Ribose-phosphate pyrophosphokinase

Overview
NameRibose-phosphate pyrophosphokinase
Smed IDSMED30032731
Length (bp)1127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribose-phosphate pyrophosphokinase (SMED30032731) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribose-phosphate pyrophosphokinase (SMED30032731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribose-phosphate pyrophosphokinase (SMED30032731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribose-phosphate pyrophosphokinase (SMED30032731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30032731SMESG000062796.1 dd_Smed_v4_12495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032731SMESG000062796.1 dd_Smed_v4_12495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032731SMESG000062796.1 dd_Smed_v4_12495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032731SMESG000062796.1 dd_Smed_v6_12495_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032731SMESG000062796.1 dd_Smed_v4_12495_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS2 (phosphoribosyl pyrophosphate synthetase 2 [Source:HGNC Symbol;Acc:HGNC:9465])

HSP 1 Score: 62.003 bits (149), Expect = 4.280e-10
Identity = 60/215 (27.91%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++LQ   E +A      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS2 (phosphoribosyl pyrophosphate synthetase 2 [Source:HGNC Symbol;Acc:HGNC:9465])

HSP 1 Score: 60.4622 bits (145), Expect = 1.199e-9
Identity = 61/218 (27.98%), Postives = 97/218 (44.50%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA---TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G+     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++LQ   E +A      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 256          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1 (phosphoribosyl pyrophosphate synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9462])

HSP 1 Score: 58.9214 bits (141), Expect = 4.181e-9
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E ++      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA ++   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1 (phosphoribosyl pyrophosphate synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9462])

HSP 1 Score: 58.9214 bits (141), Expect = 4.487e-9
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E ++      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA ++   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1 like 1 [Source:HGNC Symbol;Acc:HGNC:9463])

HSP 1 Score: 56.6102 bits (135), Expect = 2.455e-8
Identity = 58/215 (26.98%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E +       IV PD G AKR        ++  A        A+EVD IV          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA ++   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLS-----IAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIV----------LVGDVNDRVA-----ILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211424:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.344e-11
Identity = 86/327 (26.30%), Postives = 143/327 (43.73%), Query Frame = 3
Query:   51 KHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFIS-NVRDLIGKNVIFLAS----LHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSS 989
            K F   SHP   +L+ +I    +  + K  +K  KF N   N+ I  +VR   G++V  + S    ++D   + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + +IL+   E +       IV PD G AKR        ++  A        A+EV+ +           L+ ++  +++     I+VDD+ +T  TI  +A+  VE GA+K+  F +H IF   +  +            K E   ++++IP    + K S
Sbjct:    5 KVFSGSSHP---DLSTRICERLQLEVSKASLK--KFSNKETNVEIGESVR---GEDVYIIQSAAGEINDN--LMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMT----------LVGSVEGKVA-----ILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNA--------SKFEAVVVTNTIPQDENMKKCS 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7212735:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.344e-11
Identity = 86/327 (26.30%), Postives = 143/327 (43.73%), Query Frame = 3
Query:   51 KHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFIS-NVRDLIGKNVIFLAS----LHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSS 989
            K F   SHP   +L+ +I    +  + K  +K  KF N   N+ I  +VR   G++V  + S    ++D   + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + +IL+   E +       IV PD G AKR        ++  A        A+EV+ +           L+ ++  +++     I+VDD+ +T  TI  +A+  VE GA+K+  F +H IF   +  +            K E   ++++IP    + K S
Sbjct:    5 KVFSGSSHP---DLSTRICERLQLEVSKASLK--KFSNKETNVEIGESVR---GEDVYIIQSAAGEINDN--LMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMT----------LVGSVEGKVA-----ILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNA--------SKFEAVVVTNTIPQDENMKKCS 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211442:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.344e-11
Identity = 86/327 (26.30%), Postives = 143/327 (43.73%), Query Frame = 3
Query:   51 KHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFIS-NVRDLIGKNVIFLAS----LHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSS 989
            K F   SHP   +L+ +I    +  + K  +K  KF N   N+ I  +VR   G++V  + S    ++D   + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + +IL+   E +       IV PD G AKR        ++  A        A+EV+ +           L+ ++  +++     I+VDD+ +T  TI  +A+  VE GA+K+  F +H IF   +  +            K E   ++++IP    + K S
Sbjct:    5 KVFSGSSHP---DLSTRICERLQLEVSKASLK--KFSNKETNVEIGESVR---GEDVYIIQSAAGEINDN--LMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMT----------LVGSVEGKVA-----ILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNA--------SKFEAVVVTNTIPQDENMKKCS 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211436:7215226:1 gene:WBGene00020107.1 transcript:R151.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 65.0846 bits (157), Expect = 1.344e-11
Identity = 86/327 (26.30%), Postives = 143/327 (43.73%), Query Frame = 3
Query:   51 KHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFIS-NVRDLIGKNVIFLAS----LHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSS 989
            K F   SHP   +L+ +I    +  + K  +K  KF N   N+ I  +VR   G++V  + S    ++D   + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + +IL+   E +       IV PD G AKR        ++  A        A+EV+ +           L+ ++  +++     I+VDD+ +T  TI  +A+  VE GA+K+  F +H IF   +  +            K E   ++++IP    + K S
Sbjct:    5 KVFSGSSHP---DLSTRICERLQLEVSKASLK--KFSNKETNVEIGESVR---GEDVYIIQSAAGEINDN--LMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMT----------LVGSVEGKVA-----ILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNA--------SKFEAVVVTNTIPQDENMKKCS 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7213176:7215226:1 gene:WBGene00020107.1 transcript:R151.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 64.6994 bits (156), Expect = 2.019e-11
Identity = 85/325 (26.15%), Postives = 142/325 (43.69%), Query Frame = 3
Query:   57 FWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFIS-NVRDLIGKNVIFLAS----LHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSS 989
            F   SHP   +L+ +I    +  + K  +K  KF N   N+ I  +VR   G++V  + S    ++D   + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + +IL+   E +       IV PD G AKR        ++  A        A+EV+ +           L+ ++  +++     I+VDD+ +T  TI  +A+  VE GA+K+  F +H IF   +  +            K E   ++++IP    + K S
Sbjct:    6 FSGSSHP---DLSTRICERLQLEVSKASLK--KFSNKETNVEIGESVR---GEDVYIIQSAAGEINDN--LMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMT----------LVGSVEGKVA-----ILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNA--------SKFEAVVVTNTIPQDENMKKCS 284          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0076415)

