YTH domain-containing protein

Overview
NameYTH domain-containing protein
Smed IDSMED30032727
Length (bp)1967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of YTH domain-containing protein (SMED30032727) t-SNE clustered cells

Violin plots show distribution of expression levels for YTH domain-containing protein (SMED30032727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of YTH domain-containing protein (SMED30032727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for YTH domain-containing protein (SMED30032727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032727SMESG000001953.1 dd_Smed_v4_5578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032727SMESG000001953.1 dd_Smed_v4_5578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of YTH domain-containing protein vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 202.986 bits (515), Expect = 6.025e-57
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  337 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 514          
BLAST of YTH domain-containing protein vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 203.756 bits (517), Expect = 9.394e-57
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. Ensembl Human
Match: YTHDF2 (YTH N6-methyladenosine RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:31675])

HSP 1 Score: 203.756 bits (517), Expect = 9.394e-57
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. Ensembl Human
Match: YTHDF3 (YTH N6-methyladenosine RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:26465])

HSP 1 Score: 198.364 bits (503), Expect = 2.937e-55
Identity = 97/179 (54.19%), Postives = 123/179 (68.72%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  348 KAINNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 517          
BLAST of YTH domain-containing protein vs. Ensembl Human
Match: YTHDF3 (YTH N6-methyladenosine RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:26465])

HSP 1 Score: 198.364 bits (503), Expect = 2.937e-55
Identity = 97/179 (54.19%), Postives = 123/179 (68.72%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  348 KAINNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 517          
BLAST of YTH domain-containing protein vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0084794)

HSP 1 Score: 203.371 bits (516), Expect = 3.717e-56
Identity = 101/213 (47.42%), Postives = 135/213 (63.38%), Query Frame = 3
Query:  921 LSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
              + D+ +S  +E +        D ++     +   N NP    +     ARFFVIKSYSEDD+HR+IKY +WCST  GN +LD A++E +      +E G + LFFSVNGSG F G+A+M++ V+   +   WSQ+KW GKFK+KW YVKDV N  LRHIR E NENK VTNSRD  EV P + GIE +++ H   H TS+FDDF HYE+++
Sbjct:  332 FEYRDENQSRPVEATSATEELPVDSQLVLDELKDKNNYNPKVLDLKKAGSARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERH------EEGGNIMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEV-PNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQ 537          
BLAST of YTH domain-containing protein vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0334507)

HSP 1 Score: 203.371 bits (516), Expect = 3.717e-56
Identity = 101/213 (47.42%), Postives = 135/213 (63.38%), Query Frame = 3
Query:  921 LSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
              + D+ +S  +E +        D ++     +   N NP    +     ARFFVIKSYSEDD+HR+IKY +WCST  GN +LD A++E +      +E G + LFFSVNGSG F G+A+M++ V+   +   WSQ+KW GKFK+KW YVKDV N  LRHIR E NENK VTNSRD  EV P + GIE +++ H   H TS+FDDF HYE+++
Sbjct:  332 FEYRDENQSRPVEATSATEELPVDSQLVLDELKDKNNYNPKVLDLKKAGSARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERH------EEGGNIMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEV-PNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQ 537          
BLAST of YTH domain-containing protein vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0084795)

HSP 1 Score: 202.986 bits (515), Expect = 4.605e-56
Identity = 101/213 (47.42%), Postives = 135/213 (63.38%), Query Frame = 3
Query:  921 LSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
              + D+ +S  +E +        D ++     +   N NP    +     ARFFVIKSYSEDD+HR+IKY +WCST  GN +LD A++E +      +E G + LFFSVNGSG F G+A+M++ V+   +   WSQ+KW GKFK+KW YVKDV N  LRHIR E NENK VTNSRD  EV P + GIE +++ H   H TS+FDDF HYE+++
Sbjct:  331 FEYRDENQSRPVEATSATEELPVDSQLVLDELKDKNNYNPKVLDLKKAGSARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERH------EEGGNIMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEV-PNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQ 536          
BLAST of YTH domain-containing protein vs. Ensembl Fly
Match: Ythdf (gene:FBgn0039261 transcript:FBtr0113281)

HSP 1 Score: 202.986 bits (515), Expect = 4.746e-56
Identity = 101/213 (47.42%), Postives = 135/213 (63.38%), Query Frame = 3
Query:  921 LSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
              + D+ +S  +E +        D ++     +   N NP    +     ARFFVIKSYSEDD+HR+IKY +WCST  GN +LD A++E +      +E G + LFFSVNGSG F G+A+M++ V+   +   WSQ+KW GKFK+KW YVKDV N  LRHIR E NENK VTNSRD  EV P + GIE +++ H   H TS+FDDF HYE+++
Sbjct:  326 FEYRDENQSRPVEATSATEELPVDSQLVLDELKDKNNYNPKVLDLKKAGSARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERH------EEGGNIMLFFSVNGSGHFCGMAQMMTPVDYNSTSSVWSQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKSVTNSRDTQEV-PNDKGIEVLQILHSYNHSTSIFDDFFHYEKKQ 531          
BLAST of YTH domain-containing protein vs. Ensembl Fly
Match: Ythdc1 (gene:FBgn0027616 transcript:FBtr0073078)

HSP 1 Score: 57.3806 bits (137), Expect = 3.610e-8
Identity = 43/148 (29.05%), Postives = 67/148 (45.27%), Query Frame = 3
Query: 1074 RFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFW------SQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVF 1499
            RFF+IKS + D++  +    VW +    +  L+ A++E  +V           L FSVN SG FAG A M +    +     W      S     G  ++ W   K++  +   H+ +  NE KPV   RD  E+ P + G E  ++F
Sbjct:  255 RFFLIKSNNSDNVQLSKNKSVWATLPQNDANLNQAFKEARNV----------LLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKALGGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEP-KIGGELCRLF 391          
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 203.371 bits (516), Expect = 1.553e-56
Identity = 101/198 (51.01%), Postives = 131/198 (66.16%), Query Frame = 3
Query:  975 LNCITDPEIKKCLSETMQ---NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            +  IT P     + E ++   N NP  F  +N    R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L     +N+ P  L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P +   + +K+    KH TS+FDDF HYE+R+
Sbjct:  389 MGGITVPAEPHPVLEKLRMVNNYNPKDFD-WNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSL-----ANKGP--LYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 202.986 bits (515), Expect = 1.793e-56
Identity = 101/198 (51.01%), Postives = 131/198 (66.16%), Query Frame = 3
Query:  975 LNCITDPEIKKCLSETMQ---NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            +  IT P     + E ++   N NP  F  +N    R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L     +N+ P  L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P +   + +K+    KH TS+FDDF HYE+R+
Sbjct:  388 MGGITVPAEPHPVLEKLRMVNNYNPKDFD-WNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSL-----ANKGP--LYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 576          
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2786])

