Splicing factor 3a subunit 2

Overview
NameSplicing factor 3a subunit 2
Smed IDSMED30032755
Length (bp)964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 3a subunit 2 (SMED30032755) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 3a subunit 2 (SMED30032755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 3a subunit 2 (SMED30032755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 3a subunit 2 (SMED30032755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032755SMESG000081421.1 SmedASXL_019194SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032755SMESG000081421.1 SmedASXL_019194SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032755SMESG000081421.1 dd_Smed_v4_1788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Human
Match: SF3A2 (splicing factor 3a subunit 2 [Source:HGNC Symbol;Acc:HGNC:10766])

HSP 1 Score: 324.324 bits (830), Expect = 3.587e-108
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Human
Match: SF3A2 (splicing factor 3a subunit 2 [Source:HGNC Symbol;Acc:HGNC:10766])

HSP 1 Score: 188.734 bits (478), Expect = 1.563e-59
Identity = 101/135 (74.81%), Postives = 119/135 (88.15%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQ 462
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQ
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQ 135          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Celegans
Match: repo-1 (REversed POlarity in early embryos [Source:UniProtKB/TrEMBL;Acc:Q19335])

HSP 1 Score: 327.791 bits (839), Expect = 2.143e-113
Identity = 150/217 (69.12%), Postives = 179/217 (82.49%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+Q+R GGKTGSGGVAS +DA  DR++RL Q+A++ ID+ KDPYFMRNH+GTYECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++  E P  P   KA VE KKFVKIGRPGYKVTK+RDP   QQ++LFQIDYPEI++  G  PRHRFMSAYEQ I+PPD+ WQYLL AAEPYETI FK+PSRE+DK  K FWT WN+ +KQF+LQ A+KL+
Sbjct:    1 MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCLTLHNNEGSYLAHTQGKKHQANLARRAAKEQSEQPFLPAPQKAAVETKKFVKIGRPGYKVTKERDPGAGQQALLFQIDYPEIAD--GIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPYETIGFKIPSREVDKSEK-FWTMWNKDTKQFFLQVAFKLE 214          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Fly
Match: Sf3a2 (gene:FBgn0036314 transcript:FBtr0075944)

HSP 1 Score: 333.183 bits (853), Expect = 7.575e-115
Identity = 153/218 (70.18%), Postives = 185/218 (84.86%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLL-DKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+Q+R GGKTGSGGVAS+S+ NRDRK+RL Q+A++ ID++KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ NL +RAA++AKE P   L  +K +VE KKFVKIGRPGY+VTKQR+    QQS+LFQ+DYPEI+ES   +PRHRFMSAYEQ IEPPDR WQYLL AAEPYETI FKVPSRE++K   +FWT+WNR +KQF+LQFA+K +
Sbjct:    1 MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRVTKQRELSNGQQSLLFQVDYPEITESI--VPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYETIGFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFE 216          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Zebrafish
Match: sf3a2 (splicing factor 3a, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-040426-897])

HSP 1 Score: 324.709 bits (831), Expect = 3.913e-111
Identity = 166/221 (75.11%), Postives = 190/221 (85.97%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAV 720
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQSNL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRDPE  QQS+LFQIDYPEI+E  G  PRHRFMSAYEQ IEPPDR WQYLL AAEPYETIAFKVPSREIDK   RFWT+WNR +KQF+LQF +K++   V
Sbjct:    1 MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQSNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDPEIGQQSLLFQIDYPEIAEGIG--PRHRFMSAYEQRIEPPDRRWQYLLFAAEPYETIAFKVPSREIDKAETRFWTHWNRETKQFFLQFHFKMEKALV 219          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Zebrafish
Match: sf3a2 (splicing factor 3a, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-040426-897])

HSP 1 Score: 324.709 bits (831), Expect = 3.913e-111
Identity = 166/221 (75.11%), Postives = 190/221 (85.97%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAV 720
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQSNL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRDPE  QQS+LFQIDYPEI+E  G  PRHRFMSAYEQ IEPPDR WQYLL AAEPYETIAFKVPSREIDK   RFWT+WNR +KQF+LQF +K++   V
Sbjct:    1 MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQSNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDPEIGQQSLLFQIDYPEIAEGIG--PRHRFMSAYEQRIEPPDRRWQYLLFAAEPYETIAFKVPSREIDKAETRFWTHWNRETKQFFLQFHFKMEKALV 219          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Xenopus
Match: ttl (tubulin tyrosine ligase [Source:Xenbase;Acc:XB-GENE-493215])