HSP 1 Score: 61.2326 bits (147), Expect = 3.882e-10
Identity = 61/209 (29.19%), Postives = 92/209 (44.02%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EV  +V          L+  +  +I+     I+VDD+ +T  TI+ +A+  VE GA K+   + H IF
Sbjct:   99 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNS--IIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMV----------LVGDVKDKIA-----ILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0345032)

HSP 1 Score: 61.2326 bits (147), Expect = 3.882e-10
Identity = 61/209 (29.19%), Postives = 92/209 (44.02%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EV  +V          L+  +  +I+     I+VDD+ +T  TI+ +A+  VE GA K+   + H IF
Sbjct:   99 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNS--IIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMV----------LVGDVKDKIA-----ILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0333856)

HSP 1 Score: 58.9214 bits (141), Expect = 2.406e-9
Identity = 58/209 (27.75%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K    + A   A L++N+ ++  G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EV  +V          L+  +  +I+     I+VDD+ +T  TI+ +A+  VE GA K+   + H IF
Sbjct:  114 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANM-LSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNS--IIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMV----------LVGDVKDKIA-----ILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 304          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0345034)

HSP 1 Score: 58.9214 bits (141), Expect = 2.428e-9
Identity = 58/209 (27.75%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K    + A   A L++N+ ++  G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EV  +V          L+  +  +I+     I+VDD+ +T  TI+ +A+  VE GA K+   + H IF
Sbjct:   99 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANM-LSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNS--IIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMV----------LVGDVKDKIA-----ILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 289          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0310662)

HSP 1 Score: 58.9214 bits (141), Expect = 2.428e-9
Identity = 58/209 (27.75%), Postives = 93/209 (44.50%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K    + A   A L++N+ ++  G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EV  +V          L+  +  +I+     I+VDD+ +T  TI+ +A+  VE GA K+   + H IF
Sbjct:   99 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANM-LSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNS--IIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMV----------LVGDVKDKIA-----ILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 289          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 60.077 bits (144), Expect = 1.039e-9
Identity = 58/209 (27.75%), Postives = 90/209 (43.06%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA        +   +P FP    +K +K     +AK VAN+LS      +G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 60.077 bits (144), Expect = 1.090e-9
Identity = 58/209 (27.75%), Postives = 90/209 (43.06%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA        +   +P FP    +K +K     +AK VAN+LS      +G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 60.077 bits (144), Expect = 1.090e-9
Identity = 58/209 (27.75%), Postives = 90/209 (43.06%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA        +   +P FP    +K +K     +AK VAN+LS      +G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 59.3066 bits (142), Expect = 2.024e-9
Identity = 61/211 (28.91%), Postives = 92/211 (43.60%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA--TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G  A  +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  V  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLVSAGAIKVYAILTHGIF 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 58.9214 bits (141), Expect = 2.271e-9
Identity = 59/209 (28.23%), Postives = 90/209 (43.06%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  V  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLVSAGAIKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: garem1 (GRB2 associated regulator of MAPK1 subtype 1 [Source:Xenbase;Acc:XB-GENE-976985])

HSP 1 Score: 59.6918 bits (143), Expect = 2.041e-9
Identity = 59/215 (27.44%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++LQ   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLQWIRENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:394745])

HSP 1 Score: 58.5362 bits (140), Expect = 5.758e-9
Identity = 58/215 (26.98%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +  +++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASACRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDKVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:394745])

HSP 1 Score: 55.8398 bits (133), Expect = 4.237e-8
Identity = 55/215 (25.58%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA        +   +P FP    +K +K    + A   A L++N+ ++  G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +  +++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASACRVTAVIPCFPYARQDKKDKSVTASRAPISAKLVANM-LSVAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDKVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 257          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps2 (phosphoribosyl pyrophosphate synthetase 2 [Source:MGI Symbol;Acc:MGI:97776])

HSP 1 Score: 60.077 bits (144), Expect = 1.176e-9
Identity = 59/215 (27.44%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++LQ   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLQWIRENITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:MGI Symbol;Acc:MGI:97775])

HSP 1 Score: 58.9214 bits (141), Expect = 2.871e-9
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E ++      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA ++   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1l3 (phosphoribosyl pyrophosphate synthetase 1-like 3 [Source:MGI Symbol;Acc:MGI:3779453])

HSP 1 Score: 58.9214 bits (141), Expect = 3.231e-9
Identity = 57/217 (26.27%), Postives = 95/217 (43.78%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPN 875
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E ++      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +  GA ++   + H IF  
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSG 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1l1 (phosphoribosyl pyrophosphate synthetase 1-like 1 [Source:MGI Symbol;Acc:MGI:1922706])

