DNA repair and recombination protein rad54-related

Overview
NameDNA repair and recombination protein rad54-related
Smed IDSMED30032723
Length (bp)2261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA repair and recombination protein rad54-related (SMED30032723) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA repair and recombination protein rad54-related (SMED30032723) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA repair and recombination protein rad54-related (SMED30032723) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA repair and recombination protein rad54-related (SMED30032723) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032723

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032723SMESG000049182.1 SmedASXL_016796SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032723SMESG000049182.1 SmedASXL_016796SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30032723SMESG000049182.1 Contig46282uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30032723SMESG000049182.1 Contig46282newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30032723SMESG000049182.1 dd_Smed_v4_15532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30032723SMESG000049182.1 Contig99_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30032723SMESG000049182.1 SmWIOct06_000769GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Match: RAD54L (RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 356/547 (65.08%), Postives = 430/547 (78.61%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP IDKAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KGSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+ RDA AS  D   G+ERL+EL  IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++ K  + LL+    K++ SSL +ITSLKK+CNHP L+YDK  E  DGF  +    P GYS     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF  +  +LSDTH++  C+RCVN+ Q RPPP  SDC SDL+ W HC DK  L D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEG---KMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQR 744          

HSP 2 Score: 86.2705 bits (212), Expect = 9.440e-17
Identity = 41/70 (58.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP E+DALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Match: RAD54L (RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 356/547 (65.08%), Postives = 430/547 (78.61%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP IDKAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KGSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+ RDA AS  D   G+ERL+EL  IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++ K  + LL+    K++ SSL +ITSLKK+CNHP L+YDK  E  DGF  +    P GYS     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF  +  +LSDTH++  C+RCVN+ Q RPPP  SDC SDL+ W HC DK  L D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEG---KMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQR 744          

HSP 2 Score: 86.2705 bits (212), Expect = 9.440e-17
Identity = 41/70 (58.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP E+DALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Match: RAD54L (RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 356/547 (65.08%), Postives = 430/547 (78.61%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP IDKAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KGSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+ RDA AS  D   G+ERL+EL  IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++ K  + LL+    K++ SSL +ITSLKK+CNHP L+YDK  E  DGF  +    P GYS     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF  +  +LSDTH++  C+RCVN+ Q RPPP  SDC SDL+ W HC DK  L D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEG---KMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQR 744          

HSP 2 Score: 86.2705 bits (212), Expect = 9.440e-17
Identity = 41/70 (58.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP E+DALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Match: RAD54L (RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826])

HSP 1 Score: 409.838 bits (1052), Expect = 1.578e-137
Identity = 208/357 (58.26%), Postives = 260/357 (72.83%), Query Frame = 2
Query:  998 CIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
            C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++ K  + LL+    K++ SSL +ITSLKK+CN                                      K  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF  +  +LSDTH++  C+RCVN+ Q RPPP  SDC SDL+ W HC DK  L D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:    2 CLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEG---KMSVSSLSSITSLKKLCNR-------------------------------------KMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQR 318          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Match: FSBP (fibrinogen silencer binding protein [Source:HGNC Symbol;Acc:HGNC:43653])

