109 bits (331), Expect = 7.024e-28
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 2
Query: 1871 QRLTRFRLLPANSNPKRDWCIKILAVRSRQFSHRDSSLLAVTNGQVTISSRILVQKCIHKHK 2056
            QRLTRFRLLPANSNPKRDWCIKILAVRSRQFSHRDSSLLAVTNGQVTISSRILVQKCIHKHK
Sbjct:  568 QRLTRFRLLPANSNPKRDWCIKILAVRSRQFSHRDSSLLAVTNGQVTISSRILVQKCIHKHK 629          
BLAST of Dishevelled vs. TrEMBL
Match: B1NWV8 (Dishevelled-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=Dvl-a PE=2 SV=1)

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 558/573 (97.38%), Postives = 558/573 (97.38%), Query Frame = 1
Query:   97 VDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQ 1815
            VDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS               RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQ
Sbjct:    1 VDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS---------------RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQ 558          
BLAST of Dishevelled vs. TrEMBL
Match: R7UM85 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183104 PE=4 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 7.687e-140
Identity = 313/595 (52.61%), Postives = 381/595 (64.03%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS-TQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQ-FIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMG 1845
            MEET+IIY++DDE+TPYLIK   P +++TLGDFKNALNRPNYKFFFKS+DDDFGVVKEEI D++ KLP  NGRVVSWLV ++ S TQS    S          D S     V    D + PSF                       H   H      +    ET D   E DS+      PP R      + +   KL   Q SHG                           ++++SS++SSDL+TTSFFDSEDDS   +    T+ SSKYG+ RR+ RR  ++P +SRASS SS+TDST+SLNI+TVTLNMDTV FLGISIVGQ+N   + GDGGIYVGSIMKGGAVALDGRIEPGDMILEVNG+SFEN SN++AVRTLRE VQK GP+TLVVAK WDPNP GY  +P+Q+PVRPIDP AWV HT+A           + +G Q  + +G Y P   ++ST+ S  ++ SSSL  S   +  N                LT N + + I+RAMAQ DSGL IRDR+WLKITI NAFIGSDLVDWL+++V+GF DR+DARK+ATNLLK G+IRHTVNK +FSEQCYYV  D++G
Sbjct:    1 MEETKIIYHIDDEDTPYLIKLPIPADRVTLGDFKNALNRPNYKFFFKSMDDDFGVVKEEIIDEETKLPCFNGRVVSWLVPADPSDTQSQCTDSQA-------GDPSPTGERVGGIGDSRPPSF-----------------------HILFHSANASPRDQDSETCDTCTETDSL-----APPRRGNWICSNFLNGHKLDPRQRSHG---------------------------FDATSSVVSSDLETTSFFDSEDDSRFSTVTDTTSRSSKYGRHRRRRRRH-RLPPISRASSISSITDSTMSLNIVTVTLNMDTVNFLGISIVGQSN---KGGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGVSFENKSNDDAVRTLREAVQKPGPITLVVAKCWDPNPKGYFTVPRQEPVRPIDPSAWVAHTEA-----------IRAGSQGSLPAGSYRPGPASLSTLTSASSSLSSSLPDSERFDDLN----------------LTINTDMATIVRAMAQPDSGLEIRDRMWLKITIPNAFIGSDLVDWLHTNVEGFADRRDARKYATNLLKAGYIRHTVNKINFSEQCYYVFGDLLG 502          
BLAST of Dishevelled vs. TrEMBL
Match: A0A1S3II19 (segment polarity protein dishevelled homolog DVL-3 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106164491 PE=4 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 4.828e-101
Identity = 207/347 (59.65%), Postives = 248/347 (71.47%), Query Frame = 1
Query:  862 TTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAM-GNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVV 1896
            T+ SSKYG+ RR+ R+  +MP +SRASSFSS+TDST+SLNIITVTLNMDTV FLGISIVGQ+N   ++GDGGIYVGSIMKGGAVA DGRIEPGDMILEVNGISFEN+SN++AVR LRE VQK GPVTLVVAK WDPNP GY  +P+ +PVRPIDP AWV HT AM GN   P                               T  SS    SS +    P +++  R        LT   + + ++RAMAQ DSGL +RDR WLKITI NAFIGSDLVDWL+ H++GF DR+DARK+A NLLK GFIRHTVNK +FSEQCYY+  D+ G +S+++L+ ++DSVS V
Sbjct:  205 TSRSSKYGRHRRRKRKH-RMPPISRASSFSSITDSTMSLNIITVTLNMDTVNFLGISIVGQSN---KSGDGGIYVGSIMKGGAVAQDGRIEPGDMILEVNGISFENMSNDDAVRVLREAVQKPGPVTLVVAKCWDPNPKGYFTIPRHEPVRPIDPSAWVAHTTAMVGNYGGPGS-----------------------------TNMSSMTSGSSSITSSIPDSEYFDR--------LTVTTDMASVVRAMAQPDSGLEVRDRSWLKITIPNAFIGSDLVDWLHQHIEGFADRRDARKYACNLLKAGFIRHTVNKITFSEQCYYIFGDLSGNMSLLSLD-DVDSVSEV 509          

HSP 2 Score: 143.28 bits (360), Expect = 2.676e-31
Identity = 68/97 (70.10%), Postives = 78/97 (80.41%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS---TQSDNHSSSG 351
            MEET+IIY++DDE+TPYLIK   P +++TLGDFKNALNRPNYKFFFKS+DDDFGVVKEEI D+ A LP  NGRVVSWLV +E S   TQS   S  G
Sbjct:    1 MEETKIIYHIDDEDTPYLIKLSIPADKVTLGDFKNALNRPNYKFFFKSMDDDFGVVKEEIIDESAHLPCFNGRVVSWLVAAESSASDTQSQCDSQQG 97          
BLAST of Dishevelled vs. Ensembl Cavefish
Match: dvl3a (segment polarity protein dishevelled homolog DVL-3-like [Source:NCBI gene;Acc:103042896])

HSP 1 Score: 305.064 bits (780), Expect = 5.764e-90
Identity = 164/320 (51.25%), Postives = 209/320 (65.31%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNP-TGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVH 1932
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+ N++AVR LR+ V K GPV+L VAK WDPNP + + LP+ +P+RPIDP AWV HT AM                   +G Y PY                S   S+V    +  +  I  T+      L+ + + + + +AMA  DSGL +RDR+WLKITI NAFIGSD+VDWL+ HV+GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYYV  D+ G ++ ++L    +  S  A  Q +   L+H
Sbjct:  246 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMCNDDAVRVLRDIVHKPGPVSLTVAKCWDPNPNSCFALPRSEPIRPIDPAAWVSHTAAM-------------------TGIYPPYG--------------MSPSMSTVTSTSSSISSSIPETERFDDYHLSVHSDMATVAKAMACPDSGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFADRREARKYASNLLKAGFIRHTVNKITFSEQCYYVFGDLSGNMAHLSLHE--NDGSSGASDQDTLAPLLH 527          