HSP 1 Score: 57.7658 bits (138), Expect = 6.744e-9
Identity = 57/215 (26.51%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E ++      IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  + +GA ++   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----IAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICYAADKLLSEGATRVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q9XGA0|KPRS3_SPIOL (Ribose-phosphate pyrophosphokinase 3, mitochondrial OS=Spinacia oleracea OX=3562 GN=PRS3 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.448e-80
Identity = 134/324 (41.36%), Postives = 199/324 (61.42%), Query Frame = 3
Query:   48 NKHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLA 1019
            +K   L   P    LA +I + S+ I  + I  W  FE+ FPN+FISN + + GK+V FLAS   P V+FEQLSVI ALP+  + S  L LPFFP GT E++E EG +ATA T+A +LSNIPI++ GP  +V +DIH+LQE+FYFGD+++P  ES I LL +K+  L   ++ + I FPDDGA KRFH+                 +   ++ C+K+R   + I  + +      H++IVDDL+ +G T+++  ++    GA K+S ++ H IFPN SW++F KP   G  E+ + +FWI+DS P   ++ K+    F+++SLA
Sbjct:   93 SKKVCLFYCPETKALAERIAAQSDAIQLRSI-SWRTFEDGFPNLFISNAQGIRGKHVAFLASFSSPGVIFEQLSVIYALPKLFVASFKLVLPFFPTGTSERMEDEGDVATAFTLARILSNIPISREGPTSLVTFDIHALQERFYFGDNILPCFESGIPLLKKKLQQL-PDSDNITIAFPDDGAWKRFHKQL---------------QHFPMIVCAKVREGDQRIVRLKEGDPTGRHVVIVDDLVQSGGTLIECQKVLAAHGAAKVSAYVTHGIFPNKSWERF-KPDTAGCPEEGMTHFWITDSCPLTVKMVKNRPP-FEVISLA 397          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q680A5|KPRS4_ARATH (Ribose-phosphate pyrophosphokinase 4 OS=Arabidopsis thaliana OX=3702 GN=PRS4 PE=1 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 1.384e-78
Identity = 128/318 (40.25%), Postives = 194/318 (61.01%), Query Frame = 3
Query:   87 ELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLA-QLSNAL 1037
            ELA  I + S++I  + I  W  F + FPN+FI+N  D+ G++V FLAS   PAV+FEQ+SVI  LPR  + S  L LPFFP G+ E++E+EG +ATA T+A ++SNIPI++ GP  +VIYDIH+LQE+FYF D V+P  E+ I LL +++  L  + EKV + FPDDGA KRFH+                 +    V C+K+R   + I  + +      H++IVDDL+ +G T+++  ++    GA K+S ++ H +FP  SW++F    K   +E+    FWI+DS P   +   +    F+++SLA  +++AL
Sbjct:   38 ELARNIAAESDHITLQSI-NWRSFADGFPNLFINNAHDIRGQHVAFLASFSSPAVIFEQISVIYLLPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTMARIVSNIPISRGGPTSVVIYDIHALQERFYFADQVLPLFETGIPLLTKRLQQL-PETEKVIVAFPDDGAWKRFHKLL---------------DHYPTVVCTKVREGDKRIVRLKEGNPAGCHVVIVDDLVQSGGTLIECQKVLAAHGAVKVSAYVTHGVFPKSSWERFTH--KKNGLEEAFAYFWITDSCPQTVKAIGNKAP-FEVLSLAGSIADAL 335          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q9XGA1|KPRS4_SPIOL (Ribose-phosphate pyrophosphokinase 4 OS=Spinacia oleracea OX=3562 GN=PRS4 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.817e-78
Identity = 128/320 (40.00%), Postives = 200/320 (62.50%), Query Frame = 3
Query:   87 ELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDD--IVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLA-QLSNAL 1037
            ELA K+ + S  I  + I  W  F++ FPN+FI+N +D+ G++V FLA+   PAV+FEQLSVI ALPR  + S  L LPFFP G+ E++E+EG +ATA T+A +LSNIP+++ GP  +VIYDIH+LQE+FYF D+V+P  E+ I LL +++  L   + K+ + FPDDGA KRFH+                 ++D   +V C+K+R   + I  + +      H++IVDDL+ +G T+++  ++    GA K+S ++ HA+FP +S+++F    K    +K    FWI+DS P   +   +    F+++SLA  +++AL
Sbjct:   19 ELARKVAAQSPLITLQSI-NWRSFDDGFPNLFINNAQDIRGQHVAFLAAFSSPAVIFEQLSVIYALPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTMARILSNIPVSRGGPTSVVIYDIHALQERFYFSDNVLPLFETGIPLLKQRLDQLPDAD-KIVVAFPDDGAWKRFHK-----------------QLDHFPMVVCAKVREGDKRIVRLKEGNPAGCHVVIVDDLVQSGGTLIECQKVLAAHGATKVSAYVTHAVFPKNSFERFTH--KDDGSDKAFTYFWITDSCPRTVKSIANKAP-FEVLSLAGSIADAL 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q8S2E5|KPRS3_ORYSJ (Ribose-phosphate pyrophosphokinase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0723600 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 6.250e-78