HSP 1 Score: 200.29 bits (508), Expect = 1.599e-55
Identity = 95/175 (54.29%), Postives = 122/175 (69.71%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP +F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G W+Q+KW GKF + W +VKDV NS LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  418 NPKEFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAINGK-------GPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQ 583          
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2786])

HSP 1 Score: 200.29 bits (508), Expect = 1.599e-55
Identity = 95/175 (54.29%), Postives = 122/175 (69.71%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP +F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G W+Q+KW GKF + W +VKDV NS LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  418 NPKEFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAINGK-------GPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQ 583          
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Match: BX649452.1 (pep chromosome:GRCz11:CHR_ALT_CTG24_1_13:24286156:24288928:1 gene:ENSDARG00000114758.1 transcript:ENSDART00000185566.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX649452.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.889e-55
Identity = 96/181 (53.04%), Postives = 123/181 (67.96%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            + + N NP  F  + +   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD AY+ L+         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  405 KALNNYNPKDFD-WTLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAYRSLSAK-------GPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 576          
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Match: lmo7 (LIM domain 7 protein [Source:Xenbase;Acc:XB-GENE-949056])

HSP 1 Score: 201.445 bits (511), Expect = 1.097e-56
Identity = 99/195 (50.77%), Postives = 128/195 (65.64%), Query Frame = 3
Query:  975 LNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            L     P ++K  S  + N NP  F  F++   R F++KSYSEDD+HR+IKY VWCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV N  LRHIR E N+NKPVTNSRD  EV P E   + +++    KH TS+FDDF HYE+R+
Sbjct:  298 LTAEPHPVLEKLRS--VNNYNPKDFD-FSLKLGRVFIVKSYSEDDIHRSIKYNVWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMRSAVDYNTCAGVWSQDKWKGRFDVRWLFVKDVPNGQLRHIRLENNDNKPVTNSRDTQEV-PLEKARQVLRIIASYKHTTSIFDDFSHYEKRQ 481          
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:NCBI gene;Acc:395029])

HSP 1 Score: 198.749 bits (504), Expect = 1.470e-55
Identity = 96/175 (54.86%), Postives = 121/175 (69.14%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E     +K+    KH TS+FDDF HYE+R+
Sbjct:  334 NPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWLFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKLVLKIIATYKHTTSIFDDFSHYEKRQ 499          
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Match: adk (adenosine kinase [Source:Xenbase;Acc:XB-GENE-997225])

HSP 1 Score: 199.519 bits (506), Expect = 2.463e-55
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K   + + N NP  F  +++   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  381 PVLEKL--KAINNYNPKDFD-WSLKNGRVFIIKSYSEDDIHRSIKYTIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFDVKWVFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 558          
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Match: ythdf1 (YTH N(6)-methyladenosine RNA binding protein 1 [Source:NCBI gene;Acc:395029])

HSP 1 Score: 198.364 bits (503), Expect = 4.013e-55
Identity = 96/175 (54.86%), Postives = 121/175 (69.14%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E     +K+    KH TS+FDDF HYE+R+
Sbjct:  377 NPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWLFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKLVLKIIATYKHTTSIFDDFSHYEKRQ 542          
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Match: adk (adenosine kinase [Source:Xenbase;Acc:XB-GENE-997225])

HSP 1 Score: 197.593 bits (501), Expect = 1.092e-54
Identity = 98/187 (52.41%), Postives = 126/187 (67.38%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            P ++K   + + N NP  F  +++   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  380 PVLEKL--KAINNYNPKDFD-WSLKNGRVFIIKSYSEDDIHRSIKYTIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFDVKWVFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 555          
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Match: Ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2444233])

HSP 1 Score: 203.371 bits (516), Expect = 7.206e-57
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Match: Ythdf1 (YTH N6-methyladenosine RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1917431])

HSP 1 Score: 199.519 bits (506), Expect = 1.383e-55
Identity = 94/175 (53.71%), Postives = 122/175 (69.71%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP +F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD A++ ++         G ++L FSVNGSG F G+AEM S V+   S G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  378 NPKEFD-WNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSK-------GPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 543          
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Match: Ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1918850])

HSP 1 Score: 199.519 bits (506), Expect = 1.912e-55
Identity = 97/179 (54.19%), Postives = 123/179 (68.72%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  399 KAINNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 568          
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Match: Ythdf1 (YTH N6-methyladenosine RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1917431])

HSP 1 Score: 199.519 bits (506), Expect = 2.355e-55
Identity = 94/175 (53.71%), Postives = 122/175 (69.71%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP +F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD A++ ++         G ++L FSVNGSG F G+AEM S V+   S G WSQ+KW GKF +KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  405 NPKEFD-WNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMS-------SKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 570          
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Match: Ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:1918850])