HSP 2 Score: 132.109 bits (331), Expect = 3.837e-31
Identity = 57/84 (67.86%), Postives = 72/84 (85.71%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET++IY++D++ETPYL+K   P E++TL D KNAL +PN+KFFFKS+DDDFGVVKEEITDD+AKLP  NGRVV WLV ++GS
Sbjct:    1 MGETKVIYHLDEQETPYLVKLAVPAERVTLSDLKNALKKPNHKFFFKSMDDDFGVVKEEITDDNAKLPCYNGRVVCWLVSADGS 84          
BLAST of Dishevelled vs. Ensembl Cavefish
Match: dvl2 (dishevelled segment polarity protein 2 [Source:NCBI gene;Acc:103045219])

HSP 1 Score: 300.442 bits (768), Expect = 1.177e-87
Identity = 167/334 (50.00%), Postives = 210/334 (62.87%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVM-NLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSS 1971
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+TL VAK WDP+P GY  LP+ +P+RPIDP AWV H+ A+                   +G Y PY G+  T +S                          R DE     L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+V+WLY H++GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D     + M NL    +  S  A  Q +   L    PG    P+L S
Sbjct:  252 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPQGYFTLPRNEPIRPIDPAAWVSHSVAL-------------------TGTYPPYPGSTITSSS--------------------SVTETERFDEFN---LSLHSDMASVAKAMASPESGLEVRDRMWLKITIPNAFLGSDVVEWLYHHIEGFQDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDFSDCENYMANLSLNDNDGSSGASDQDTLAPL--PLPGATPWPLLHS 538          

HSP 2 Score: 130.568 bits (327), Expect = 1.666e-30
Identity = 59/82 (71.95%), Postives = 69/82 (84.15%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            M ET+IIY++D+EETPYL+K   P E+ITL DFK  LN+PNYKFFFKS+D DFGVVKEEI+DD AKLP  NGRVVSWLV S+
Sbjct:    1 MAETKIIYHIDEEETPYLVKIPIPAEKITLLDFKQVLNKPNYKFFFKSMDQDFGVVKEEISDDSAKLPCFNGRVVSWLVSSD 82          
BLAST of Dishevelled vs. Ensembl Cavefish
Match: dvl3a (segment polarity protein dishevelled homolog DVL-3-like [Source:NCBI gene;Acc:103042896])

HSP 1 Score: 286.96 bits (733), Expect = 1.099e-83
Identity = 154/317 (48.58%), Postives = 201/317 (63.41%), Query Frame = 1
Query:  985 ITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNP-TGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVH 1932
            ++    ++   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+ N++AVR LR+ V K GPV+L VAK WDPNP + + LP+ +P+RPIDP AWV HT AM                   +G Y PY                S   S+V    +  +  I  T+      L+ + + + + +AMA  DSGL +RDR+WLKITI NAFIGSD+VDWL+ HV+GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYYV  D+ G ++ ++L     S    A  Q +   L+H
Sbjct:  231 LSFFFTLEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMCNDDAVRVLRDIVHKPGPVSLTVAKCWDPNPNSCFALPRSEPIRPIDPAAWVSHTAAM-------------------TGIYPPYG--------------MSPSMSTVTSTSSSISSSIPETERFDDYHLSVHSDMATVAKAMACPDSGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFADRREARKYASNLLKAGFIRHTVNKITFSEQCYYVFGDLSGNMAHLSLHENDGSSG--ASDQDTLAPLLH 509          

HSP 2 Score: 131.339 bits (329), Expect = 5.307e-31
Identity = 57/84 (67.86%), Postives = 72/84 (85.71%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET++IY++D++ETPYL+K   P E++TL D KNAL +PN+KFFFKS+DDDFGVVKEEITDD+AKLP  NGRVV WLV ++GS
Sbjct:    1 MGETKVIYHLDEQETPYLVKLAVPAERVTLSDLKNALKKPNHKFFFKSMDDDFGVVKEEITDDNAKLPCYNGRVVCWLVSADGS 84          
BLAST of Dishevelled vs. Ensembl Cavefish
Match: dvl1b (segment polarity protein dishevelled homolog DVL-1-like [Source:NCBI gene;Acc:103046093])

HSP 1 Score: 286.189 bits (731), Expect = 9.028e-83
Identity = 148/304 (48.68%), Postives = 189/304 (62.17%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKF------IGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+                   +G Y                               PQ +F      +G+TD             + +++ M   DSGL IRDR+WLKITI NA IG D+VDWLYS V+GF DR+DARK+A+ +LK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:  247 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRILREIVSKTGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWISHTTAL-------------------TGSY-------------------------------PQYEFDDLPLTVGKTDM------------ATLVKVMQLPDSGLEIRDRMWLKITIANAVIGGDVVDWLYSRVEGFKDRRDARKYASTMLKHGYLRHTVNKITFSEQCYYTFGDICQNMASLNL 485          

HSP 2 Score: 126.716 bits (317), Expect = 2.400e-29
Identity = 59/87 (67.82%), Postives = 73/87 (83.91%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALN-RP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGS 321
            M ET+IIY++D+EETPYL+K    P+++TL DFKN LN RP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLPVAPDKVTLADFKNVLNNRPVNSYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAESS 87          
BLAST of Dishevelled vs. Ensembl Cavefish
Match: dvl2 (dishevelled segment polarity protein 2 [Source:NCBI gene;Acc:103045219])

HSP 1 Score: 281.952 bits (720), Expect = 5.839e-81
Identity = 159/320 (49.69%), Postives = 203/320 (63.44%), Query Frame = 1
Query: 1018 FLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVM-NLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSS 1971
            FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+TL VAK WDP+P GY  LP+ +P+RPIDP AWV H+ A+                   +G Y PY G+  T +S++T T                     R DE     L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+V+WLY H++GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYY+  D     + M NL    +  S  A  Q +   L    PG    P+L S
Sbjct:  266 FLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPQGYFTLPRNEPIRPIDPAAWVSHSVAL-------------------TGTYPPYPGSTITSSSSVTETE--------------------RFDEFN---LSLHSDMASVAKAMASPESGLEVRDRMWLKITIPNAFLGSDVVEWLYHHIEGFQDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDFSDCENYMANLSLNDNDGSSGASDQDTLAPL--PLPGATPWPLLHS 538          