Identity = 131/311 (42.12%), Postives = 194/311 (62.38%), Query Frame = 3
Query:   87 ELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLA 1019
            ELA ++ + +++I  + I  W  F + FPN+FISN   + G++V FLAS   P+V+FEQLS+I ALP+  I+S  L LPFFP GT E++E EG +ATA T+A +LSNIPI++ GP+ +VI+DIH+LQE+FYFGDSV+P  ES I LL  ++  L   ++ + I FPDDGA KRF++                 +   +V C+K+R   + I  I +      H++IVDDL+ +G T+++  ++  E GA K+S ++ H IFPN SW+KF +P         L +FWI+DS P      K   + F+++SLA
Sbjct:  109 ELAEQVVARNDDIELRSI-SWRTFADGFPNLFISNAHTIRGQHVAFLASFSSPSVIFEQLSIIYALPKLFISSFTLILPFFPTGTSERMEDEGDVATAFTLARILSNIPISRGGPSSLVIFDIHALQERFYFGDSVLPCFESGIPLLKSRLQEL-PDSDNITIAFPDDGAWKRFYKQL---------------QHFPMVVCNKVREGEQRIVRIKEGDPRGRHVVIVDDLVQSGGTLIECQKVLAEHGAAKVSAYVTHGIFPNKSWEKF-QPDNGEGPGHGLSHFWITDSCPLTVNAVKDR-QPFEILSLA 400          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q93Z66|KPRS3_ARATH (Ribose-phosphate pyrophosphokinase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRS3 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.373e-76
Identity = 127/310 (40.97%), Postives = 188/310 (60.65%), Query Frame = 3
Query:   27 SKMSALKNKHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDS 956
            S+  +  +K   L       +LA +I + S+ I  + I  W KF++ FPN+FI N + + G++V FLAS   PAV+FEQLSVI ALP+  ++S  L LPFFP GT E++E EG +ATA T+A +LSNIP ++ GP  +V +DIH+LQE+FYFGD+++P  ES I LL  ++  L   ++ ++I FPDDGA KRFH+                     IV C+K+R   + I  I +  +   H++IVDDL+ +G T+++  ++    GA K+S ++ H IFP  SWK+F    K G+  + L  FWI+DS
Sbjct:   91 SESGSKSSKRVCLFHSDETRDLAERIVAKSDCIELRSI-NWKKFDDGFPNLFIQNAQGIRGQHVAFLASFSSPAVIFEQLSVIYALPKLFVSSFTLVLPFFPTGTSERMEDEGDVATAFTLARILSNIPTSRGGPTSLVTFDIHALQERFYFGDTILPCFESGIPLLKSRLQSLP-DSDNISIAFPDDGAWKRFHK--------------QLQHYPTIV-CNKVRMGDKRIVRIKEGDAEGRHVVIVDDLVQSGGTLIECQKVLAAHGAAKISAYVTHGIFPRSSWKRFKLDTK-GDPAEGLSYFWITDS 382          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A3S1BC63 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_015026 PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 4.395e-100
Identity = 145/306 (47.39%), Postives = 209/306 (68.30%), Query Frame = 3
Query:  111 NSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQG-RLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQL 1025
             + ++ F++ I+W KF + FPN+FI +V+ + GK+VIF+ S H PAV+FEQLSV+ A PRYL  S    LP+FP GTME+++ EGQIATAKT+A LLS IP++  GPA+I+IYDIH+LQE+FYF D+VIPRLE+ I LLH K+S+++ + E +AI FPDDGA KRFH  F   +             + ++ C+K R +G + I T+        H++IVDDL+ TG T+L+ A+  ++ GA  +S ++ HA+FPN SWKKF   ++    +    NFWI+DS+PHA EIC  + E F+L+SL+ +
Sbjct:   87 KARHVEFRNTIQWKKFADGFPNVFIEDVKYMAGKDVIFIGSFHSPAVVFEQLSVLYAFPRYLARSFHFILPYFPTGTMERVDTEGQIATAKTLATLLSAIPLSAKGPAQIIIYDIHALQERFYFSDNVIPRLETAIPLLHSKLSMMEGQGEDLAIAFPDDGAYKRFHLLFPGDE-------------ERLIICAKRRMEGNKRIVTVKDGDPKGKHVVIVDDLVQTGGTLLECAKALLQGGATAISAYVTHAVFPNQSWKKFTHTVE--GAQPAFANFWITDSLPHAPEIC--AHEPFKLLSLSTV 375          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A267FSF0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019935g8 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.304e-97
Identity = 141/337 (41.84%), Postives = 221/337 (65.58%), Query Frame = 3
Query:   39 ALKNKHFWLLSHPTQFELAVKIESNSEN---------IIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQ 1022
            A +++  WLL+H +  +LA +I  +S           I++KD + W++F + FPNIFI NV+ + G++VIFLASLH+P+V+FEQ+S+I++LPRY + SL L LP+FPCGTME++++EGQ+ATA +VA LLS+ P+T+ GP ++V+YDIH+LQE+FYF D V+P L S ++LL+ ++  L+     +AI FPD+GA KRFH  F   +             DD++ C K+R     +  + +      H++IVDDL+ TG T+++ A      GA+ +S F+ HA+FP +SW++F       + +   E+FWI+DS+PHA +I +     F+L+SLA+