HSP 1 Score: 199.134 bits (505), Expect = 3.293e-55
Identity = 97/179 (54.19%), Postives = 123/179 (68.72%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ LN         G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  410 KAINNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGK-------GPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 579          
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VCZ3|YTHD2_BOVIN (YTH domain-containing family protein 2 OS=Bos taurus OX=9913 GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 4.458e-56
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  388 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 565          
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y5A9|YTHD2_HUMAN (YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 4.511e-56
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91YT7|YTHD2_MOUSE (YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 5.041e-56
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R5D9|YTHD2_MACFA (YTH domain-containing family protein 2 OS=Macaca fascicularis OX=9541 GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 5.575e-56
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K  S  + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ +N         G ++L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  387 PVLEKLRS--INNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGK-------GPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQ 564          
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Match: sp|E7F1H9|YTHD2_DANRE (YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.173e-55
Identity = 101/198 (51.01%), Postives = 131/198 (66.16%), Query Frame = 3
Query:  975 LNCITDPEIKKCLSETMQ---NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            +  IT P     + E ++   N NP  F  +N    R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L     +N+ P  L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P +   + +K+    KH TS+FDDF HYE+R+
Sbjct:  389 MGGITVPAEPHPVLEKLRMVNNYNPKDFD-WNPKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSL-----ANKGP--LYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLDKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing protein vs. TrEMBL
Match: R7U9W0 (YTH domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_19575 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 6.917e-59
Identity = 96/168 (57.14%), Postives = 124/168 (73.81%), Query Frame = 3
Query: 1071 ARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMDPTL 1574
            ARFF+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+E        +  G +FLFFSVNGSG F G+A+M+S V+   S   W+Q+KW G+F++KW YVKDV NS LRHIR E NENKPVTNSRD  EV P E G + +++ H  +H TS+FDDF HYE+R+ D  +
Sbjct:    6 ARFFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRE-------REGKGPVFLFFSVNGSGHFCGMAQMMSAVDYNASSSVWAQDKWKGQFEVKWIYVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKGKQVLRILHQYRHTTSIFDDFSHYEKRQEDEPI 165          
BLAST of YTH domain-containing protein vs. TrEMBL
Match: T1FX57 (YTH domain-containing protein OS=Helobdella robusta OX=6412 GN=20213405 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 2.108e-58
Identity = 95/170 (55.88%), Postives = 126/170 (74.12%), Query Frame = 3
Query: 1056 FNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMD 1565
            +++  ARFFVIKSYSEDD+HR+IKY +WCST+ GN +LD+AY+E ++        G+++LFFSVNGSG F G+A M S ++ E+  G W+QNKW G+F +KW YVKDV NS LRHI+ E NENKPVTNSRD  EV P + G + + + H  +H TS+FDDF+HYE+R  D
Sbjct:    1 WDLTDARFFVIKSYSEDDIHRSIKYQIWCSTEYGNKRLDAAYRERDN-------KGKIYLFFSVNGSGHFCGVAMMTSALDYEKQAGVWAQNKWKGQFSVKWLYVKDVPNSQLRHIKLENNENKPVTNSRDTQEV-PADKGKQVLYIIHQYRHTTSLFDDFQHYEQRLAD 162          
BLAST of YTH domain-containing protein vs. TrEMBL
Match: F4W6C6 (YTH domain family protein 2 OS=Acromyrmex echinatior OX=103372 GN=G5I_01020 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.798e-58
Identity = 97/179 (54.19%), Postives = 130/179 (72.63%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMD 1565
            + NP++F       ARFFVIKSYSEDD+HR+IKY +WCST+ GN +LD AY+E      +++E   L+LFFSVNGSG F G+A+M+S V+ + +   WSQ+KW G+F+++W YVKDV N  LRHI+ E NENKPVTNSRDA EV P   G+  +++ H  +H TS+FDDF HYERR+ +
Sbjct:   15 DYNPVEFDQAAPG-ARFFVIKSYSEDDIHRSIKYEIWCSTEHGNKRLDQAYRE------ASREGAPLYLFFSVNGSGHFCGMAQMVSPVDYQSNSSVWSQDKWKGQFRVRWIYVKDVPNVQLRHIKLENNENKPVTNSRDAQEV-PHAKGVTVLRILHTYRHSTSIFDDFGHYERRQAE 185          
BLAST of YTH domain-containing protein vs. TrEMBL
Match: A0A232FEC6 (YTH domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_000400 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 3.917e-58
Identity = 97/177 (54.80%), Postives = 129/177 (72.88%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMD 1565
            NP++F       ARFFVIKSYSEDD+HR+IKY +WCST+ GN +LD AY+E +  S+       L+LFFSVNGSG F G+A+M+S V+ + +   WSQ+KW G+F+++W YVKDV N  LRHI+ E NENKPVTNSRDA EV P   G++ +++ H  +H TS+FDDF HYERR+ +
Sbjct:  121 NPVEFDQ-TAPGARFFVIKSYSEDDIHRSIKYEIWCSTEHGNKRLDQAYREASRDSAP------LYLFFSVNGSGHFCGMAQMVSSVDYKSNSSVWSQDKWKGQFRVRWIYVKDVPNVQLRHIKLENNENKPVTNSRDAQEV-PHAKGVQVLRILHSYRHSTSIFDDFGHYERRQAE 289          
BLAST of YTH domain-containing protein vs. TrEMBL
Match: A0A1X7UUI9 (YTH domain-containing protein OS=Amphimedon queenslandica OX=400682 GN=100638469 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.033e-57
Identity = 100/177 (56.50%), Postives = 127/177 (71.75%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            N NP + T+ N+N ARFFVIKSY+EDD+HR+IKY VWCST  GN +LD+A++E         + G ++L FSVNGSG F G+A+M+S V      G W+Q+KW G+F I+W YVKDV N+ LRHIR E NENKPVTNSRD  EV P + G   IK+ H  +H TS+FDDFEHYE+R+
Sbjct:  306 NYNPSELTI-NMNNARFFVIKSYAEDDVHRSIKYNVWCSTDHGNRRLDTAFKE------QKSKGGGVYLLFSVNGSGHFCGVAQMMSEVELSTDTGIWTQDKWKGRFDIRWIYVKDVPNNQLRHIRLENNENKPVTNSRDTQEV-PVDKGKLVIKIIHSYQHTTSIFDDFEHYEKRQ 474          
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 203.371 bits (516), Expect = 1.236e-56
Identity = 97/177 (54.80%), Postives = 121/177 (68.36%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            N NP  F  +N  + R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L          G L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  411 NYNPKDFD-WNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGK-------GPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKARQVLKIIASYKHTTSIFDDFSHYEKRQ 578          
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:103047574])