HSP 2 Score: 125.946 bits (315), Expect = 5.170e-29
Identity = 56/78 (71.79%), Postives = 66/78 (84.62%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWL 303
            M ET+IIY++D+EETPYL+K   P E+ITL DFK  LN+PNYKFFFKS+D DFGVVKEEI+DD AKLP  NGRVVSW+
Sbjct:    1 MAETKIIYHIDEEETPYLVKIPIPAEKITLLDFKQVLNKPNYKFFFKSMDQDFGVVKEEISDDSAKLPCFNGRVVSWV 78          
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001371.1 (pep scaffold:Pmarinus_7.0:GL492828:1505:4356:1 gene:ENSPMAG00000001236.1 transcript:ENSPMAT00000001371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 1.731e-39
Identity = 59/95 (62.11%), Postives = 79/95 (83.16%), Query Frame = 1
Query: 1564 LTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGA 1848
            L+ + + + +++AMA  +SGL +RDR+WLKITI NAFIGSDLVDWL++H++GF DR+DARK+A NLLK G IRHTVNK +FSEQCYY+  D+ G+
Sbjct:   63 LSIHSDMATVVKAMASPESGLEVRDRMWLKITIPNAFIGSDLVDWLFNHLEGFQDRRDARKYACNLLKAGLIRHTVNKITFSEQCYYIFGDLCGS 157          

HSP 2 Score: 67.781 bits (164), Expect = 2.044e-13
Identity = 28/46 (60.87%), Postives = 32/46 (69.57%), Query Frame = 1
Query: 1234 PVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAP 1368
            P+TL VAK WDP P GY  +P+ +PVRPIDP AWV HT AM    P
Sbjct:   10 PITLTVAKCWDPTPRGYFTIPRSEPVRPIDPAAWVSHTAAMTGAYP 55          
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009066.1 (pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 gene:ENSPMAG00000008193.1 transcript:ENSPMAT00000009066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 2.286e-8
Identity = 32/73 (43.84%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  991 VTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTL 1209
            V +N+     LG SIV      Q N   GIY+ SI+KGGA  LDGRI  GD +L +NG S   +S + AV  +
Sbjct:  628 VQINLQKRQGLGFSIVAAKGPRQANI--GIYIKSIIKGGAADLDGRIARGDQLLSINGTSLIGISEKRAVEIM 698          
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.622e-7
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLR 1212
            L++ TV L       LG+SIVG+ +GN      G++V  ++ GGA   DGR+  GD IL V+G    + S E     L+
Sbjct:   73 LHVFTVELLKKAGRGLGLSIVGKKSGN------GVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILK 145          
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007682.1 (pep scaffold:Pmarinus_7.0:GL479837:661:11661:1 gene:ENSPMAG00000006940.1 transcript:ENSPMAT00000007682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 4.890e-7
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 1
Query:   85 IIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPN-YKFFFKSLDDDF--GVVKEEITDDDAKLPY----VNGRV 291
            ++YY   E  PY          +TLG FK  L +   Y+++FK   +DF  GVV EE+ DDDA LP     +NG+V
Sbjct:  205 VVYYFCGETIPYRTSVRG--HVLTLGHFKELLTKKGTYRYYFKKASEDFDCGVVYEEVQDDDAILPIYEEKINGKV 278          
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008444.1 (pep scaffold:Pmarinus_7.0:GL479496:14395:17295:-1 gene:ENSPMAG00000007646.1 transcript:ENSPMAT00000008444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 1.026e-6
Identity = 29/71 (40.85%), Postives = 39/71 (54.93%), Query Frame = 1
Query:   91 YYVDDEETPYLIKFHSPPEQITLGDFKNALNRP-NYKFFFKSLDDDF--GVVKEEITDDDAKLPYVNGRVV 294
            YY   E  PY  +     + +TL  FK  L +  NY+F+FK   ++F  GVV EE+ DD A LP   G+VV
Sbjct:   14 YYFCGEPIPYRSRVRG--DSLTLAHFKELLTKKGNYRFYFKKASEEFECGVVFEEVRDDKALLPLYQGKVV 82          
BLAST of Dishevelled vs. Ensembl Nematostella
Match: EDO39599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L8])

HSP 1 Score: 324.324 bits (830), Expect = 4.539e-98
Identity = 172/317 (54.26%), Postives = 216/317 (68.14%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL---ESEIDSVSVVAGQQQS 1914
            LNIIT+TLNMD V FLGISIVGQ+N   + GDGGIYVGS+MKGGAV LDGR+EPGDM+L+VN ++FEN+SN++AVR LRE V K GP+TL VAK WDP P GY  LP  DPVRPID  AWV HT AM   A              Q G+++P A           + S+   +SS +    P++       E     LT N + S +++AMA  DSGL IRDR+WLKITI NAFIGSD+VDWLY+HV+GF DR++ARK+A NLLK G+IRHTVNK +FSEQCYYV  D+ G L+ ++L   E + D++  +  QQQ+
Sbjct:  245 LNIITITLNMDKVNFLGISIVGQSN---KKGDGGIYVGSVMKGGAVDLDGRVEPGDMLLQVNDVNFENMSNDDAVRVLREMVHKPGPITLTVAKCWDPTPKGYFTLPHSDPVRPIDTSAWVQHTTAMNQFA-------------AQQGQFVPPA-----KPGNSQSLSTMTSTSSSMTSSLPESDRYTEIPEG--EALTINTDMSTVVKAMAAPDSGLDIRDRMWLKITIPNAFIGSDVVDWLYTHVEGFMDRREARKYACNLLKAGYIRHTVNKITFSEQCYYVFGDLCGNLAALSLNENEGDQDTLGPLPPQQQA 538          

HSP 2 Score: 136.732 bits (343), Expect = 2.924e-33
Identity = 59/87 (67.82%), Postives = 74/87 (85.06%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQS 330
            M+ET++IY++DDE+TPYL+K    P+ +TLGDFKN LNRPNYKFFFKS+DDDFGVVKEEI+DD+  LP  NGRVV+WLV S+ S+ S
Sbjct:    1 MDETKVIYHIDDEDTPYLVKLGKTPDIVTLGDFKNVLNRPNYKFFFKSMDDDFGVVKEEISDDETHLPCFNGRVVAWLVTSDTSSVS 87          
BLAST of Dishevelled vs. Ensembl Nematostella
Match: EDO39598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L7])

HSP 1 Score: 137.887 bits (346), Expect = 5.406e-33
Identity = 67/99 (67.68%), Postives = 80/99 (80.81%), Query Frame = 1
Query: 1006 DTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQ 1299
            D V FLGISIVGQ+N   + GDGGIYVGS+MKGGAV LDGR+EPGDM+L+VN ++FEN+SN++AVR LRE V K GP+TL VAK WDP P GY  LP +
Sbjct:  167 DKVNFLGISIVGQSN---KKGDGGIYVGSVMKGGAVDLDGRVEPGDMLLQVNDVNFENMSNDDAVRVLREMVHKPGPITLTVAKCWDPTPKGYFTLPHK 262          
BLAST of Dishevelled vs. Ensembl Nematostella
Match: EDO28754 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5K6])

HSP 1 Score: 56.225 bits (134), Expect = 6.923e-10
Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 1021 LGISIVGQTNGNQEN----GDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWD 1266
            LGISI G   G+  N     D GI++  + +G A   DGR+  G  ILEVNG+S    ++ EAVR LR    +   VTL+V   +D
Sbjct:    7 LGISIRGGAKGHPGNPLDKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRALRSMGDR---VTLLVCDGYD 89          
BLAST of Dishevelled vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 59.3066 bits (142), Expect = 8.267e-10
Identity = 33/79 (41.77%), Postives = 51/79 (64.56%), Query Frame = 1
Query: 1021 LGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAK 1257
            LG SI G +      GD GIY+  I++GGA   DGR++ GD I+ VN  + E+VS+E+AV+ L+   ++   VT+VV++
Sbjct:  111 LGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKER---VTIVVSR 186          