Sbjct:    1 ADQSRPLWLLAHSSMAQLAKEIADHSAATAAGQKSRLIVYKDSVSWDRFADGFPNIFIHNVQQMAGQDVIFLASLHEPSVIFEQVSLIHSLPRYFVRSLTLLLPYFPCGTMERVDREGQVATAMSVARLLSSTPLTRHGPCQLVVYDIHALQERFYFTDCVVPLLASAMSLLYPQLYDLRRAQPGLAIAFPDEGAFKRFHLSFSVPE-----------HADDLITCLKVRDGDSRVIRVKEGSPAGRHVVIVDDLVQTGGTLIQCAAALKSLGASSVSAFVPHAVFPRESWRRFT------DGQGLFEHFWITDSLPHARQIAQHPP--FRLLSLAE 318          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A267DEJ7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028349g1 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.701e-96
Identity = 139/337 (41.25%), Postives = 221/337 (65.58%), Query Frame = 3
Query:   39 ALKNKHFWLLSHPTQFELAVKIESNSEN---------IIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQ 1022
            A +++  WLL+H +  +LA +I  +S           I++KD + W++F + FPNIFI NV+ + G++V+FLASLH+P+V+FEQ+S+I++LPRY + SL L LP+FPCGTME++++EGQ+ATA +VA LL++ P+T+ GP ++V+YDIH+LQE+FYF D V+P L S ++LL+ ++  L+     +AI FPD+GA KRFH  F   +             DD++ C K+R     +  + +      H++IVDDL+ TG T+++ A      GA+ +S F+ HA+FP +SW++F       + +   E+FWI+DS+PHA +I +     F+L+SLA+
Sbjct:    1 ADQSRPLWLLAHSSMAQLAKEIADHSAATAAGQKSRLIVYKDSVSWDRFADGFPNIFIHNVQQMAGQDVVFLASLHEPSVIFEQVSLIHSLPRYFVRSLTLLLPYFPCGTMERVDREGQVATAMSVARLLNSTPLTRHGPCQLVVYDIHALQERFYFTDCVVPLLASAMSLLYPQLYDLRRAQPGLAIAFPDEGAFKRFHLSFSVPE-----------HADDLITCLKVRDGDSRVIRVKEGSPAGRHVVIVDDLVQTGGTLIQCAAALKSLGASAVSAFVPHAVFPRESWRRFT------DGQGLFEHFWITDSLPHARQIAQHPP--FRLLSLAE 318          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A1I8GQP8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 1.781e-94
Identity = 134/310 (43.23%), Postives = 206/310 (66.45%), Query Frame = 3
Query:   93 AVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQ 1022
            A      S  I++KD + W++F + FPNIFI NV+ + G++VIFLASLH+P+V+FEQ+S+I++LPRY + SL L LP+FPCGTME++++EGQ+ATA +VA LLS+ P+T+ GP ++V+YDIH+LQE+FYF D V+P L S ++LL+ ++  L+     +AI FPD+GA KRFH  F   +             DD++ C K+R     +  + +      H++IVDDL+ TG T+++ A      GA+ +S F+ HA+FP +SW++F       + +   E+FWI+DS+PHA +I +     F+L+SLA+
Sbjct:   14 ATAAGQKSRLIVYKDSVSWDRFADGFPNIFIHNVQQMAGQDVIFLASLHEPSVIFEQVSLIHSLPRYFVRSLTLLLPYFPCGTMERVDREGQVATAMSVARLLSSTPLTRHGPCQLVVYDIHALQERFYFTDCVVPLLASAMSLLYPQLYDLRRAQPGLAIAFPDEGAFKRFHLSFSVPE-----------HADDLITCLKVRDGDSRVIRVKEGSPAGRHVVIVDDLVQTGGTLIQCAAALKSLGASSVSAFVPHAVFPRESWRRFT------DGQGLFEHFWITDSLPHARQIAQHPP--FRLLSLAE 304          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: K1Q645 (Ribose-phosphate pyrophosphokinase 3, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10023797 PE=3 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 3.766e-91
Identity = 144/317 (45.43%), Postives = 203/317 (64.04%), Query Frame = 3
Query:   75 PTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIFISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLL-HEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQ 1022
            P    L++   S+   + ++  I+W  F + FPN+FI +V+ + GK+VIF+ S H P V+FEQLSV+ A PRYL  S    +P+FP GTME+++ EGQIATAKT+A L+S IP+T  GPA+I+I+DIH+LQE+FYF D+VIPRLES + LL  E  S+   KN  V+I FPDDGA KRFH FF  +D  T               C KIR   R I  +        H++I+DDL+ +G T+ + A+   EKGA K+S ++ HA+FP +SW+KF+      + + K ENFWI+DS+PHA  IC+     F+L+SL++
Sbjct:   12 PPVRALSISASSSPREVEYRKTIQWKTFPDGFPNLFIEDVKYMAGKDVIFIGSFHTPDVIFEQLSVLYAFPRYLARSFHFIMPYFPTGTMERVDTEGQIATAKTLATLISGIPLTTKGPAQIIIFDIHALQERFYFSDNVIPRLESAVPLLMREMKSLPDFKN--VSIAFPDDGACKRFHNFFPDEDPIT---------------CVKIRDGNRRIVKVKDGNPAGRHVLIIDDLVQSGGTLKECAKALYEKGAIKVSAYVTHAVFPKESWRKFV------DSDVKFENFWITDSLPHAKMICEHPP--FRLLSLSE 303          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1a (ribose-phosphate pyrophosphokinase 1-like [Source:NCBI gene;Acc:103031347])