HSP 1 Score: 320.087 bits (819), Expect = 2.865e-107
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRDPE  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDPEMAQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKVEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Mouse
Match: Sf3a2 (splicing factor 3a, subunit 2 [Source:MGI Symbol;Acc:MGI:104912])

HSP 1 Score: 324.324 bits (830), Expect = 4.477e-108
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Mouse
Match: Sf3a2 (splicing factor 3a, subunit 2 [Source:MGI Symbol;Acc:MGI:104912])

HSP 1 Score: 272.707 bits (696), Expect = 8.460e-92
Identity = 143/194 (73.71%), Postives = 166/194 (85.57%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDP 639
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFK  +  +   P
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKPLTFSLGAKP 192          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Mouse
Match: Sf3a2 (splicing factor 3a, subunit 2 [Source:MGI Symbol;Acc:MGI:104912])

HSP 1 Score: 119.013 bits (297), Expect = 1.382e-33
Identity = 51/65 (78.46%), Postives = 62/65 (95.38%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNN 252
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNN 65          
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Match: sp|Q15428|SF3A2_HUMAN (Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2)

HSP 1 Score: 324.324 bits (830), Expect = 1.722e-107
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Match: sp|Q6AXT8|SF3A2_RAT (Splicing factor 3A subunit 2 OS=Rattus norvegicus OX=10116 GN=Sf3a2 PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 2.397e-107
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAE--GVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Match: sp|A5PJN8|SF3A2_BOVIN (Splicing factor 3A subunit 2 OS=Bos taurus OX=9913 GN=SF3A2 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 6.065e-107
Identity = 163/217 (75.12%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +FWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Match: sp|Q62203|SF3A2_MOUSE (Splicing factor 3A subunit 2 OS=Mus musculus OX=10090 GN=Sf3a2 PE=1 SV=2)