HSP 1 Score: 202.216 bits (513), Expect = 1.440e-56
Identity = 99/189 (52.38%), Postives = 128/189 (67.72%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            P ++K   + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L          G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  384 PVLEKL--KALNNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLG-------AKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQ 561          
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 202.986 bits (515), Expect = 1.485e-56
Identity = 97/177 (54.80%), Postives = 121/177 (68.36%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            N NP  F  +N  + R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L          G L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  410 NYNPKDFD-WNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGK-------GPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKARQVLKIIASYKHTTSIFDDFSHYEKRQ 577          
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:103025866])

HSP 1 Score: 201.445 bits (511), Expect = 2.360e-56
Identity = 97/177 (54.80%), Postives = 121/177 (68.36%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            N NP  F  +N  + R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L          G L+L FSVNGSG F G+AEM S V+     G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  372 NYNPKDFD-WNPKQGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSLGGK-------GPLYLLFSVNGSGHFCGVAEMRSPVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLEKARQVLKIIASYKHTTSIFDDFSHYEKRQ 539          
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:103047574])

HSP 1 Score: 199.519 bits (506), Expect = 2.562e-55
Identity = 98/187 (52.41%), Postives = 126/187 (67.38%), Query Frame = 3
Query:  993 PEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYER 1553
            P ++K   + + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+AY+ L          G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW +VKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+
Sbjct:  420 PVLEKL--KALNNYNPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLG-------AKGPLYLLFSVNGSGHFCGVAEMKSTVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATFKHTTSIFDDFAHYEK 595          
BLAST of YTH domain-containing protein vs. Ensembl Sea Lamprey
Match: ythdf2 (YTH N(6)-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:393220])

HSP 1 Score: 210.69 bits (535), Expect = 3.368e-60
Identity = 101/181 (55.80%), Postives = 127/181 (70.17%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            ++M + NP  F     N AR F+IKSYSEDD+HR+IKY +WCST+ GN +LDSAY+ L       Q  G ++L FSVNGSG F G+AEM+S V+ +   G WSQ+KW GKF++KW YVKDV N+ LRHIR E NENKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  406 KSMNSYNPRDFDCSPKN-ARVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAYRSL-------QSKGPIYLLFSVNGSGHFCGVAEMMSPVDYQTCAGVWSQDKWKGKFEVKWIYVKDVPNAQLRHIRLENNENKPVTNSRDTQEV-PLEKAKQVLKIIAAYKHTTSIFDDFGHYEKRQ 577          
BLAST of YTH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004771.1 (pep scaffold:Pmarinus_7.0:GL488602:889:1863:1 gene:ENSPMAG00000004347.1 transcript:ENSPMAT00000004771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 3.170e-57
Identity = 89/162 (54.94%), Postives = 116/162 (71.60%), Query Frame = 3
Query: 1074 RFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            R F+IKSYSEDD+HR++KY +WCST+ GN +LD AY+ +       Q  G ++L FSVNGSG F G+A+M S V+ +   G WSQ+KW GKF+++W +VKDV NS LRHIR E NENKPVTNSRD  EV P +   + ++V    +H TS+FDDF HYERR+
Sbjct:   11 RAFIIKSYSEDDVHRSVKYSIWCSTEHGNRRLDGAYRAM-------QGKGPVYLLFSVNGSGHFCGVAQMTSPVDYQTCAGVWSQDKWKGKFEVQWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLDKARQALRVIAAFRHTTSIFDDFAHYERRQ 164          
BLAST of YTH domain-containing protein vs. Ensembl Sea Lamprey
Match: YTHDC2 (YTH domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24721])

HSP 1 Score: 68.9366 bits (167), Expect = 2.384e-12
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 3
Query: 1074 RFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEV 1460
            R+FV+KS +  +L  + + G+W +T     KL+ A+     V          +L FSV GSG F G A M+S +  +E C  W      G F++ W Y+  +    ++H+ +  N+NK V  SRD  E+
Sbjct: 1290 RYFVMKSSNMRNLELSQQRGIWSTTPANEQKLNRAFLLCPVV----------YLVFSVQGSGHFQGYARMVSPIG-QERCQEWGSPALGGVFRVLWLYLGGIPFQQVQHLLNPWNDNKRVQISRDGQEL 1407          
BLAST of YTH domain-containing protein vs. Ensembl Yeast
Match: PHO92 (Posttranscriptional regulator of phosphate metabolism; facilitates PHO4 mRNA degradation by interacting with Pop2p; regulates PHO4 mRNA stability by binding to PHO4's 3'UTR in a phosphate-dependent manner; contains highly conserved YTH (YT521-B Homology) domain that exhibits RNA-binding activity; human homolog YTHDF2 can complement yeast null mutant [Source:SGD;Acc:S000002782])

HSP 1 Score: 112.464 bits (280), Expect = 7.410e-28
Identity = 63/161 (39.13%), Postives = 91/161 (56.52%), Query Frame = 3
Query: 1071 ARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGK-FKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYE 1550
            +RFFVIKS S   + R+   G+W ST  GN +L  AY++LN          ++FLFFS+N SG F G+AEM+S +  +     W   +  GK FK++W  V+D+ N +L+     +NE KP+T+SRD  E+ P+  GI  I +F     +   F D E YE
Sbjct:  155 SRFFVIKSSSLKHVKRSFYNGIWSSTHFGNKRLSEAYKKLN-------SGAKVFLFFSINTSGRFCGVAEMVSDLKMDLDTSIWEDEQKYGKAFKVRWVIVRDINNRSLKRFLIPSNEMKPITHSRDTQEI-PYSIGISIINLFKTQDSDIFSFLD-ETYE 306          
BLAST of YTH domain-containing protein vs. Ensembl Nematostella
Match: EDO40126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S845])