HSP 1 Score: 62.003 bits (149), Expect = 2.305e-10
Identity = 62/211 (29.38%), Postives = 92/211 (43.60%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA--TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G  A  +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  V  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLVSAGATKVYAILTHGIF 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1a (ribose-phosphate pyrophosphokinase 1-like [Source:NCBI gene;Acc:103031347])

HSP 1 Score: 60.8474 bits (146), Expect = 4.759e-10
Identity = 62/211 (29.38%), Postives = 92/211 (43.60%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA--TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G  A  +AK VAN+LS       G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  V  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKN--CTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICHAADKLVSAGATKVYAILTHGIF 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:103045742])

HSP 1 Score: 60.077 bits (144), Expect = 1.021e-9
Identity = 57/215 (26.51%), Postives = 95/215 (44.19%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS      +G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  T+  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIKENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS4 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS4 has a paralog, PRS2, that arose from the whole genome duplication; a missense mutation in the conserved residue R196 of its human homolog PRPS1 is pathogenic [Source:SGD;Acc:S000000164])

HSP 1 Score: 60.4622 bits (145), Expect = 9.168e-11
Identity = 58/222 (26.13%), Postives = 97/222 (43.69%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISIL-----QSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKF 893
            + E L +I+A        +   +P FP    +K +K     TAK VANLL        G   ++  D+H+ Q Q +F    IP     +  L+ + S+L     ++  +   +V PD G AKR        DL+ A        A+EV  +V          L+  +T     N   ++VDD+ +T  T++K+ +  +E GA ++   + H IF   + +K 
Sbjct:   79 LMELLILIHACKIASARKITTVIPNFPYARQDKKDKSRAPITAKLVANLLQT-----AGADHVITMDLHASQIQGFFH---IP-----VDNLYAEPSVLNYIRTKTDFDNAILVSPDAGGAKRVAALADKLDLNFALIHKERQKANEVSKMV----------LVGDVT-----NKSCLLVDDMADTCGTLVKACDTLMEHGAKEVIAIVTHGIFSGSAREKL 272          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS3 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes [Source:SGD;Acc:S000001003])

HSP 1 Score: 58.151 bits (139), Expect = 4.861e-10
Identity = 64/251 (25.50%), Postives = 108/251 (43.03%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRL---ESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNI-EKKLENFWISDSIPHANEICK 983
            + E L +INA        +   +P FP    ++ +K     TAK +A++L     T  G   ++  D+H+ Q Q +F D  +  L    S +  + E ++ + S      I+ PD G AKR        DL+ A        A+EV  +V          L+  +T +I      IIVDD+ +T  T+ K+AE+ +E  A  +   + H +    +         I NI   KL+    ++++P   +I K
Sbjct:   70 VLELLIMINASKTASARRITAIIPNFPYARQDRKDKSRAPITAKLMADML-----TTAGCDHVITMDLHASQIQGFF-DVPVDNLYAEPSVVRYIKENVNYMDS-----IIISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMV----------LVGDVTDKIC-----IIVDDMADTCGTLAKAAEILLENRAKSVIAIVTHGVLSGRA---------IENINNSKLDRVVCTNTVPFEEKIKK 285          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS2 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS2 has a paralog, PRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000000901])

HSP 1 Score: 56.225 bits (134), Expect = 2.353e-9
Identity = 55/245 (22.45%), Postives = 101/245 (41.22%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA-----IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIP 962
            + E L +I+A     +  +   +P FP    +K +K     TAK +ANLL        G   ++  D+H+ Q Q +F    IP     +  L+ + S+L     K       +V PD G AKR        D++ A        A+EV  ++    +  +  L+               +DD+ +T  T++K+ +  ++ GA ++   + H IF   + +K         I  +L     ++++P
Sbjct:   71 LMELLILIHACKTASVRRITAVIPNFPYARQDKKDKSRAPITAKLIANLLET-----AGCDHVITMDLHASQIQGFFH---IP-----VDNLYGEPSVLNYIRTKTDFNNAILVSPDAGGAKRVASLADKLDMNFALIHKERQKANEVSRMLLVGDVAGKSCLL---------------IDDMADTCGTLVKACDTLMDHGAKEVIAIVTHGIFSGSAREKL--------INSRLSRIVCTNTVP 279          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Match: EDO36633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY8])

HSP 1 Score: 158.303 bits (399), Expect = 1.524e-46
Identity = 91/216 (42.13%), Postives = 128/216 (59.26%), Query Frame = 3
Query:  384 TVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIR-YQGRLINTITQEISP-NFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQL 1025
            T+A LLS  P+T  GP +IVI+DIH+LQE+FYFGD VIPRLES I LL   + +L +  EKV I FPD+GA KRFH  F               +    + C KIR    R++     + +P   H+IIVDDL+ TG T++  A+     GA+K+S ++ HA+FP +SWK+F       + +   E F+I+DS+PHA +I  +S   F L+SL  +
Sbjct:   25 TLATLLSATPLTARGPTQIVIFDIHALQERFYFGDFVIPRLESAIPLL---LRVLSNFQEKVNIAFPDEGAYKRFHTMF---------------QAFPNITCIKIRDGDKRIVKVKEGKFTPKGSHVIIVDDLVMTGGTLIMCAKALKAAGASKISAYVTHAVFPQESWKRFT------SRDVPFEKFYITDSLPHAKDIASNSP--FHLLSLCDV 214          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Match: EDO47117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC7])

HSP 1 Score: 56.6102 bits (135), Expect = 5.103e-9
Identity = 64/247 (25.91%), Postives = 99/247 (40.08%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPH 965
            M E L +INA        +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++L+   E V       IV PD G AKR        +   A        A+EV  +V    ++               +   I+VDD+ +T  T+  +A    E GA K+     H +F   + K+    I        +E   I++SIP 
Sbjct:   67 MMELLIMINACKIASAQRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVLKWIKENVHDWQNSVIVSPDAGGAKRVTSIADHLNCGFALIHKERKVANEVASMVLVGDVK---------------DRTAILVDDIADTCGTLTLAATKLNEAGAAKVYAICTHGVFSGPALKRLDGSI--------IEAVAITNSIPQ 277          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:101169709])

HSP 1 Score: 62.7734 bits (151), Expect = 1.221e-10
Identity = 62/211 (29.38%), Postives = 94/211 (44.55%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA--TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G  A  +AK VAN+LS      +G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +T  ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKN--CIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVTDRVA-----ILVDDMADTCGTICHAADKLISAGATKVYAILTHGIF 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:101169709])

HSP 1 Score: 62.7734 bits (151), Expect = 1.378e-10
Identity = 62/211 (29.38%), Postives = 94/211 (44.55%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIA--TAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K G  A  +AK VAN+LS      +G   I+  D+H+ Q Q +F   V         L   K +I + KN    IV PD G AKR        ++  A        A+EVD +V          L+  +T  ++     I+VDD+ +T  TI  +A+  +  GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLS-----VSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKN--CIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVTDRVA-----ILVDDMADTCGTICHAADKLISAGATKVYAILTHGIF 255          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: ENSORLT00000008371.2 (ribose-phosphate pyrophosphokinase 2 [Source:NCBI gene;Acc:101173845])