HSP 1 Score: 402.905 bits (1034), Expect = 2.640e-129
Identity = 237/569 (41.65%), Postives = 322/569 (56.59%), Query Frame = 2
Query:  434 QGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLAA-KISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERA-----------DGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKST-TNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQT-------------RPPPSESDCN-------SDLSQWYH-CADKKSLEDVALKSVWNNNIISFVF 2032
            QGP  GKP+I K +IV P SLV NW+ E  KWL + +I   T+D       D  +  F+      I Y VLIISYE        +      L++CDEGHRLKNS  +T  +LI L+ +KR++L+GTPIQNDL E+F+L+ FVN GILG+ S +++ YE PI+ SR+  AS E+   G+ R  EL  +    I+RRTQ ++ KYLP KIE VV C+  ++Q ++Y   +  +     L+   E      L  I +LKK+CNHP L+++ + E+              ++   S  P  Y+P  F  + SGK QVL  +LAVI      +KVV+VSNYTQTL+I + +CK  GY + RLDG   I +R +IVD FN  +S  F+F+LSSKAGG GLNLIG + L ++D DWNPA D QAM+RVWRDGQK    IYRL+ TGTIEEKI QRQ  K+ L   V+D  +  E   FS+ ELK LF+ +  +   TH+   C+     + T             +  P     N       S L QW H   D  +L D  L+ +  N  +SF+F
Sbjct:  162 QGPYGGKPVIKKTLIVTPGSLVNNWKKEFQKWLGSERIKIFTVDQ------DHKVEEFIKS----IFYSVLIISYEMLLRSLDQIKNIKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPIQNDLQEFFALIDFVNPGILGSLSSYRKIYEEPIILSREPSASEEEKELGERRAAELTCLTGLFILRRTQEIINKYLPPKIENVVFCRPGALQIELYRKLLNSQVVRFCLQGLLENSP--HLICIGALKKLCNHPCLLFNSIKEKECSSTCDKNEEKSLYKGLLSVFPADYNPLLFTEKESGKLQVLSKLLAVIHELRPTEKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQHSSFFIFLLSSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKYPVHIYRLLTTGTIEEKIYQRQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITEN--VSFIF 716          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Match: rad-54 (pep chromosome:WBcel235:I:9065087:9070264:1 gene:WBGene00004298.1 transcript:W06D4.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rad-54)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 314/542 (57.93%), Postives = 399/542 (73.62%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFE-RSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHC-ADKKSLEDVALKSVWNNNIISFVFWHRSH 2047
             RQ P   P + K++IV PSSLVKNW  EI KWL  +++ M +DSG ++ I   L  F+  S  R   PVLIISYETFRL+A +LH G VG+++CDEGHRLKNSEN TYQ+L  L   +RVL+SGTPIQNDLLEYFSLV+FVN G+LGTASEF++ +E  IL+ RDA+AS ED  KG+E+ +E++ +V  CIIRRT +LLTKYLPVK E ++CCK  ++QE +Y   ++ + ++ +++      A S+L  IT LKK+CNHP LVYD+  +  + F  +  S  PE ++P  F+P +SGK +VLD +LAV + TT+DK V+VSNYTQT+D    +CK RGY FVRLDGSMSIK+R+KIVD FNDP S  F F+LSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKK CFIYRL+ATG+IEEK+ QRQ HKKALSSCV+D  EDV RHFS  +L+ELF       SDTHEK KCKRC+  +++  PP+ +DC SDLS W+H     + + D  L++V+    ISFVF  +SH
Sbjct:  250 LRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGTRLNAMPVDSGKREQIIACLNSFMADSKMRCAIPVLIISYETFRLYANILHSGDVGIVICDEGHRLKNSENLTYQALSGLKCARRVLISGTPIQNDLLEYFSLVNFVNPGLLGTASEFRKKFENAILKGRDADASSEDQKKGEEKTKEMISLVEKCIIRRTSALLTKYLPVKYEHIICCKNSTLQETLYNKLIECEKQNRIVEKDKGATA-SALSFITHLKKLCNHPYLVYDEFQKPDNRFRNKCLSIFPESFNPKSFDPSFSGKMKVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPASTIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKMCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGEDVARHFSSEQLRELFKLESTVASDTHEKLKCKRCIQGVESVDPPTNADCASDLSNWFHSQKSARKVADNVLRAVFECGSISFVFHQKSH 790          

HSP 2 Score: 60.077 bits (144), Expect = 4.883e-9
Identity = 34/73 (46.58%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGR 437
            +++  I KLLS+ F +P+  Y   +LSG S  LG  R   K A+FDP+ E AL+LY+P  LS H QLK D  R
Sbjct:  121 DHDAMIAKLLSRKFSIPMEGY---MLSGRSLGLGGNRR--KCALFDPYHEGALILYAPEHLSEHAQLKEDKDR 188          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Match: Y116A8C.13 (pep chromosome:WBcel235:IV:16950066:16962868:1 gene:WBGene00013792.1 transcript:Y116A8C.13b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.13)