HSP 1 Score: 298.901 bits (764), Expect = 2.276e-97
Identity = 155/217 (71.43%), Postives = 182/217 (83.87%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHRPGGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  ++ KVE KKFVKIGRPGYKVTKQRD E  QQS+LFQIDYPEI+E  G +PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   +F          F+LQF +K++
Sbjct:    1 MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEQVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAE--GIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKF----------FFLQFHFKME 205          
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Match: sp|Q54B65|SF3A2_DICDI (Splicing factor 3A subunit 2 OS=Dictyostelium discoideum OX=44689 GN=sf3a2 PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.418e-77
Identity = 113/213 (53.05%), Postives = 157/213 (73.71%), Query Frame = 1
Query:   82 GKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPI---QPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDP---KRFWTYWNRHSKQFYLQFAYK 702
            GK GSGG+ S    N DR++R  Q+ ++ +D+ KDPY + NH+G++EC+LCLT+HNN  +Y+ HTQGKKHQ++L +RAA++ +ENP       +   +V HKK +KIGRPGYK+ KQRD +T Q S+LFQIDYPEI   +G  PRHR MSA+EQ +E P++ +QYLL AAEPYETIAFK+P++EID+      +F+T+W+R +K F LQ  +K
Sbjct:    5 GKAGSGGLQSSQYDNIDRRERQKQLVLEHVDVSKDPYIISNHIGSFECRLCLTVHNNVGNYLAHTQGKKHQTHLARRAAKEQRENPSVSKNNYIQTTRVIHKKTIKIGRPGYKIIKQRDSKTGQLSLLFQIDYPEI--ESGLQPRHRIMSAFEQRVEQPNKDYQYLLFAAEPYETIAFKIPNKEIDRTTGPDGKFFTHWDR-NKTFTLQLYFK 214          
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Match: A0A0R3WC80 (Matrin-type domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8298 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.544e-130
Identity = 176/236 (74.58%), Postives = 205/236 (86.86%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNK 765
            MD+QHR GGKTGSGGVAS S+ANRDR++RL Q+A+D ID++KDPYFM+NHLGTYECKLCLTLHNN  SY+ HTQGKKHQ NLQ+RA EQAKE P     +KAKVE KKF+KIGRPGYKVTKQ+DPET QQSMLFQIDYPEI+++ G IPRHRFMSAYEQH+EPPDR WQYLL AAEPYETIAFKV SRE+DKDPK+FWTYWN  SKQF+LQFAYKL+N +  +  ++RE+E Q+ +
Sbjct:    1 MDFQHRVGGKTGSGGVASESEANRDRRERLRQLALDTIDLEKDPYFMKNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQYNLQRRAHEQAKEGPATLQPEKAKVEPKKFIKIGRPGYKVTKQKDPETGQQSMLFQIDYPEIADAAGVIPRHRFMSAYEQHVEPPDRKWQYLLFAAEPYETIAFKVRSREVDKDPKKFWTYWNPASKQFFLQFAYKLENQSTSSA-MIRELEMQKAR 235          
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Match: U6JIC2 (Splicing factor 3A subunit 2 OS=Echinococcus granulosus OX=6210 GN=EGR_08769 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.561e-130
Identity = 176/236 (74.58%), Postives = 205/236 (86.86%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNK 765
            MD+QHR GGKTGSGGVAS S+ANRDR++RL Q+A+D ID++KDPYFM+NHLGTYECKLCLTLHNN  SY+ HTQGKKHQ NLQ+RA EQAKE P     +KAKVE KKF+KIGRPGYKVTKQ+DPET QQSMLFQIDYPEI+++ G IPRHRFMSAYEQH+EPPDR WQYLL AAEPYETIAFKV SRE+DKDPK+FWTYWN  SKQF+LQFAYKL+N +  +  ++RE+E Q+ +
Sbjct:    1 MDFQHRVGGKTGSGGVASESEANRDRRERLRQLALDTIDLEKDPYFMKNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQYNLQRRAHEQAKEGPATLQPEKAKVEPKKFIKIGRPGYKVTKQKDPETGQQSMLFQIDYPEIADAAGVIPRHRFMSAYEQHVEPPDRKWQYLLFAAEPYETIAFKVRSREVDKDPKKFWTYWNPASKQFFLQFAYKLENQSTSSA-MIRELEMQKAR 235          
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Match: A0A068Y433 (Splicing factor 3a subunit 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000414400 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.573e-130
Identity = 176/236 (74.58%), Postives = 205/236 (86.86%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNK 765
            MD+QHR GGKTGSGGVAS S+ANRDR++RL Q+A+D ID++KDPYFM+NHLGTYECKLCLTLHNN  SY+ HTQGKKHQ NLQ+RA EQAKE P     +KAKVE KKF+KIGRPGYKVTKQ+DPET QQSMLFQIDYPEI+++ G IPRHRFMSAYEQH+EPPDR WQYLL AAEPYETIAFKV SRE+DKDPK+FWTYWN  SKQF+LQFAYKL+N +  +  ++RE+E Q+ +
Sbjct:    1 MDFQHRVGGKTGSGGVASESEANRDRRERLRQLALDTIDLEKDPYFMKNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQYNLQRRAHEQAKEGPATLQPEKAKVEPKKFIKIGRPGYKVTKQKDPETGQQSMLFQIDYPEIADAAGVIPRHRFMSAYEQHVEPPDRKWQYLLFAAEPYETIAFKVRSREVDKDPKKFWTYWNPASKQFFLQFAYKLENQSTSSA-MIRELEMQKAR 235          
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Match: A0A0R3TL37 (Matrin-type domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7924 PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 2.243e-130
Identity = 176/234 (75.21%), Postives = 205/234 (87.61%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQR 759
            MD+QHR GGKTGSGGVAS S+ANRDR++RL Q+A+D ID++KDPYFM+NHLGTYECKLCLTLHNN  SY+ HTQGKKHQ NLQ+RA EQAKE+P     +KA+VE KKF+KIGRPGYKVTKQ+DPET QQSMLFQIDYPEI+++ G +PRHRFMSAYEQHIEPPDR WQYLL AAEPYETIAFKV SRE+DKDPK+FWTYWN  SKQF+LQFAYKL+N   ++  +LRE+E Q+
Sbjct:    1 MDFQHRVGGKTGSGGVASESEANRDRRERLRQLALDTIDLEKDPYFMKNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQYNLQRRAHEQAKESPATLQPEKARVEPKKFIKIGRPGYKVTKQKDPETGQQSMLFQIDYPEIADAAGVVPRHRFMSAYEQHIEPPDRKWQYLLFAAEPYETIAFKVRSREVDKDPKKFWTYWNPASKQFFLQFAYKLENQ--QSSVVLRELELQK 232          
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Match: A0A0R3SFK5 (Matrin-type domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3628 PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 2.386e-130
Identity = 177/234 (75.64%), Postives = 205/234 (87.61%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQR 759
            MD+QHR GGKTGSGGVAS S+ANRDR++RL Q+A+D ID++KDPYFMRNHLGTYECKLCLTLHNN  SY+ HTQGKKHQ NLQ+RA EQAKE+P     +KAKVE KKF+KIGRPGYKVTKQ+DPET QQSMLFQIDYPEI+++ G +PRHRFMSAYEQH+EPPDR WQYLL AAEPYETIAFKV SRE+DKDPK+FWTYWN  SKQF+LQFAYKL+N   ++  +LRE+E Q+
Sbjct:    1 MDFQHRVGGKTGSGGVASESEANRDRRERLRQLALDTIDLEKDPYFMRNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQYNLQRRAHEQAKESPATLQPEKAKVEPKKFIKIGRPGYKVTKQKDPETGQQSMLFQIDYPEIADAAGVVPRHRFMSAYEQHVEPPDRKWQYLLFAAEPYETIAFKVRSREVDKDPKKFWTYWNPASKQFFLQFAYKLENQ--QSSVVLRELELQK 232          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Cavefish
Match: sf3a2 (splicing factor 3a subunit 2 [Source:NCBI gene;Acc:111194520])