HSP 1 Score: 59.6918 bits (143), Expect = 1.421e-9
Identity = 58/215 (26.98%), Postives = 94/215 (43.72%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVA------IVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIF 869
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F        +  +  L+ + ++LQ   E +       IV PD G AKR        ++  A        A+EVD +V          L+  +   ++     I+VDD+ +T  TI  +A+  +E GA K+   + H IF
Sbjct:   67 LMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGADHIITMDLHASQIQGFF--------DIAVDNLYAEPAVLQWIKENIPEWKNCIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMV----------LVGDVKDRVA-----ILVDDMADTCGTICFAADKLIEAGALKVYAILTHGIF 253          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000062796.1 (SMESG000062796.1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 263/265 (99.25%), Postives = 265/265 (100.00%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQLSNALFSK 1046
            MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLIN+ITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANK+SVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQLSNALFSK
Sbjct:    1 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKDLSTANRSDNAHEVDDIVFCSKIRYQGRLINSITQEISPNFHLIIVDDLINTGNTILKSAELCVEKGANKISVFIIHAIFPNDSWKKFLKPIKIGNIEKKLENFWISDSIPHANEICKSSGEIFQLVSLAQLSNALFSK 265          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000008469.1 (SMESG000008469.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.888e-7
Identity = 53/196 (27.04%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKV------AIVFPDDGAAKRFHRFFYTKDLSTA---NRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAE 812
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F    IP     +  L+ + ++++   + +      AIV PD G AKR        ++  A        A+EVD +V    +R               +   I+VDD+I+T  TI  +AE
Sbjct:   67 LMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGANHIITMDLHASQIQGFFD---IP-----VDNLYAEPAVVRWIKDNIPDWNQCAIVSPDAGGAKRVTAIADHLNVDFALIHKERKKANEVDRMVLVGDVR---------------DRVAILVDDMIDTCGTICLAAE 234          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000008493.1 (SMESG000008493.1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.089e-7
Identity = 53/190 (27.89%), Postives = 81/190 (42.63%), Query Frame = 3
Query:  252 MFEQLSVINALPRYLINSLILFLPFFPCGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYFGDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRF--FYTKDLSTANRS-DNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLINTGNTILKSAE 812
            + E L +INA      + +   +P FP    +K +K     +AK VAN+LS       G   I+  D+H+ Q Q +F   V         +   K++I      + AIV PD G AKR          D +  ++    A+EVD +V    +R               +   I+VDD+I+T  TI  +AE
Sbjct:   67 LMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLS-----VAGANHIITMDLHASQIQGFFDIPVDNLYAEPAVVRWIKVNI--PDWNQCAIVSPDAGGAKRVTAIADHLNADFALIHKERKKANEVDRMVLVGDVR---------------DRVAILVDDMIDTCGTICLAAE 234          
The following BLAST results are available for this feature:
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPS24.280e-1027.91phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
PRPS21.199e-927.98phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
PRPS14.181e-926.51phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
PRPS14.487e-926.51phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
PRPS1L12.455e-826.98phosphoribosyl pyrophosphate synthetase 1 like 1 [... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R151.21.344e-1126.30pep chromosome:WBcel235:III:7211424:7215111:1 gene... [more]
R151.21.344e-1126.30pep chromosome:WBcel235:III:7212735:7215111:1 gene... [more]
R151.21.344e-1126.30pep chromosome:WBcel235:III:7211442:7215111:1 gene... [more]
R151.21.344e-1126.30pep chromosome:WBcel235:III:7211436:7215226:1 gene... [more]
R151.22.019e-1126.15pep chromosome:WBcel235:III:7213176:7215226:1 gene... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG67673.882e-1029.19gene:FBgn0036030 transcript:FBtr0076415[more]
CG67673.882e-1029.19gene:FBgn0036030 transcript:FBtr0345032[more]
CG67672.406e-927.75gene:FBgn0036030 transcript:FBtr0333856[more]
CG67672.428e-927.75gene:FBgn0036030 transcript:FBtr0345034[more]
CG67672.428e-927.75gene:FBgn0036030 transcript:FBtr0310662[more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prps1b1.039e-927.75phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
prps1b1.090e-927.75phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
prps1b1.090e-927.75phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
prps1a2.024e-928.91phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1a2.271e-928.23phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
garem12.041e-927.44GRB2 associated regulator of MAPK1 subtype 1 [Sour... [more]
prps15.758e-926.98phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prps14.237e-825.58phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Prps21.176e-927.44phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
Prps12.871e-926.51phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
Prps1l33.231e-926.27phosphoribosyl pyrophosphate synthetase 1-like 3 [... [more]
Prps1l16.744e-926.51phosphoribosyl pyrophosphate synthetase 1-like 1 [... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XGA0|KPRS3_SPIOL2.448e-8041.36Ribose-phosphate pyrophosphokinase 3, mitochondria... [more]
sp|Q680A5|KPRS4_ARATH1.384e-7840.25Ribose-phosphate pyrophosphokinase 4 OS=Arabidopsi... [more]
sp|Q9XGA1|KPRS4_SPIOL1.817e-7840.00Ribose-phosphate pyrophosphokinase 4 OS=Spinacia o... [more]
sp|Q8S2E5|KPRS3_ORYSJ6.250e-7842.12Ribose-phosphate pyrophosphokinase 3, chloroplasti... [more]
sp|Q93Z66|KPRS3_ARATH2.373e-7640.97Ribose-phosphate pyrophosphokinase 3, chloroplasti... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BC634.395e-10047.39Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A267FSF02.304e-9741.84Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DEJ71.701e-9641.25Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GQP81.781e-9443.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1Q6453.766e-9145.43Ribose-phosphate pyrophosphokinase 3, mitochondria... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prps1a2.305e-1029.38ribose-phosphate pyrophosphokinase 1-like [Source:... [more]
prps1a4.759e-1029.38ribose-phosphate pyrophosphokinase 1-like [Source:... [more]
prps1b1.021e-926.51phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRS49.168e-1126.135-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS34.861e-1025.505-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS22.353e-922.455-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO366331.524e-4642.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471175.103e-925.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prps1b1.221e-1029.38phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prps1b1.378e-1029.38phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
ENSORLT00000008371.21.421e-926.98ribose-phosphate pyrophosphokinase 2 [Source:NCBI ... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000062796.10.000e+099.25SMESG000062796.1[more]
SMESG000008469.11.888e-727.04SMESG000008469.1[more]
SMESG000008493.12.089e-727.89SMESG000008493.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032731 ID=SMED30032731|Name=Ribose-phosphate pyrophosphokinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1127bp
ATTTTCTTTTTGAATTTAAAGTTTAGAGTAAAATGTCAGCTTTAAAAAAT
AAACATTTTTGGCTTTTAAGTCATCCGACGCAATTTGAATTGGCTGTTAA
AATTGAAAGTAATTCAGAAAATATTATTTTTAAAGACATTATTAAATGGA
ATAAGTTTGAAAATAATTTTCCAAACATTTTTATATCAAACGTCCGAGAT
CTAATAGGAAAAAATGTAATATTTTTAGCTAGTTTGCATGATCCAGCTGT
AATGTTTGAGCAATTATCAGTGATCAATGCATTGCCTAGGTATTTAATAA
ATTCTCTTATTTTGTTTTTGCCGTTTTTTCCTTGTGGAACAATGGAGAAA
ATCGAAAAGGAAGGCCAGATCGCAACCGCAAAAACAGTTGCAAATTTATT
GTCTAATATTCCGATAACAAAAACTGGCCCGGCTGAAATTGTAATTTATG
ATATCCATTCTTTGCAGGAACAATTTTATTTCGGAGATTCTGTAATACCA
AGGTTGGAATCGTGTATTACTTTGTTGCACGAAAAAATTAGCATTCTCCA
ATCGAAAAATGAAAAAGTAGCAATTGTATTTCCAGATGATGGCGCAGCAA
AACGCTTTCATCGTTTCTTTTACACAAAAGATTTATCAACAGCAAATCGG
TCTGATAACGCTCACGAAGTAGATGACATCGTATTCTGTTCAAAGATTCG
TTATCAAGGACGTTTGATAAATACCATCACTCAGGAGATTTCCCCAAATT
TTCATCTTATAATTGTAGATGATCTCATTAATACGGGGAATACTATTCTT
AAAAGCGCAGAATTATGTGTCGAAAAAGGAGCAAACAAATTAAGTGTATT
TATTATTCATGCAATTTTTCCCAATGATTCTTGGAAGAAATTTCTGAAAC
CTATAAAAATCGGGAATATTGAAAAGAAATTGGAAAATTTTTGGATTTCA
GATTCTATTCCTCATGCGAATGAGATCTGTAAAAGCTCCGGGGAAATATT
CCAGCTGGTCTCTTTGGCCCAGTTGTCGAATGCTTTATTTTCAAAATGAT
AGCTGATGTTTTTAGTAATTATTTATATTCAAACTTTATTAATATATTTA
TTCGTTAAAATGAAATTTTATTGCCAG
back to top