HSP 2 Score: 51.9878 bits (123), Expect = 2.307e-7
Identity = 33/86 (38.37%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1021 LGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPT 1278
            LG SI G T+    + D GIY+  ++ GGA A DGR++  D IL VNG +  ++ +++AV  L+    +   VTLV  K     PT
Sbjct:   16 LGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQ---VTLVREKKRGNAPT 98          
BLAST of Dishevelled vs. Ensembl Nematostella
Match: EDO45887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU6])

HSP 1 Score: 62.003 bits (149), Expect = 1.501e-9
Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  991 VTLNMDTVPFLGISIVGQT----NGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQ--KLGP--VTLVVAKSWDP 1269
            + LNM     LG+S+ G+     +G     D GI+V S++ GGA   DGR++  D +L VN +SF  ++N EA+  LR  +Q  +LG   +   VA+  DP
Sbjct:  429 IPLNMSGAAGLGVSVKGKVADTDSGRDSPIDMGIFVKSVIAGGAAFKDGRLKAEDQLLSVNNVSFMRLTNTEAIDGLRRAMQNTRLGQAFIETTVARERDP 529          
BLAST of Dishevelled vs. Ensembl Medaka
Match: dvl3a (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:101157324])

HSP 1 Score: 306.99 bits (785), Expect = 1.258e-90
Identity = 168/330 (50.91%), Postives = 214/330 (64.85%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNP-TGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPI 1962
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LR+ V K GP+TL VAK WDPNP + + LP+ +P+RPIDP AWV HT AM                   +G Y PY                S   S+V    +  +  I  T+      L+ + + + + +AMA  +SGL +RDR+WLKITI NAFIGSD+VDWL+ HV+GF+DR++ARK+A+NLLK GFIRHTVNK +FSEQCYYV  D+ G ++ ++L    D  S  A  Q +   L H  PG    P+
Sbjct:  243 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPITLTVAKCWDPNPRSCFALPRSEPIRPIDPAAWVSHTAAM-------------------TGVYPPYG--------------MSPSMSTVTSTSSSISSSIPETERFDDFHLSIHSDMATVAKAMACPESGLEVRDRMWLKITIANAFIGSDVVDWLFHHVEGFSDRREARKYASNLLKAGFIRHTVNKITFSEQCYYVFGDLCGNMAHLSLHDH-DGSSGGASDQDTLPPLPH--PGAAPWPM 533          

HSP 2 Score: 134.42 bits (337), Expect = 7.694e-32
Identity = 65/123 (52.85%), Postives = 82/123 (66.67%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFR 438
            M ET+IIY++DD+ETPYL+K   P +++TL DFKN + +PNYKFFFKS+DDDFGVVKEEI+DD+AKLP  NGRVVSWLV  +G                       D G+V+DS +P  P  R
Sbjct:    1 MGETKIIYHLDDQETPYLVKLSVPADRVTLADFKNVIKKPNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSGDGG--------------------HADTGSVADSLEPAPPLER 103          
BLAST of Dishevelled vs. Ensembl Medaka
Match: dvl2 (dishevelled segment polarity protein 2 [Source:NCBI gene;Acc:101163770])

HSP 1 Score: 295.049 bits (754), Expect = 7.397e-86
Identity = 156/296 (52.70%), Postives = 202/296 (68.24%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDM-MGALSV 1857
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+ L VAK WDP+P GY  LP+ +P+RPIDP AWV H+ A+                   SG Y P+ G+ S    T +++ +  +                R D+     L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+V+WL+ H++GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYYV  D+ M  LS+
Sbjct:  239 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPIILTVAKCWDPSPQGYFTLPRNEPIRPIDPAAWVSHSVAV-------------------SGGYPPFPGSSSLSTITSSSSVTETE----------------RFDDFN---LSLHSDMASVAKAMASPESGLEVRDRMWLKITIPNAFLGSDVVEWLFHHIEGFQDRREARKYASNLLKAGFIRHTVNKITFSEQCYYVFGDLNMANLSL 493          

HSP 2 Score: 122.094 bits (305), Expect = 7.597e-28
Identity = 55/78 (70.51%), Postives = 64/78 (82.05%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWL 303
            M ET+IIY++D+EETPYL+K     E ITL DFK  LN+PNYKFFFKS+D DFGVVKEEI+DD AKLP  NGRVVSW+
Sbjct:    1 MAETKIIYHIDEEETPYLVKIPIAAENITLLDFKQVLNKPNYKFFFKSMDQDFGVVKEEISDDSAKLPCFNGRVVSWV 78          
BLAST of Dishevelled vs. Ensembl Medaka
Match: dvl2 (dishevelled segment polarity protein 2 [Source:NCBI gene;Acc:101163770])

HSP 1 Score: 294.664 bits (753), Expect = 2.320e-85
Identity = 153/289 (52.94%), Postives = 198/289 (68.51%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDM 1839
            LNIITVTLNM+   FLGISIVGQ+N   E GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN I+FEN+SN++AVR LRE V K GP+ L VAK WDP+P GY  LP+ +P+RPIDP AWV H+ A+                   SG Y P+ G+ S    T +++ +  +                R D+     L+ + + + + +AMA  +SGL +RDR+WLKITI NAF+GSD+V+WL+ H++GF DR++ARK+A+NLLK GFIRHTVNK +FSEQCYYV  D+
Sbjct:  253 LNIITVTLNMEKYNFLGISIVGQSN---ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLREIVHKPGPIILTVAKCWDPSPQGYFTLPRNEPIRPIDPAAWVSHSVAV-------------------SGGYPPFPGSSSLSTITSSSSVTETE----------------RFDDFN---LSLHSDMASVAKAMASPESGLEVRDRMWLKITIPNAFLGSDVVEWLFHHIEGFQDRREARKYASNLLKAGFIRHTVNKITFSEQCYYVFGDL 500          

HSP 2 Score: 126.716 bits (317), Expect = 2.602e-29
Identity = 58/82 (70.73%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSE 315
            M ET+IIY++D+EETPYL+K     E ITL DFK  LN+PNYKFFFKS+D DFGVVKEEI+DD AKLP  NGRVVSWLV S+
Sbjct:    1 MAETKIIYHIDEEETPYLVKIPIAAENITLLDFKQVLNKPNYKFFFKSMDQDFGVVKEEISDDSAKLPCFNGRVVSWLVSSD 82          
BLAST of Dishevelled vs. Ensembl Medaka
Match: dvl1a (dishevelled segment polarity protein 1 [Source:NCBI gene;Acc:101165393])