HSP 1 Score: 283.493 bits (724), Expect = 1.323e-84
Identity = 171/497 (34.41%), Postives = 276/497 (55.53%), Query Frame = 2
Query:  413 ATES*FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLL-TKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLP-----EGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEE--DVERHFSLSELKELFSY-NIGTLSDTHEKFKC 1876
            AT +  +   T + L +  +I+ PSSLV NW+ E +KW    +    + + + +DI    TY   QS  +++ P L+ISY+  + H + L      +++CDEGH+LKN + +  ++L+ L + +R++L+GTP+QND  E++SL+ FV   + G+  EF++                       +R ++L ++++ C++RRT + +  K+LP K E ++ C    +Q+ ++ +       D             +L  I   +++ NHP L+ D + E+ +   ++  + P     +G    R   + SGK   L  M+   +    +  V+VSNY +TLD+ + +C+   +  +RLDG   +  R K+V  FND      +F+LS+KAGG GLNLIGA+RL +FD DWNPAND+QAMAR+WRDGQ + C IYRLI TGTIEEK+LQRQ  K  L  CVID  E  D    F+  +LK++F++    T  +TH+  +C
Sbjct:  138 ATWALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRL-MRFPAVIALTANDIT---TY---QSTIKLM-PYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDGKLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEFRKMCS--------------------DRPEQLNELIDECMLRRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGD-------------ALSLIFFARQLANHPKLLLDNLREKTEK-SKAHKHSPLLLAFDGAHMPRGGVKESGKLTALVDMIKCFR-LLQECTVIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGL-GCVIDAIEVGDTIATFTDEDLKDIFTFTGSATECNTHDLCEC 590          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Match: Y116A8C.13 (pep chromosome:WBcel235:IV:16950065:16962868:1 gene:WBGene00013792.1 transcript:Y116A8C.13a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.13)