HSP 1 Score: 324.709 bits (831), Expect = 6.565e-111
Identity = 165/217 (76.04%), Postives = 191/217 (88.02%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE P QP  +K KVE KKFVKIGRPGYKVTKQRDPET QQS+LFQIDYPEI+E  G  PRHRFMSAYEQ IEPPDR WQYLL+AAEPYETIAFKVPSREIDK   RFWT+WNR +KQF+LQF +K++
Sbjct:    1 MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDPETGQQSLLFQIDYPEIAEGIG--PRHRFMSAYEQRIEPPDRRWQYLLLAAEPYETIAFKVPSREIDKSETRFWTHWNRETKQFFLQFHFKME 215          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Yeast
Match: PRP11 (Subunit of the SF3a splicing factor complex; required for spliceosome assembly [Source:SGD;Acc:S000002201])

HSP 1 Score: 67.0106 bits (162), Expect = 2.649e-13
Identity = 57/208 (27.40%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  175 IDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKEN---PIQPLLD----KAKVEHKKFVKIGR--PGYKVTKQRDPETNQQSMLFQIDY-PEISEST-------GAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREI---------------DKDPKRFWTYWNRHSKQFYLQFAYK 702
            +  +PY  +NH G   CKLC T+H +  S   H  GKKH  N+ +R     K +     Q   D    +  +E K+ +K     P  K+   ++P+     +  Q++Y  E+ E++          P  R +S  E   +   +  ++L+IA EP+E IA ++P  EI               D+  K+  T+W+  SK +Y+QF +K
Sbjct:   52 VRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHDFRQQQKIIEAKQSLKNNGTIPVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLIRIVSGLELS-DTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKK-CTFWDAISKLYYVQFFFK 257          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Nematostella
Match: EDO40904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S618])

HSP 1 Score: 342.428 bits (877), Expect = 5.886e-119
Identity = 153/217 (70.51%), Postives = 187/217 (86.18%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLD 708
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ ID++KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQSNL +RAA++AK+ P QP  +K +V  KKFVKIGRPGYKVTKQR+P+  Q S+LFQ+DYPEI+E  G +PRHRFMSAYEQ IEPP++ WQYLL AAEPYETIAFK+PSREIDK+  +FWT WNR +KQFY+QF ++L 
Sbjct:    1 MDFQHRAGGKTGSGGVASSSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQSNLARRAAKEAKDAPAQPAPEKPRVSLKKFVKIGRPGYKVTKQRNPDNGQHSLLFQVDYPEIAE--GVVPRHRFMSAYEQRIEPPNKQWQYLLFAAEPYETIAFKIPSREIDKEEGKFWTQWNRDTKQFYIQFHFRLS 215          
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Medaka
Match: sf3a2 (splicing factor 3a subunit 2 [Source:NCBI gene;Acc:101163849])