HSP 1 Score: 181.03 bits (458), Expect = 2.775e-47
Identity = 86/132 (65.15%), Postives = 105/132 (79.55%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAP 1368
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+    P
Sbjct:  207 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRILREIVSKTGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWISHTTALTGPYP 335          

HSP 2 Score: 135.191 bits (339), Expect = 2.805e-32
Identity = 57/94 (60.64%), Postives = 75/94 (79.79%), Query Frame = 1
Query: 1585 SVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWLYS V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:  352 ATIVKVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMASLNL 445          

HSP 3 Score: 128.257 bits (321), Expect = 5.154e-30
Identity = 63/94 (67.02%), Postives = 76/94 (80.85%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALN-RP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHS 342
            M ET+IIY++D+EETPYL+K    PE++TL DFKN LN RP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S  SD  S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLSVSPEKVTLADFKNVLNNRPVNSYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAE-SAHSDGGS 93          
BLAST of Dishevelled vs. Ensembl Medaka
Match: dvl1a (dishevelled segment polarity protein 1 [Source:NCBI gene;Acc:101165393])

HSP 1 Score: 182.57 bits (462), Expect = 3.195e-47
Identity = 85/127 (66.93%), Postives = 104/127 (81.89%), Query Frame = 1
Query:  976 LNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAM 1353
            LNIITVTLNM+   FLGISIVGQ+N   + GDGGIY+GSIMKGGAVA DGRIEPGDM+L+VN ++FEN+SN++AVR LRE V K GP++L VAK WDP+P  Y  +P+ +PVRPIDP AW+ HT A+
Sbjct:  252 LNIITVTLNMEKYNFLGISIVGQSN---DRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRILREIVSKTGPISLTVAKCWDPSPRSYFTIPRAEPVRPIDPAAWISHTTAL 375          

HSP 2 Score: 135.961 bits (341), Expect = 2.724e-32
Identity = 57/94 (60.64%), Postives = 75/94 (79.79%), Query Frame = 1
Query: 1585 SVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNL 1866
            + I++ M   DSGL IRDR+WLKITI NA IG+D+VDWLYS V+GF DR+DARK+A++LLK G++RHTVNK +FSEQCYY   D+   ++ +NL
Sbjct:  397 ATIVKVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYSRVEGFKDRRDARKYASSLLKHGYLRHTVNKITFSEQCYYTFGDLCQNMASLNL 490          

HSP 3 Score: 129.028 bits (323), Expect = 5.160e-30
Identity = 63/94 (67.02%), Postives = 76/94 (80.85%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALN-RP--NYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHS 342
            M ET+IIY++D+EETPYL+K    PE++TL DFKN LN RP  +YKFFFKS+D DFGVVKEEI+DD+AKLP  NGRVVSWLV++E S  SD  S
Sbjct:    1 MAETKIIYHIDEEETPYLVKLSVSPEKVTLADFKNVLNNRPVNSYKFFFKSMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVLAE-SAHSDGGS 93          
BLAST of Dishevelled vs. Planmine SMEST
Match: SMESG000049876.1 (SMESG000049876.1)

HSP 1 Score: 1561.2 bits (4041), Expect = 0.000e+0
Identity = 920/935 (98.40%), Postives = 920/935 (98.40%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSRGPGSVNSGSVVTRNCVCLNSMTVLKAVKHMWESGANKSVMAATDLXXXXXXXXXXXXXXXXXXTVREVEPVSTASMRNQDINSIVSVNSTTCRLCGGEQEESDLYSNNDEDDNPHRHHSMKMDAPXXXXXXXXXXXXXNVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD 2874
            MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS               RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSRGPGSVNSGSVVTRNCVCLNSMTVLKAVKHMWESGANKSVMAATDLSGGSGGGSSGGGEGGGGSTVREVEPVSTASMRNQDINSIVSVNSTTCRLCGGEQEESDLYSNNDEDDNPHRHHSMKMDAPATTSGSSASGSSGNVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD
Sbjct:    1 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS---------------RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSRGPGSVNSGSVVTRNCVCLNSMTVLKAVKHMWESGANKSVMAATDLSGGSGGGSSGGGEGGGGSTVREVEPVSTASMRNQDINSIVSVNSTTCRLCGGEQEESDLYSNNDEDDNPHRHHSMKMDAPATTSGSSASGSSGNVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD 920          
BLAST of Dishevelled vs. Planmine SMEST
Match: SMESG000049876.1 (SMESG000049876.1)

HSP 1 Score: 1156.35 bits (2990), Expect = 0.000e+0
Identity = 688/703 (97.87%), Postives = 688/703 (97.87%), Query Frame = 1
Query:   70 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMXXXXXXXXXXXXXXXXXXXXXXQNPQNKFIGRTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSR 2178
            MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS               RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSR
Sbjct:    1 MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNHKFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNAQGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFFDSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDSTVSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGKYLPYAGAMSTVASTITTTSSSLKS---------------RTDETIPSPLTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQSNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLKSSR 688          

HSP 2 Score: 197.978 bits (502), Expect = 4.289e-52
Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
Query: 2593 NVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD 2874
            NVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD
Sbjct:  707 NVTRNIQMPVYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIMPGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD 800          
BLAST of Dishevelled vs. Planmine SMEST
Match: SMESG000010246.1 (SMESG000010246.1)

HSP 1 Score: 345.125 bits (884), Expect = 8.261e-104
Identity = 249/443 (56.21%), Postives = 310/443 (69.98%), Query Frame = 1
Query:   73 EETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLVDSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHXXXXXXXXXXNKIHRQNHKFTGPEKITLDETD---DAFDEIDSIYN--EDKVPPLRKFSDFKHSVKLKKLRNAQGSHGXXXXXXXXXXXXXXXXXXXXPAKQQPIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETTMSSKYGKXXXXXXXXXKMPHLXXXXXXXXXXXXXXXLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDPNPTGYM-LPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPP 1383
            +ETRIIY++D+EETPYLIK    P+++TLGD KNALNRP+YK+FFKS+DDDFGVVKEEITDD+AKLP   GRV+SWLV +EGST SDN  S+G    ++D ++S+                     +P + S               N K +G    T +E+D   D   + DS+Y+  +D+V PLR F D+K + ++    N   ++                     P  Q PIYE++SSMMSSDL++TSFFDSED+SSRFS+ T TTMSS+YG+Q++Q RRRR  P +SRASSFSS+TDST+SLNI+TV LNMDTV FLGISIVGQ+N   + GDGGIYVGSIMKGGAVA DGRIEPGDMILEVN ISFE++SN++AVRTLREQVQK GP+ LVVAK WDPNP GY  +P+Q+PVRPIDPRAWVLHT AM   A  ++PP
Sbjct:   13 DETRIIYHIDEEETPYLIKLSISPDKVTLGDLKNALNRPHYKYFFKSMDDDFGVVKEEITDDEAKLPCFKGRVISWLVTAEGSTVSDNVDSNG----ILDKNESR--------------------MLPFQESHFPLI---------NNIKASG--GTTTNESDTICDTCTDTDSVYSAAQDRVGPLRSFHDYKQAGRVAAHANRVNTN--------------------TPNGQNPIYETNSSMMSSDLESTSFFDSEDESSRFSTTTCTTMSSRYGRQKQQRRRRRP-PAISRASSFSSITDSTMSLNIVTVRLNMDTVKFLGISIVGQSN---KGGDGGIYVGSIMKGGAVAQDGRIEPGDMILEVNDISFEDMSNDDAVRTLREQVQKPGPINLVVAKCWDPNPKGYFTIPRQEPVRPIDPRAWVLHTNAM--TAGASEPP 394          