HSP 1 Score: 283.493 bits (724), Expect = 1.319e-83
Identity = 171/497 (34.41%), Postives = 276/497 (55.53%), Query Frame = 2
Query:  413 ATES*FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLT-KYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLP-----EGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEE--DVERHFSLSELKELFSY-NIGTLSDTHEKFKC 1876
            AT +  +   T + L +  +I+ PSSLV NW+ E +KW    +    + + + +DI    TY   QS  +++ P L+ISY+  + H + L      +++CDEGH+LKN + +  ++L+ L + +R++L+GTP+QND  E++SL+ FV   + G+  EF++                       +R ++L ++++ C++RRT + +  K+LP K E ++ C    +Q+ ++ +       D             +L  I   +++ NHP L+ D + E+ +   ++  + P     +G    R   + SGK   L  M+   +    +  V+VSNY +TLD+ + +C+   +  +RLDG   +  R K+V  FND      +F+LS+KAGG GLNLIGA+RL +FD DWNPAND+QAMAR+WRDGQ + C IYRLI TGTIEEK+LQRQ  K  L  CVID  E  D    F+  +LK++F++    T  +TH+  +C
Sbjct:  251 ATWALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRL-MRFPAVIALTANDI---TTY---QSTIKLM-PYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKNLDGKLRKTLLSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVFGSIVEFRKMC--------------------SDRPEQLNELIDECMLRRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGD-------------ALSLIFFARQLANHPKLLLDNLREKTEK-SKAHKHSPLLLAFDGAHMPRGGVKESGKLTALVDMIKCFR-LLQECTVIVSNYIETLDMIQQLCEYLNFKVLRLDGKTQVPDRQKLVRTFNDHRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGL-GCVIDAIEVGDTIATFTDEDLKDIFTFTGSATECNTHDLCEC 703          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 213.772 bits (543), Expect = 1.339e-57
Identity = 138/461 (29.93%), Postives = 233/461 (50.54%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKW---------LAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRIL----YPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVI 1771
             ++G T  P +    I AP S + NW+ E   W         +  + S M I       +D  +      S  + L    + VL+ SYE   +   +L       ++ DE HRLKN+++  +++L + N+Q RVLL+GTP+QN+L E F L++F+          F   +         +E S ED      ++++L  ++   ++RR ++ +   +P K E +V  +L ++Q++ Y++ + R    + +K  G +++   +  I  LKK CNHP L      E           L  G        + +GKF +L  ML  +K   + +V++ S  T  LDI E  C   GY + R+DGS++ ++R   +D++N P +++FVF+LS++AGG G+NL  A+ + ++D DWNP ND QA +R  R GQK +  IYR +  G++EE+I      K  L+  V+
Sbjct:  659 MKEGHTKGPFL----IAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIREHEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAPDRFNQLESFTAEF---------SEISKED------QIEKLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDALNVKNGGTQMSL--INIIMELKKCCNHPYLFMKACLEAPK--------LKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGH-RVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVV 1089          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 207.608 bits (527), Expect = 1.580e-55
Identity = 137/449 (30.51%), Postives = 239/449 (53.23%), Query Frame = 2
Query:  470 VIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDD---IDKNLTYFVN---QSGYR---------ILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVI 1771
            +I AP S + NW+ E  +W         +  G +D    + ++   FV    +SG +         + + VL+ SYET  +   +L     G ++ DE HRLKN+++  +++L +  +  RVLL+GTP+QN+L E F L++F+++        F   +          E S ED      ++++L  ++   ++RR ++ +   +P K E +V  +L ++Q++ Y++ + R    + +K  G +++   +  +  LKK CNHP L     +E     E++  Y  EG +  +     SGKF +L  ML  +K   + +V++ S  T+ LDI E +C+  GY + R+DGS+  + R   +D++N P +Q+F+F+LS++AGG G+NL  A+ + ++D DWNP ND QA +R  R GQK +  IYR +   ++EEKI      K  L+  V+
Sbjct:  655 LIAAPLSTIINWEREAEQWCPDFYVVTYV--GLRDARVVLREHEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLNFLSKERFNQLEAFTAEFN---------EISKED------QIEKLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDALNVKNGGTQMSL--MNVLMELKKCCNHPYLFV--KAELEAPKEKNGMY--EGTALIK----NSGKFVLLQKMLRKLKDGGH-RVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVV 1075          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Match: okr (gene:FBgn0002989 transcript:FBtr0077673)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 312/544 (57.35%), Postives = 415/544 (76.29%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNN-NIISFVFWHRSHEKQ 2056
             RQGP  KP I+KA++V+PSSLVKNW+ E  KWL  ++ C+ ++ G+K++  + L  F   S  R+  PVL+ISYETFR++A++L K  VG+++CDEGHRLKNS+N TYQ+L+ L  ++RVLLSGTPIQNDL EY+SLV+FVN  +LGTA+ FKR++E+ ILR ++ +++ ++  +  E+ QEL+ +V+ CIIRRT  +LTKYLPVK E V+C KL ++Q ++Y +F+K       L    EK + ++L  IT+LKKIC+HPDL+Y+K++ R  GFE S + LP  Y P   NP+ SGKF +LD MLA I++  NDKVV++SNYTQTLD+ E + + R Y FVRLDG+MSIKKR+K+VD+FNDP S  F+FMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKK C+IYRL+A+G+IEEKILQRQ HKK+LSS +ID  E  E+HF+  +LK+LF+++   LSDTH+K KCKRCV NIQ +PPP ++DC S LSQWYHC++ + L D  L   W +   +SFVF HRS  ++
Sbjct:  203 LRQGPECKPTINKAIVVSPSSLVKNWEKEFTKWLHGRLLCLPMEGGTKENTIRALEQFSMTSA-RLGTPVLLISYETFRIYAEILCKYEVGMVICDEGHRLKNSDNLTYQALMGLKTKRRVLLSGTPIQNDLTEYYSLVNFVNPEMLGTAAVFKRNFESAILRGQNTDSTEQERQRAIEKTQELIGLVDQCIIRRTNQILTKYLPVKFEMVICAKLTAIQLELYTNFLKSDQVRRSLADCNEKASLTALADITTLKKICSHPDLIYEKLTAREKGFENSQNVLPSNYKPKDLNPELSGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFNDPESDSFLFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEKHFTRDDLKDLFTFDANILSDTHDKLKCKRCVQNIQMKPPPEDTDCTSHLSQWYHCSNNRGLPDNILAQAWMDCKCVSFVFHHRSQAQE 745          