HSP 1 Score: 359.377 bits (921), Expect = 1.017e-124
Identity = 165/227 (72.69%), Postives = 194/227 (85.46%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNIL 738
            MD+QHR GGKTGSGGVAS S++NRDR++RL Q+A++ IDI+KDPYFM+NHLG+YECKLCLTLHNN  SY+ HTQGKKHQ+NL +RAA++AKE+P QP   K KVE KKFVKIGRPGYKVTKQRDPE  QQS+LFQIDYPEI+E  G  PRHRFMSAYEQ IEPPDR WQYLL AAEPYETIAFKVPSREIDK   RFWT+WN+ +KQF+LQF +K++    ++ N+L
Sbjct:    1 MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKESPAQPAPAKLKVEVKKFVKIGRPGYKVTKQRDPEIGQQSLLFQIDYPEIAEGIG--PRHRFMSAYEQRIEPPDRRWQYLLFAAEPYETIAFKVPSREIDKAETRFWTHWNKETKQFFLQFHFKMEKAISQSGNLL 225          
BLAST of Splicing factor 3a subunit 2 vs. Planmine SMEST
Match: SMESG000081421.1 (SMESG000081421.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:   58 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNKAXXXXXXXXXXSEESAQISGQVQVLXXXXXXXXXXXXXXXXXXXXXXXFVTFPIPRF 936
            MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNKAQTTQQQLLTLSEESAQISGQVQVLPPISAPRVFPPPPPINIASMPSPFVTFPIPRF
Sbjct:    1 MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNHLGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLDKAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPRHRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTYWNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNKAQTTQQQLLTLSEESAQISGQVQVLPPISAPRVFPPPPPINIASMPSPFVTFPIPRF 293          
The following BLAST results are available for this feature:
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SF3A23.587e-10875.12splicing factor 3a subunit 2 [Source:HGNC Symbol;A... [more]
SF3A21.563e-5974.81splicing factor 3a subunit 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
repo-12.143e-11369.12REversed POlarity in early embryos [Source:UniPro... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sf3a27.575e-11570.18gene:FBgn0036314 transcript:FBtr0075944[more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3a23.913e-11175.11splicing factor 3a, subunit 2 [Source:ZFIN;Acc:ZDB... [more]
sf3a23.913e-11175.11splicing factor 3a, subunit 2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttl2.865e-10775.12tubulin tyrosine ligase [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Sf3a24.477e-10875.12splicing factor 3a, subunit 2 [Source:MGI Symbol;A... [more]
Sf3a28.460e-9273.71splicing factor 3a, subunit 2 [Source:MGI Symbol;A... [more]
Sf3a21.382e-3378.46splicing factor 3a, subunit 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15428|SF3A2_HUMAN1.722e-10775.12Splicing factor 3A subunit 2 OS=Homo sapiens OX=96... [more]
sp|Q6AXT8|SF3A2_RAT2.397e-10775.12Splicing factor 3A subunit 2 OS=Rattus norvegicus ... [more]
sp|A5PJN8|SF3A2_BOVIN6.065e-10775.12Splicing factor 3A subunit 2 OS=Bos taurus OX=9913... [more]
sp|Q62203|SF3A2_MOUSE2.276e-9771.43Splicing factor 3A subunit 2 OS=Mus musculus OX=10... [more]
sp|Q54B65|SF3A2_DICDI1.418e-7753.05Splicing factor 3A subunit 2 OS=Dictyostelium disc... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WC801.544e-13074.58Matrin-type domain-containing protein OS=Taenia as... [more]
U6JIC21.561e-13074.58Splicing factor 3A subunit 2 OS=Echinococcus granu... [more]
A0A068Y4331.573e-13074.58Splicing factor 3a subunit 2 OS=Echinococcus multi... [more]
A0A0R3TL372.243e-13075.21Matrin-type domain-containing protein OS=Rodentole... [more]
A0A0R3SFK52.386e-13075.64Matrin-type domain-containing protein OS=Hymenolep... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sf3a26.565e-11176.04splicing factor 3a subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PRP112.649e-1327.40Subunit of the SF3a splicing factor complex; requi... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO409045.886e-11970.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sf3a21.017e-12472.69splicing factor 3a subunit 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Splicing factor 3a subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000081421.10.000e+0100.00SMESG000081421.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032755 ID=SMED30032755|Name=Splicing factor 3a subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=964bp
TTTATATATTACATATTTCAAAGAGTTTTGTAAACAAATTTAATAAGATT
AATTAAAATGGATTATCAACATCGTCCAGGAGGAAAAACTGGCAGTGGAG
GTGTTGCTTCATTCTCCGATGCGAATAGAGATAGAAAGGACCGTTTAATG
CAAATTGCAATGGATGTTATTGATATAGACAAAGATCCATATTTTATGCG
TAACCACCTTGGTACTTACGAATGCAAATTGTGCTTGACACTTCACAATA
ACCCCGAATCTTATATGACTCATACTCAAGGTAAGAAGCATCAAAGTAAT
TTGCAAAAAAGAGCTGCAGAACAAGCAAAGGAGAATCCTATTCAACCTTT
ATTGGATAAAGCAAAAGTGGAGCATAAAAAGTTTGTCAAAATTGGTCGTC
CTGGTTATAAAGTTACAAAGCAAAGAGATCCTGAAACTAATCAACAGTCC
ATGCTATTTCAAATTGATTATCCAGAGATTTCAGAGAGCACTGGTGCTAT
TCCTCGACATAGATTTATGTCAGCTTATGAACAACACATTGAACCACCAG
ATCGTCACTGGCAATATCTGTTGATTGCAGCAGAGCCTTATGAAACCATA
GCATTTAAAGTTCCAAGTCGAGAAATAGACAAGGATCCTAAAAGATTCTG
GACATATTGGAATCGTCATTCTAAACAGTTTTATTTACAATTTGCGTACA
AACTAGACAATACTGCTGTTAAAAATGTCAATATACTTCGAGAAATTGAG
GAACAACGAAATAAAGCTCAAACAACTCAACAGCAGCTATTAACTTTATC
TGAAGAAAGTGCACAAATTTCCGGGCAAGTTCAAGTACTACCACCAATAT
CGGCTCCAAGGGTTTTCCCACCACCACCTCCGATTAATATTGCATCAATG
CCATCACCATTTGTTACTTTTCCAATACCGAGGTTTTAAATATAGTTTGA
ACGTTTGAAAACAA
back to top