protein sequence of SMED30032731-orf-1

>SMED30032731-orf-1 ID=SMED30032731-orf-1|Name=SMED30032731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MSALKNKHFWLLSHPTQFELAVKIESNSENIIFKDIIKWNKFENNFPNIF
ISNVRDLIGKNVIFLASLHDPAVMFEQLSVINALPRYLINSLILFLPFFP
CGTMEKIEKEGQIATAKTVANLLSNIPITKTGPAEIVIYDIHSLQEQFYF
GDSVIPRLESCITLLHEKISILQSKNEKVAIVFPDDGAAKRFHRFFYTKD
LSTANRSDNAHEVDDIVFCSKIRYQGRLINTITQEISPNFHLIIVDDLIN
TGNTILKSAELCVEKGANKLSVFIIHAIFPNDSWKKFLKPIKIGNIEKKL
ENFWISDSIPHANEICKSSGEIFQLVSLAQLSNALFSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005946Rib-P_diPkinase
IPR000836PRibTrfase_dom
IPR029057PRTase-like
Vocabulary: molecular function
TermDefinition
GO:0000287magnesium ion binding
GO:0004749ribose phosphate diphosphokinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
GO:0009165nucleotide biosynthetic process
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01400Pribosyltran_N_2coord: 9..127
e-value: 4.8E-6
score: 10.7
NoneNo IPR availablePANTHERPTHR10210:SF45RIBOSE-PHOSPHATE PYROPHOSPHOKINASE 3, CHLOROPLASTICcoord: 6..329
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 37..331
e-value: 2.1E-43
score: 150.4
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 160..326
e-value: 2.1E-43
score: 150.4
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 111..286
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 36..152
IPR005946Ribose-phosphate pyrophosphokinasePANTHERPTHR10210RIBOSE-PHOSPHATE DIPHOSPHOKINASE FAMILY MEMBERcoord: 6..329
IPR000836Phosphoribosyltransferase domainCDDcd06223PRTases_typeIcoord: 161..293
e-value: 1.43152E-11
score: 59.3316