HSP 1 Score: 200.29 bits (508), Expect = 8.256e-61
Identity = 96/163 (58.90%), Postives = 122/163 (74.85%), Query Frame = 3
Query: 1071 ARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            ARFF+IKSYSEDD+HR+IKY VW ST+ GN +L+ A++E  H        G ++LFFSVNGSG F GIA+M+S VN +   G WSQ+KW GKF++KW+YVKDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +K+ H  KH+TS+FDDF HYE+R+
Sbjct:    5 ARFFIIKSYSEDDIHRSIKYCVWTSTEHGNRRLNEAFREQRH--------GPIYLFFSVNGSGHFCGIAQMMSEVNLDIETGIWSQDKWKGKFEVKWYYVKDVPNNALRHIRLENNDNKPVTNSRDTQEVPP-EKARQVVKIIHSYKHQTSIFDDFAHYEKRQ 158          
BLAST of YTH domain-containing protein vs. Ensembl Nematostella
Match: EDO40330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H4])

HSP 1 Score: 66.2402 bits (160), Expect = 3.420e-11
Identity = 45/144 (31.25%), Postives = 72/144 (50.00%), Query Frame = 3
Query: 1071 ARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFH 1502
            ARFF++K  ++ +L  ++  G+W +T     KL+ A++E   V           L FSV GSG F G+A M S +  E+S  F S +   G F ++W    ++      H+ +  N++K V  SRD  E+ P   G E  K++ 
Sbjct: 1272 ARFFIMKCNNQRNLDISMAKGIWATTIANEKKLNRAFKESKKV----------VLIFSVQGSGHFQGVAHMTSPIGREKSPEFGSSS-LGGVFTVEWITKANIPFQQAHHLVNPWNDHKKVQISRDGQELEP-SIGAELCKLWE 1403          
BLAST of YTH domain-containing protein vs. Ensembl Nematostella
Match: EDO39495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W8])

HSP 1 Score: 56.9954 bits (136), Expect = 7.803e-10
Identity = 44/148 (29.73%), Postives = 69/148 (46.62%), Query Frame = 3
Query: 1074 RFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFW------SQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVF 1499
            R+FV+KS + +++  +   GVW + +T   KL++A++   +V           L FSV  SG F G A ++      E    W      +     G FK++W    D+  S   H+R+  N+NK V   RD  EV P   G E  ++F
Sbjct:    1 RYFVMKSNNAENVLLSKAKGVWSTPRTNEKKLNAAFKRYKNV----------ILIFSVKESGKFQGFARLLGEAKHGEHFVPWVLPPGMNAKALGGVFKLEWLNRHDLWFSKCIHLRNPWNDNKEVKICRDGQEVEP-GVGEELCRLF 137          
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Match: ythdf3 (YTH N6-methyladenosine RNA binding protein 3 [Source:NCBI gene;Acc:101158487])

HSP 1 Score: 203.756 bits (517), Expect = 6.481e-57
Identity = 98/181 (54.14%), Postives = 124/181 (68.51%), Query Frame = 3
Query: 1017 ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
              + N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSAY+ L +        G L+L FSVNGSG F G+AEM S V+     G WSQ+KW GKF++KW ++KDV N+ LRHIR E N+NKPVTNSRD  EV P E   + +KV    KH TS+FDDF HYE+R+
Sbjct:  416 RVLNNYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAYRSLGNK-------GPLYLLFSVNGSGHFCGVAEMRSPVDYNAYAGVWSQDKWKGKFEVKWVFIKDVPNNQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKVIATFKHTTSIFDDFAHYEKRQ 587          
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Match: ythdf2 (YTH N6-methyladenosine RNA binding protein 2 [Source:NCBI gene;Acc:101163288])

HSP 1 Score: 203.756 bits (517), Expect = 1.041e-56
Identity = 97/177 (54.80%), Postives = 121/177 (68.36%), Query Frame = 3
Query: 1029 NINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            N NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD AY+ L          G L+L FSVNGSG F G+AEM S V+   S G WSQ+KW G+F ++W +VKDV NS LRHIR E NENKPVTNSRD  EV P +   + +K+    KH TS+FDDF HYE+R+
Sbjct:  432 NYNPKDFD-WNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDGAYRSLGGK-------GPLYLLFSVNGSGHFCGVAEMRSPVDYNTSAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEV-PLDKARQVLKIIAGYKHTTSIFDDFTHYEKRQ 599          
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Match: YTHDF1 (YTH domain-containing family protein 1-like [Source:NCBI gene;Acc:101163899])

HSP 1 Score: 199.519 bits (506), Expect = 2.471e-55
Identity = 95/175 (54.29%), Postives = 121/175 (69.14%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G W+Q+KW GKF + W +VKDV NS LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HYE+R+
Sbjct:  416 NPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAMNGK-------GPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATYKHTTSIFDDFSHYEKRQ 581          
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Match: ythdf1 (YTH domain-containing family protein 1 [Source:NCBI gene;Acc:101169361])

HSP 1 Score: 194.126 bits (492), Expect = 2.009e-53
Identity = 92/171 (53.80%), Postives = 117/171 (68.42%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHY 1547
            NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LD+A++ +N         G ++L FSVNGSG F G+AEM S V+   S G W+Q+KW GKF + W +VKDV NS LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HY
Sbjct:  418 NPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDTAFRAMNSK-------GPVYLLFSVNGSGHFCGVAEMRSPVDYSTSAGVWAQDKWKGKFDVNWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIAQYKHTTSIFDDFSHY 579          
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Match: YTHDF1 (YTH domain-containing family protein 1-like [Source:NCBI gene;Acc:101163899])

HSP 1 Score: 192.586 bits (488), Expect = 3.235e-53
Identity = 93/171 (54.39%), Postives = 117/171 (68.42%), Query Frame = 3
Query: 1035 NPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHY 1547
            NP  F  +N+   R F+IKSYSEDD+HR+IKY +WCST+ GN +LDSA++ +N         G ++L FSVNGSG F G+AEM S V+   S G W+Q+KW GKF + W +VKDV NS LRHIR E N+NKPVTNSRD  EV P E   + +K+    KH TS+FDDF HY
Sbjct:  375 NPKDFD-WNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRAMNGK-------GPVYLLFSVNGSGHFCGVAEMRSPVDYGTSAGVWAQDKWKGKFDVDWLFVKDVPNSQLRHIRLENNDNKPVTNSRDTQEV-PLEKAKQVLKIIATYKHTTSIFDDFSHY 536          
BLAST of YTH domain-containing protein vs. Planmine SMEST
Match: SMESG000001953.1 (SMESG000001953.1)