HSP 2 Score: 150.599 bits (379), Expect = 5.796e-37
Identity = 68/112 (60.71%), Postives = 90/112 (80.36%), Query Frame = 1
Query: 1564 LTTNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQGFTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLESEIDSVSVVA 1899
            LT N +   I+R ++Q DSGL IRDRLWLKIT+ NAFIGS+LVDWLY H++GF+DRK+ARK+A NLLK G+I+HTVNK +FSEQCYYVL +    +S ++L+ +++SVS V 
Sbjct:  501 LTKNTDVGTILRVLSQPDSGLDIRDRLWLKITLPNAFIGSNLVDWLYRHIEGFSDRKEARKYAANLLKFGYIKHTVNKVTFSEQCYYVLGNTTLNMSRLSLD-QVESVSEVG 611          
BLAST of Dishevelled vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.568e-8
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 1021 LGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLR 1212
            LGIS++G+       G  G+Y+  ++KGG   +DGR++PGD ILE+NG  F N + E A   L+
Sbjct:  679 LGISVIGR------EGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLK 736          
BLAST of Dishevelled vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 56.9954 bits (136), Expect = 7.764e-8
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 1021 LGISIVGQTNGNQENGDGGIYVGSIMKGGAVALDGRIEPGDMILEVNGISFENVSNEEAVRTLR 1212
            LGIS++G+       G  G+Y+  ++KGG   +DGR++PGD ILE+NG  F N + E A   L+
Sbjct:  478 LGISVIGR------EGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLK 535          
The following BLAST results are available for this feature:
BLAST of Dishevelled vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DVL21.071e-8448.35dishevelled segment polarity protein 2 [Source:HGN... [more]
DVL21.386e-8448.35dishevelled segment polarity protein 2 [Source:HGN... [more]
DVL38.499e-7947.58dishevelled segment polarity protein 3 [Source:HGN... [more]
DVL11.118e-4840.16dishevelled segment polarity protein 1 [Source:HGN... [more]
DVL12.697e-4664.39dishevelled segment polarity protein 1 [Source:HGN... [more]
back to top
BLAST of Dishevelled vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dsh-12.553e-6946.21DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:... [more]
dsh-17.693e-6946.21DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:... [more]
dsh-18.843e-6846.21DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:... [more]
dsh-12.499e-6746.21DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:... [more]
dsh-18.265e-6746.21DiSHevelled related [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Dishevelled vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dsh1.137e-7448.26gene:FBgn0000499 transcript:FBtr0073454[more]
baz8.973e-833.00gene:FBgn0000163 transcript:FBtr0343764[more]
baz9.889e-833.00gene:FBgn0000163 transcript:FBtr0111000[more]
baz1.060e-733.00gene:FBgn0000163 transcript:FBtr0074388[more]
baz1.083e-733.00gene:FBgn0000163 transcript:FBtr0343763[more]
back to top
BLAST of Dishevelled vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dvl3a1.966e-9151.56dishevelled segment polarity protein 3a [Source:ZF... [more]
dvl1b6.847e-8551.17dishevelled segment polarity protein 1b [Source:ZF... [more]
dvl1b8.102e-8551.17dishevelled segment polarity protein 1b [Source:ZF... [more]
dvl1a5.342e-8348.99dishevelled segment polarity protein 1a [Source:ZF... [more]
dvl1a6.676e-7948.59dishevelled segment polarity protein 1a [Source:ZF... [more]
back to top
BLAST of Dishevelled vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dvl31.482e-8752.68dishevelled segment polarity protein 3 [Source:NCB... [more]
dvl13.658e-8750.67dishevelled segment polarity protein 1 [Source:NCB... [more]
dvl18.498e-8650.67dishevelled segment polarity protein 1 [Source:NCB... [more]
dvl11.038e-8550.67dishevelled segment polarity protein 1 [Source:NCB... [more]
dvl33.821e-8151.76dishevelled segment polarity protein 3 [Source:NCB... [more]
back to top
BLAST of Dishevelled vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dvl27.205e-8548.35dishevelled segment polarity protein 2 [Source:MGI... [more]
Dvl27.205e-8548.35dishevelled segment polarity protein 2 [Source:MGI... [more]
Dvl27.205e-8548.35dishevelled segment polarity protein 2 [Source:MGI... [more]
Dvl35.566e-7947.58dishevelled segment polarity protein 3 [Source:MGI... [more]
Dvl35.665e-7947.58dishevelled segment polarity protein 3 [Source:MGI... [more]
back to top
BLAST of Dishevelled vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1WAP7|DVL3_XENTR7.852e-8752.68Segment polarity protein dishevelled homolog DVL-3... [more]
sp|Q6DKE2|DVL3_XENLA2.008e-8652.35Segment polarity protein dishevelled homolog DVL-3... [more]
sp|P51142|DVL2_XENLA1.490e-8552.53Segment polarity protein dishevelled homolog DVL-2... [more]
sp|Q05AS8|DVL2_XENTR1.270e-8452.36Segment polarity protein dishevelled homolog DVL-2... [more]
sp|Q60838|DVL2_MOUSE5.040e-8448.35Segment polarity protein dishevelled homolog DVL-2... [more]
back to top
BLAST of Dishevelled vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q589S61.709e-4288.81Dishevelled OS=Dugesia japonica OX=6161 GN=DjdshA ... [more]
F2WMR47.024e-2897.08Dvl-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
B1NWV80.000e+097.38Dishevelled-like protein (Fragment) OS=Schmidtea m... [more]
R7UM857.687e-14052.61Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3II194.828e-10159.65segment polarity protein dishevelled homolog DVL-3... [more]
back to top
BLAST of Dishevelled vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dvl3a5.764e-9051.25segment polarity protein dishevelled homolog DVL-3... [more]
dvl21.177e-8750.00dishevelled segment polarity protein 2 [Source:NCB... [more]
dvl3a1.099e-8348.58segment polarity protein dishevelled homolog DVL-3... [more]