protein sequence of SMED30032755-orf-1

>SMED30032755-orf-1 ID=SMED30032755-orf-1|Name=SMED30032755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=294bp
MDYQHRPGGKTGSGGVASFSDANRDRKDRLMQIAMDVIDIDKDPYFMRNH
LGTYECKLCLTLHNNPESYMTHTQGKKHQSNLQKRAAEQAKENPIQPLLD
KAKVEHKKFVKIGRPGYKVTKQRDPETNQQSMLFQIDYPEISESTGAIPR
HRFMSAYEQHIEPPDRHWQYLLIAAEPYETIAFKVPSREIDKDPKRFWTY
WNRHSKQFYLQFAYKLDNTAVKNVNILREIEEQRNKAQTTQQQLLTLSEE
SAQISGQVQVLPPISAPRVFPPPPPINIASMPSPFVTFPIPRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR003604Matrin/U1-like-C_Znf_C2H2
IPR031781SF3A2_dom
IPR000690Matrin/U1-C_Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 223..250
NoneNo IPR availableSMARTSM01050CactinC_cactus_3coord: 91..221
e-value: 8.5E-30
score: 115.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.2690coord: 95..224
e-value: 3.9E-5
score: 25.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 41..90
e-value: 6.6E-6
score: 27.5
NoneNo IPR availablePFAMPF12874zf-metcoord: 54..78
e-value: 1.1E-5
score: 25.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR23205SPLICING FACTOR 3A SUBUNIT 2coord: 1..281
IPR003604Matrin/U1-C-like, C2H2-type zinc fingerSMARTSM00451ZnF_U1_5coord: 51..85
e-value: 1.2E-6
score: 38.0
IPR031781SF3A2 domainPFAMPF16835SF3A2coord: 112..208
e-value: 8.3E-39
score: 131.9
IPR000690Matrin/U1-C, C2H2-type zinc fingerPROSITEPS50171ZF_MATRINcoord: 54..84
score: 9.11
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 45..84