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 488/488 (100.00%), Postives = 488/488 (100.00%), Query Frame = 3
Query:  117 MNYSENHDSIRNSLENDNSKFYQNNKKSENSNRQTNNKHENKQSFSNSINMNNESQSRLNYYSSPFIPKQFQNINDSKALRPDISGDSTNRMPSDHDNQFYSQSANMNYDGFNSNMTNPCLYSPYDFVPLWYHLHNPGTHSNYWPLVANSNYYGLSNLGLSTGLEPNQNMFMVGKTSENSLNSSNTYNSAIXXXXXXXXXXXXXPQSKSQPISHVQNNRKNSQIMKANNSGNVNVEAPAPGIQWNYDVNNFNENFHKQLKNSNSTDFNLSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMDPTLNV 1580
            MNYSENHDSIRNSLENDNSKFYQNNKKSENSNRQTNNKHENKQSFSNSINMNNESQSRLNYYSSPFIPKQFQNINDSKALRPDISGDSTNRMPSDHDNQFYSQSANMNYDGFNSNMTNPCLYSPYDFVPLWYHLHNPGTHSNYWPLVANSNYYGLSNLGLSTGLEPNQNMFMVGKTSENSLNSSNTYNSAISNLESNFNSFSLNPQSKSQPISHVQNNRKNSQIMKANNSGNVNVEAPAPGIQWNYDVNNFNENFHKQLKNSNSTDFNLSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMDPTLNV
Sbjct:    1 MNYSENHDSIRNSLENDNSKFYQNNKKSENSNRQTNNKHENKQSFSNSINMNNESQSRLNYYSSPFIPKQFQNINDSKALRPDISGDSTNRMPSDHDNQFYSQSANMNYDGFNSNMTNPCLYSPYDFVPLWYHLHNPGTHSNYWPLVANSNYYGLSNLGLSTGLEPNQNMFMVGKTSENSLNSSNTYNSAISNLESNFNSFSLNPQSKSQPISHVQNNRKNSQIMKANNSGNVNVEAPAPGIQWNYDVNNFNENFHKQLKNSNSTDFNLSHSDQYKSENIEKSKEILNCITDPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREMDPTLNV 488          
BLAST of YTH domain-containing protein vs. Planmine SMEST
Match: SMESG000075874.1 (SMESG000075874.1)

HSP 1 Score: 199.519 bits (506), Expect = 1.089e-57
Identity = 93/190 (48.95%), Postives = 131/190 (68.95%), Query Frame = 3
Query:  990 DPEIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            D +I K L++  + INP      +VN+++F+VIKSY+ED +HR+IKYG WCST+ GN+ L++AY   N V S N   G ++LFFSVNGSG+F G+AEM S+ +T      W+ +KW+G F ++W YVKDV N  L+HI  E N+N+P+TNSRDA E+ P   G E +++ H   H +S+FDDF+ YE RE
Sbjct:  176 DTQIDKHLTDLYKRINPRSDFSLDVNKSKFYVIKSYTEDHVHRSIKYGQWCSTQRGNDILNTAY---NSVKSQN---GHVYLFFSVNGSGYFCGVAEMTSQFDTNNRVAHWNDDKWLGGFSVEWLYVKDVPNKYLKHIILEYNDNRPITNSRDATEIKPPTKGYETLRIIHEYHHNSSLFDDFDFYESRE 359          
BLAST of YTH domain-containing protein vs. Planmine SMEST
Match: SMESG000008619.1 (SMESG000008619.1)

HSP 1 Score: 201.83 bits (512), Expect = 1.625e-57
Identity = 92/168 (54.76%), Postives = 124/168 (73.81%), Query Frame = 3
Query: 1059 NVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERREM 1562
            N   A+FFVIKSYSEDD++R+IKY +WCST+TGN +LD+AY      S+    P  +FLFFSVNGSG F G+AEM+S V+++     W+Q KW G+F+++W +VKDV NS LRHIR E NENKPVTNSRD  E+ P E G + +K+  + K  +S++DDF+HYE+RE+
Sbjct:  297 NFKNAKFFVIKSYSEDDVYRSIKYQIWCSTETGNRRLDNAYS-----SAGGDMP--IFLFFSVNGSGHFCGVAEMVSPVDSKTRASVWAQGKWKGQFRVRWVFVKDVPNSQLRHIRIETNENKPVTNSRDVTEI-PLEKGRQVLKIIANFKATSSIYDDFDHYEQREL 456          
BLAST of YTH domain-containing protein vs. Planmine SMEST
Match: SMESG000003195.1 (SMESG000003195.1)

HSP 1 Score: 190.66 bits (483), Expect = 1.015e-53
Identity = 85/190 (44.74%), Postives = 127/190 (66.84%), Query Frame = 3
Query:  996 EIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGR--LFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            E+   L+E ++ INP+   +F  N +RFFVIKS++ED+++++I++GVWCST  GN+ L  AY+ +      N E  +  ++LFFSVNGSG+F G+AEM S ++   S   W+Q KW  +F + W Y+KDV NS LR I+ E+NEN+PVTN RD+ E+ P E GIE +K+ H+  ++T + +DF    R E
Sbjct:  249 ELDGLLNELVKKINPVDEFVFRSNNSRFFVIKSFTEDNIYQSIRHGVWCSTPVGNDALVQAYKHVKSREKPNDETTKAHVYLFFSVNGSGYFCGVAEMTSELHPPSSSSIWNQKKWQNQFSVDWLYIKDVPNSYLRQIKLESNENRPVTNCRDSTEILPLEKGIEVLKIIHNIHYDTCLLNDFNDIVRAE 438          
BLAST of YTH domain-containing protein vs. Planmine SMEST
Match: SMESG000003195.1 (SMESG000003195.1)