dvl1b9.028e-8348.68segment polarity protein dishevelled homolog DVL-1... [more]
dvl25.839e-8149.69dishevelled segment polarity protein 2 [Source:NCB... [more]
back to top
BLAST of Dishevelled vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001371.11.731e-3962.11pep scaffold:Pmarinus_7.0:GL492828:1505:4356:1 gen... [more]
ENSPMAT00000009066.12.286e-843.84pep scaffold:Pmarinus_7.0:GL479913:2065:18580:1 ge... [more]
ENSPMAT00000004677.11.622e-736.71pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
ENSPMAT00000007682.14.890e-739.47pep scaffold:Pmarinus_7.0:GL479837:661:11661:1 gen... [more]
ENSPMAT00000008444.11.026e-640.85pep scaffold:Pmarinus_7.0:GL479496:14395:17295:-1 ... [more]
back to top
BLAST of Dishevelled vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dishevelled vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395994.539e-9854.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395985.406e-3367.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287546.923e-1040.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460598.267e-1041.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458871.501e-936.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dishevelled vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dvl3a1.258e-9050.91dishevelled segment polarity protein 3 [Source:NCB... [more]
dvl27.397e-8652.70dishevelled segment polarity protein 2 [Source:NCB... [more]
dvl22.320e-8552.94dishevelled segment polarity protein 2 [Source:NCB... [more]
dvl1a2.775e-4765.15dishevelled segment polarity protein 1 [Source:NCB... [more]
dvl1a3.195e-4766.93dishevelled segment polarity protein 1 [Source:NCB... [more]
back to top
BLAST of Dishevelled vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049876.10.000e+098.40SMESG000049876.1[more]
SMESG000049876.14.289e-5297.87SMESG000049876.1[more]
SMESG000010246.18.261e-10456.21SMESG000010246.1[more]
SMESG000056186.14.568e-842.19SMESG000056186.1[more]
SMESG000056186.17.764e-842.19SMESG000056186.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032757 ID=SMED30032757|Name=Dishevelled|organism=Schmidtea mediterranea sexual|type=transcript|length=3384bp
ATGAATCAATAATTTTTTATCAATTCTATTAAATAATTATTTTTACTTGG
GTTTTTTTGGACCCGTTATATGGAAGAAACGAGGATTATTTATTATGTTG
ACGATGAAGAGACGCCTTATTTAATTAAATTTCATTCCCCACCCGAACAG
ATCACTTTGGGAGACTTCAAAAATGCTCTTAATCGTCCAAATTACAAATT
CTTTTTCAAGTCACTGGATGATGATTTTGGTGTTGTGAAAGAAGAGATCA
CAGACGATGACGCAAAATTACCGTATGTCAATGGAAGGGTCGTATCTTGG
TTAGTAGTTTCCGAAGGTAGCACTCAGTCAGACAATCATTCTTCTTCTGG
CAAAGAAGTTTTGCTTGTAGATTCAGATAAGAGTAAAGATAAAGGCACAG
TGAGCGATTCAAGTGATCCAAAATCGCCGAGTTTTAGAAATTACAATAAA
ATACCGACAAAACATTCTAGCAGCTCAAAAAAGCAAGAAGAAAGCAACAA
AATTCACAGACAAAATCACAAATTTACCGGACCAGAAAAAATCACTCTGG
ATGAGACAGATGATGCATTTGATGAAATAGATTCGATTTATAACGAAGAT
AAAGTACCCCCGTTAAGAAAGTTCAGCGATTTCAAACACAGCGTGAAATT
GAAAAAGCTGCGAAATGCACAAGGGTCGCATGGGAATAGTAATAGTAGTA
GTAATAATAATAATAGCAACAGTAATAATGCATCTAATAATGCACCTGCC
AAACAGCAGCCAATTTATGAATCTTCCTCATCGATGATGAGCAGTGATCT
CGATACTACCAGTTTCTTTGATTCAGAGGACGATTCCAGCAGATTCTCCA
GTGCTACCGAAACCACAATGTCATCAAAATACGGAAAGCAAAGGAGGCAA
TTACGCCGTAGAAGAAAAATGCCACATTTGAGTCGAGCTTCATCCTTTAG
TAGTATGACAGACTCGACGGTATCTCTCAATATAATAACGGTTACTCTAA
ATATGGATACGGTACCATTTCTAGGGATATCGATCGTCGGTCAGACTAAT
GGAAATCAGGAGAATGGAGACGGAGGAATTTATGTTGGATCGATAATGAA
AGGTGGAGCTGTTGCTCTCGATGGTAGAATTGAACCCGGTGATATGATTC
TTGAAGTGAATGGAATAAGTTTTGAAAATGTTAGTAATGAAGAAGCAGTT
AGAACACTAAGGGAACAAGTCCAAAAATTAGGTCCTGTTACACTGGTCGT
TGCCAAGAGTTGGGATCCAAATCCTACAGGATACATGCTTCCTCAACAAG
ATCCTGTGCGTCCTATTGATCCTAGAGCATGGGTGCTGCACACACAAGCT
ATGGGCAACATGGCCCCTCCAAATCAGCCCCCAGTCGCCAGTGGCGATCA
ATTCATTCAGAGTGGAAAGTATCTACCGTATGCAGGAGCTATGTCAACAG
TTGCCAGTACAATAACTACCACAAGCTCTAGCTTAAAAAGTAGCTCTGTA
GTGGAGGTACAGAATCCTCAAAATAAATTTATAGGTCGAACTGATGAAAC
TATTCCATCTCCTTTAACAACTAATCACGAACCATCAGTTATAATCCGAG
CTATGGCACAGGCAGATTCTGGTTTACCCATTCGAGATCGGTTGTGGTTA
AAAATAACAATATATAATGCGTTTATTGGTTCCGATCTTGTTGATTGGTT
ATATTCGCACGTTCAAGGCTTCACAGACAGGAAGGATGCAAGGAAATTTG
CTACAAATCTTTTAAAGATGGGTTTTATCAGACACACAGTCAATAAGTCG
AGTTTTTCCGAGCAGTGTTATTATGTTCTCAATGACATGATGGGAGCTCT
ATCCGTCATGAATCTCGAGTCAGAGATTGACTCGGTTTCGGTTGTTGCCG
GCCAACAGCAATCCAAAACGAGACTGGTGCATCAAGATCCTGGCTGTAAG
GAGTCGCCAATTCTCTCATCGGGATTCCAGTCTGCTTGCAGTAACAAATG
GTCAAGTTACAATATCCAGTCGAATCCTGGTCCAGAAATGTATTCACAAG
CACAAATCATGACGATGAACAACAACAACGCTTTCAAATACCAGAACTTC
TACACTGACAATATGCAGCCGCAATCTCAATCCTTAGTTAAACCCCTCGG
TCTTTCCAGTAATCTCAAATCCAGTCGGGGTCCGGGTTCAGTCAATAGTG
GTTCAGTCGTCACTAGAAACTGTGTCTGCCTGAATTCAATGACTGTACTC
AAAGCTGTAAAGCATATGTGGGAAAGTGGCGCGAACAAATCTGTTATGGC
AGCAACAGATCTCAGCGGTGGTAGTGGTGGGGGTAGTAGTGGAGGAGGAG
AAGGAGGAGGAGGAAGTACCGTACGAGAGGTAGAGCCTGTTTCAACTGCT
TCAATGCGCAATCAAGATATCAATTCGATTGTCAGTGTGAACTCGACCAC
ATGTCGATTATGTGGTGGCGAACAGGAAGAAAGCGATCTCTATTCAAACA
ACGACGAAGACGATAACCCACATCGGCACCACTCTATGAAAATGGATGCT
CCTGCTACAACATCAGGCAGTTCTGCTAGTGGTAGCAGTGGAAATGTAAC
TCGGAATATTCAAATGCCAGTTTATCACATGCAGAACCCAGCTCCGGTTA
TTGGCAGTGGCATTGTTTTACCGGACGCATCACAATACCCCTTGCACAAC
AGCCCACCCCCTTCATATCAGCAATCGATGGCTATCGGTACAATTCTAGG
CAAAAACCAGTCAATCATGCCAGGTGACAACAGTTCCAACCAATTTTCAC
TTGCTATTTCTAATGGCATTCTCAACGAAAACAGCTCGTCTGGTTTCTTT
TCAGATGGAGTAGACAAATGTGATTGAAGTCAAGAGCGAAGCCCCGTTAT
TCGATTCTAGTCAATTGCATTACACTATACCATCAAGATCTACTCCAAAT
TAATCATTGATACCTTTCGTCAACTCTTCTGATAAAATTGCTGCCTTATT
GAAATCGTTGCGATAGATCATCATCCCGAGGTGACCGTTGCTGTCACCGC
CGCTGTCACCGCGCCGCCATCACTCACTCGCTCCAAACAGCAGTTTCACC
TATTGTCATCAAATTATAAATTTAGTTGAAAATTTTAAAATAAATTTCTG
CCTTCCGTGAAAAATGATCGAAAAATGTCTGCAACTCGTGTTAGCTTGCT
ATTCATTTCAATGACATGAAGTTTGATCTAGATTTCTCACAGCAGCCCAT
TGGTCGTCCGTTTGGTGCTGCTGCTTGTGTAGATTTGTGTTTTTATTTTT
ATTTCGCAATAATCATCTCTATTCAATCATCCATCAATCGATCAAATTAT
ATATAATCAATGTATTATTTCATCGATTTTTAAT
back to top