HSP 1 Score: 190.66 bits (483), Expect = 1.158e-53
Identity = 85/190 (44.74%), Postives = 127/190 (66.84%), Query Frame = 3
Query:  996 EIKKCLSETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNKLDSAYQELNHVSSSNQEPGR--LFLFFSVNGSGFFAGIAEMISRVNTEESCGFWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTPFENGIEFIKVFHHAKHETSVFDDFEHYERRE 1559
            E+   L+E ++ INP+   +F  N +RFFVIKS++ED+++++I++GVWCST  GN+ L  AY+ +      N E  +  ++LFFSVNGSG+F G+AEM S ++   S   W+Q KW  +F + W Y+KDV NS LR I+ E+NEN+PVTN RD+ E+ P E GIE +K+ H+  ++T + +DF    R E
Sbjct:  253 ELDGLLNELVKKINPVDEFVFRSNNSRFFVIKSFTEDNIYQSIRHGVWCSTPVGNDALVQAYKHVKSREKPNDETTKAHVYLFFSVNGSGYFCGVAEMTSELHPPSSSSIWNQKKWQNQFSVDWLYIKDVPNSYLRQIKLESNENRPVTNCRDSTEILPLEKGIEVLKIIHNIHYDTCLLNDFNDIVRAE 442          
The following BLAST results are available for this feature:
BLAST of YTH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YTHDF26.025e-5752.38YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF29.394e-5752.38YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF29.394e-5752.38YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF32.937e-5554.19YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
YTHDF32.937e-5554.19YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of YTH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ythdf3.717e-5647.42gene:FBgn0039261 transcript:FBtr0084794[more]
Ythdf3.717e-5647.42gene:FBgn0039261 transcript:FBtr0334507[more]
Ythdf4.605e-5647.42gene:FBgn0039261 transcript:FBtr0084795[more]
Ythdf4.746e-5647.42gene:FBgn0039261 transcript:FBtr0113281[more]
Ythdc13.610e-829.05gene:FBgn0027616 transcript:FBtr0073078[more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf21.553e-5651.01YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
ythdf21.793e-5651.01YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
ythdf11.599e-5554.29YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
ythdf11.599e-5554.29YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
BX649452.12.889e-5553.04pep chromosome:GRCz11:CHR_ALT_CTG24_1_13:24286156:... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo71.097e-5650.77LIM domain 7 protein [Source:Xenbase;Acc:XB-GENE-9... [more]
ythdf11.470e-5554.86YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
adk2.463e-5552.38adenosine kinase [Source:Xenbase;Acc:XB-GENE-99722... [more]
ythdf14.013e-5554.86YTH N(6)-methyladenosine RNA binding protein 1 [So... [more]
adk1.092e-5452.41adenosine kinase [Source:Xenbase;Acc:XB-GENE-99722... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ythdf27.206e-5752.38YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
Ythdf11.383e-5553.71YTH N6-methyladenosine RNA binding protein 1 [Sour... [more]
Ythdf31.912e-5554.19YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
Ythdf12.355e-5553.71YTH N6-methyladenosine RNA binding protein 1 [Sour... [more]
Ythdf33.293e-5554.19YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VCZ3|YTHD2_BOVIN4.458e-5652.38YTH domain-containing family protein 2 OS=Bos taur... [more]
sp|Q9Y5A9|YTHD2_HUMAN4.511e-5652.38YTH domain-containing family protein 2 OS=Homo sap... [more]
sp|Q91YT7|YTHD2_MOUSE5.041e-5652.38YTH domain-containing family protein 2 OS=Mus musc... [more]
sp|Q4R5D9|YTHD2_MACFA5.575e-5652.38YTH domain-containing family protein 2 OS=Macaca f... [more]
sp|E7F1H9|YTHD2_DANRE1.173e-5551.01YTH domain-containing family protein 2 OS=Danio re... [more]
back to top
BLAST of YTH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U9W06.917e-5957.14YTH domain-containing protein OS=Capitella teleta ... [more]
T1FX572.108e-5855.88YTH domain-containing protein OS=Helobdella robust... [more]
F4W6C63.798e-5854.19YTH domain family protein 2 OS=Acromyrmex echinati... [more]
A0A232FEC63.917e-5854.80YTH domain-containing protein OS=Trichomalopsis sa... [more]
A0A1X7UUI92.033e-5756.50YTH domain-containing protein OS=Amphimedon queens... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf21.236e-5654.80YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf31.440e-5652.38YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
ythdf21.485e-5654.80YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf22.360e-5654.80YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
ythdf32.562e-5552.41YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ythdf23.368e-6055.80YTH N(6)-methyladenosine RNA binding protein 2 [So... [more]
ENSPMAT00000004771.13.170e-5754.94pep scaffold:Pmarinus_7.0:GL488602:889:1863:1 gene... [more]
YTHDC22.384e-1231.78YTH domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO927.410e-2839.13Posttranscriptional regulator of phosphate metabol... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO401268.256e-6158.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403303.420e-1131.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394957.803e-1029.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of YTH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ythdf36.481e-5754.14YTH N6-methyladenosine RNA binding protein 3 [Sour... [more]
ythdf21.041e-5654.80YTH N6-methyladenosine RNA binding protein 2 [Sour... [more]
YTHDF12.471e-5554.29YTH domain-containing family protein 1-like [Sourc... [more]
ythdf12.009e-5353.80YTH domain-containing family protein 1 [Source:NCB... [more]
YTHDF13.235e-5354.39YTH domain-containing family protein 1-like [Sourc... [more]
back to top
BLAST of YTH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001953.10.000e+0100.00SMESG000001953.1[more]
SMESG000075874.11.089e-5748.95SMESG000075874.1[more]
SMESG000008619.11.625e-5754.76SMESG000008619.1[more]
SMESG000003195.11.015e-5344.74SMESG000003195.1[more]
SMESG000003195.11.158e-5344.74SMESG000003195.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032727 ID=SMED30032727|Name=YTH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1967bp
CTTGATTTCTTTATATAGTGATAATTTGATATTAAACAGATGATTTTCGT
TGTTTATTTAAATCTCGTAATTTCTTTTATTGTAATTTTGGAGTCTTTAC
CACATTCCTGAACTCAATGAACTACTCTGAAAACCATGACTCTATTAGAA
ATTCATTAGAAAATGATAATTCCAAATTCTATCAGAATAATAAAAAATCA
GAAAATTCTAATCGTCAAACAAATAATAAACACGAAAATAAGCAGTCATT
TTCGAATAGCATTAATATGAATAATGAAAGTCAAAGTCGGCTAAATTATT
ATTCAAGTCCATTTATACCGAAGCAGTTTCAGAATATAAACGACTCAAAA
GCTTTAAGACCAGATATTAGTGGTGATTCAACTAATCGTATGCCTTCAGA
TCACGACAACCAGTTCTATTCTCAATCTGCTAATATGAATTATGATGGAT
TCAACAGTAATATGACAAATCCATGTTTATATAGTCCTTATGATTTTGTT
CCACTTTGGTATCACTTACATAATCCTGGAACTCATTCAAATTATTGGCC
CTTAGTAGCGAATTCCAATTACTATGGGTTGTCAAACCTCGGTCTTTCAA
CTGGCTTAGAGCCTAATCAAAATATGTTTATGGTTGGGAAAACGTCTGAA
AATTCTCTTAATTCAAGTAATACTTACAATTCGGCAATTAGCAATCTTGA
ATCCAACTTCAATTCATTTTCATTAAATCCTCAGTCCAAAAGTCAGCCAA
TTTCACATGTTCAAAATAACAGGAAAAATTCCCAAATTATGAAGGCAAAC
AATTCAGGAAATGTCAACGTTGAAGCTCCAGCTCCAGGAATACAATGGAA
TTATGATGTAAATAATTTTAATGAAAACTTTCACAAACAATTAAAAAATT
CAAACTCGACGGATTTTAATTTATCGCATTCAGACCAATATAAATCTGAA
AATATTGAAAAATCTAAAGAAATTCTAAACTGTATTACTGACCCAGAAAT
TAAAAAATGTCTATCAGAAACTATGCAAAATATTAACCCTATACAGTTTA
CAATGTTCAATGTAAATAGAGCACGATTTTTTGTAATAAAATCATATTCA
GAGGATGATCTTCATCGAGCTATTAAATATGGAGTTTGGTGCAGTACAAA
AACGGGAAATAATAAATTAGACAGTGCTTATCAGGAATTAAATCACGTAT
CATCATCTAATCAAGAACCCGGCCGTTTATTTCTATTTTTCTCTGTAAAT
GGTTCAGGGTTTTTCGCTGGAATTGCCGAAATGATAAGTCGTGTCAATAC
GGAAGAAAGTTGCGGGTTTTGGAGTCAAAACAAATGGGTTGGTAAATTCA
AAATCAAGTGGCATTACGTTAAAGATGTCCGCAACAGTAACTTACGTCAC
ATTCGAAGTGAAGCTAATGAAAACAAACCGGTTACAAATAGTAGAGATGC
AGTTGAAGTGACTCCATTTGAAAATGGTATTGAATTTATCAAGGTTTTTC
ACCATGCTAAGCATGAAACATCAGTTTTCGATGATTTCGAGCATTATGAA
CGCAGAGAAATGGATCCAACTTTGAATGTATAGTAAAATTCTTTCAAAGA
CAAACGAGTGGTTGACTAAACAATTGAGAATATATAATATTTAATCATGA
TTGTGATTACTGAAATTTTTGTAGACTTTCGAAAACCAAGCTAAATCAGT
TCTTTACTTGTATTTGTGTTCCATCACAGTTTATAGTGATAGATAATATT
TAGTGTAATTATTGCTTGACATTTTACTATGTATTTTCAAATCTGTTTTG
CCTATAAATTTCTGAAACAGAAAAAAAATTATTTCATTTGTTATTGTGAT
TTTGTTTGTGCACGTAATCTTATTTTTGTTTATTATACACTTGTTATTGC
TGATATCTTTATTTTAAGTTGCAACATTATTATTATCAATGGCTGAGACA
TGTTATTTGAAATTCAC
back to top