protein sequence of SMED30032757-orf-1

>SMED30032757-orf-1 ID=SMED30032757-orf-1|Name=SMED30032757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=936bp
MEETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNRPNYKFFFKSLD
DDFGVVKEEITDDDAKLPYVNGRVVSWLVVSEGSTQSDNHSSSGKEVLLV
DSDKSKDKGTVSDSSDPKSPSFRNYNKIPTKHSSSSKKQEESNKIHRQNH
KFTGPEKITLDETDDAFDEIDSIYNEDKVPPLRKFSDFKHSVKLKKLRNA
QGSHGNSNSSSNNNNSNSNNASNNAPAKQQPIYESSSSMMSSDLDTTSFF
DSEDDSSRFSSATETTMSSKYGKQRRQLRRRRKMPHLSRASSFSSMTDST
VSLNIITVTLNMDTVPFLGISIVGQTNGNQENGDGGIYVGSIMKGGAVAL
DGRIEPGDMILEVNGISFENVSNEEAVRTLREQVQKLGPVTLVVAKSWDP
NPTGYMLPQQDPVRPIDPRAWVLHTQAMGNMAPPNQPPVASGDQFIQSGK
YLPYAGAMSTVASTITTTSSSLKSSSVVEVQNPQNKFIGRTDETIPSPLT
TNHEPSVIIRAMAQADSGLPIRDRLWLKITIYNAFIGSDLVDWLYSHVQG
FTDRKDARKFATNLLKMGFIRHTVNKSSFSEQCYYVLNDMMGALSVMNLE
SEIDSVSVVAGQQQSKTRLVHQDPGCKESPILSSGFQSACSNKWSSYNIQ
SNPGPEMYSQAQIMTMNNNNAFKYQNFYTDNMQPQSQSLVKPLGLSSNLK
SSRGPGSVNSGSVVTRNCVCLNSMTVLKAVKHMWESGANKSVMAATDLSG
GSGGGSSGGGEGGGGSTVREVEPVSTASMRNQDINSIVSVNSTTCRLCGG
EQEESDLYSNNDEDDNPHRHHSMKMDAPATTSGSSASGSSGNVTRNIQMP
VYHMQNPAPVIGSGIVLPDASQYPLHNSPPPSYQQSMAIGTILGKNQSIM
PGDNSSNQFSLAISNGILNENSSSGFFSDGVDKCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000062esophagus
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038207DIX_dom_sf
IPR036388WH-like_DNA-bd_sf
IPR036034PDZ_sf
IPR015506Dsh/Dvl-rel
IPR026542Dsh
IPR036390WH_DNA-bd_sf
IPR007109Brix
IPR000591DEP_dom
IPR001158DIX
IPR001478PDZ
IPR011991WHTH_DNA-bd_dom
IPR003351Dishevelled_protein_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001158DIX domainSMARTSM00021dax_2coord: 1..82
e-value: 2.1E-45
score: 166.8
IPR001158DIX domainPFAMPF00778DIXcoord: 3..78
e-value: 2.9E-31
score: 107.1
IPR001158DIX domainPROSITEPS50841DIXcoord: 1..82
score: 28.355
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 316..398
e-value: 6.0E-17
score: 72.3
IPR001478PDZ domainPFAMPF00595PDZcoord: 308..394
e-value: 5.6E-17
score: 61.9
IPR001478PDZ domainPROSITEPS50106PDZcoord: 307..382
score: 19.461
IPR000591DEP domainSMARTSM00049DEP_3coord: 515..589
e-value: 4.4E-21
score: 86.0
IPR000591DEP domainPFAMPF00610DEPcoord: 518..585
e-value: 1.3E-16
score: 60.4
IPR000591DEP domainPROSITEPS50186DEPcoord: 515..589
score: 25.856
IPR038207DIX domain superfamilyGENE3DG3DSA:3.10.20.380coord: 1..80
e-value: 4.8E-37
score: 127.7
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 488..589
e-value: 6.7E-30
score: 104.9
IPR003351Dishevelled protein domainPFAMPF02377Dishevelledcoord: 114..303
e-value: 9.6E-25
score: 87.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 300..402
e-value: 2.0E-28
score: 100.4
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 284..399
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..113
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 198..293
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 273..287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..160
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..160
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 114..132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 804..841
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 827..841
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 811..825
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 200..272
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 305..395
e-value: 5.93215E-20
score: 82.9998
NoneNo IPR availableCDDcd04438DEP_dishevelledcoord: 508..589
e-value: 4.71002E-49
score: 165.979
IPR015506Dishevelled-related proteinPANTHERPTHR10878SEGMENT POLARITY PROTEIN DISHEVELLEDcoord: 1..701
IPR026542Dishevelled DshPANTHERPTHR10878:SF25SEGMENT POLARITY PROTEIN DISHEVELLEDcoord: 1..701
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 499..632
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 2..79