protein sequence of SMED30032727-orf-1

>SMED30032727-orf-1 ID=SMED30032727-orf-1|Name=SMED30032727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MNYSENHDSIRNSLENDNSKFYQNNKKSENSNRQTNNKHENKQSFSNSIN
MNNESQSRLNYYSSPFIPKQFQNINDSKALRPDISGDSTNRMPSDHDNQF
YSQSANMNYDGFNSNMTNPCLYSPYDFVPLWYHLHNPGTHSNYWPLVANS
NYYGLSNLGLSTGLEPNQNMFMVGKTSENSLNSSNTYNSAISNLESNFNS
FSLNPQSKSQPISHVQNNRKNSQIMKANNSGNVNVEAPAPGIQWNYDVNN
FNENFHKQLKNSNSTDFNLSHSDQYKSENIEKSKEILNCITDPEIKKCLS
ETMQNINPIQFTMFNVNRARFFVIKSYSEDDLHRAIKYGVWCSTKTGNNK
LDSAYQELNHVSSSNQEPGRLFLFFSVNGSGFFAGIAEMISRVNTEESCG
FWSQNKWVGKFKIKWHYVKDVRNSNLRHIRSEANENKPVTNSRDAVEVTP
FENGIEFIKVFHHAKHETSVFDDFEHYERREMDPTLNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR007275YTH_domain
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.590.10coord: 295..476
e-value: 3.2E-56
score: 191.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..48
NoneNo IPR availablePANTHERPTHR12357:SF15METHYLATED RNA-BINDING PROTEIN 1coord: 26..482
NoneNo IPR availablePANTHERPTHR12357YTH YT521-B HOMOLOGY DOMAIN-CONTAININGcoord: 26..482
IPR007275YTH domainPFAMPF04146YTHcoord: 319..461
e-value: 4.0E-33
score: 114.7
IPR007275YTH domainPROSITEPS50882YTHcoord: 319..461
score: 41.763