HSP 2 Score: 58.5362 bits (140), Expect = 2.143e-8
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  222 YEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            YE  I K+L++ FKVP+ NY      G  R+LG+RR  S+  + DP   +ALVL+ PP  + HE++ +D
Sbjct:   72 YELAIAKVLARKFKVPMDNYVPDY--GGKRVLGVRRCISRRPLHDPMACNALVLFHPPAYTEHERMGMD 138          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Match: Chd3 (gene:FBgn0023395 transcript:FBtr0074998)

HSP 1 Score: 224.557 bits (571), Expect = 5.074e-62
Identity = 150/486 (30.86%), Postives = 256/486 (52.67%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSG--SKDDIDKNLTYFV---------NQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQE-EDVERHFSLSELKELFSYNIGTL 1849
            F++G    P +    I  P S + NW+ E+  W A ++ C+T   G  ++  I K+   F          NQ+ Y+  + V++ SYE   + A  L       ++ DE HRL++++++ ++ L +  +  ++LL+GTP+QN+L E F L++F++ G       F+  +               D SK +E+++ L +I+   ++RR ++ + K +P K E +V  +L S+Q++ Y+  + +  K +  K  G     S L  +  L+K CNHP L +   +E A       +  P G        + SGK  +L  ML  +K+  N +V++ S  T+ L++ E   +  GY + R+DGS+    R K +D+FNDP S+ FVF+LS++AGG G+NL  A+ + +FD DWNP ND QA +R  R GQKK+  IYR +   ++EE+I+Q   HK  L+  V+      +  +FS  EL+++  +    L
Sbjct:  310 FKEGHCRGPFL----ISVPLSTLTNWERELELW-APELYCVTYVGGKTARAVIRKHEISFEEVTTKTMRENQTQYK--FNVMLTSYEFISVDAAFLGCIDWAALVVDEAHRLRSNQSKFFRILSKYRIGYKLLLTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFT--------------DVSK-EEQVKRLHEILEPHMLRRLKADVLKSMPPKSEFIVRVELSSMQKKFYKHILTKNFKALNQKGGGR--VCSLLNIMMDLRKCCNHPYL-FPSAAEEA-------TISPSGLYEMSSLTKASGKLDLLSKMLKQLKAD-NHRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGSIKGDLRQKAIDRFNDPVSEHFVFLLSTRAGGLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMGQKKKVMIYRFVTHNSVEERIMQVAKHKMMLTHLVVRPGMGGMTTNFSKDELEDILRFGTEDL 762          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Match: Hel89B (gene:FBgn0022787 transcript:FBtr0301715)

HSP 1 Score: 209.149 bits (531), Expect = 5.989e-56
Identity = 150/481 (31.19%), Postives = 241/481 (50.10%), Query Frame = 2
Query:  467 AVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYP-------VLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVA------FSS----LQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQ-----VLDCMLAV-IKSTTNDKVVVVSNYTQTLDICE---LMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            ++++ P +L  +W  E+ K+L         D GS   + + L Y+    G   L         +++ SY+T R              + DEGH +KN + ++ +++ +L    R++LSGTPIQN++LE +SL  F+  G LGT  +F + +  PIL SRDA++S ++   G   ++ L + V   ++RR +  + K LP KI Q + C+L  +Q ++YEDF  +  KD L K      A       S+     QA+  L+ +CNHP LV  +  E      +  S L    S +  + ++S K       +LDC + V  +S +  + ++       LDI E   L        ++RLDGS+   +R  IV+ FN   S + V +L++  GG GLNL GA+ +   + DWNP  D QAM R  R GQKK   +YRLI   ++EEKI+  Q  K   ++ V+  E    +    S++ +LF+
Sbjct: 1406 SLVICPPTLTGHWVYEVEKFL---------DQGS---VLRPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEE----LTKVTSQLALSNS-SLDDIEHSAKLPALKQLLLDCGIGVQTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSID-VLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSAENASLQTMGTSQIFDLFN 1868          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Match: Hel89B (gene:FBgn0022787 transcript:FBtr0344471)

HSP 1 Score: 209.149 bits (531), Expect = 5.989e-56
Identity = 150/481 (31.19%), Postives = 241/481 (50.10%), Query Frame = 2
Query:  467 AVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYP-------VLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVA------FSS----LQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQ-----VLDCMLAV-IKSTTNDKVVVVSNYTQTLDICE---LMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            ++++ P +L  +W  E+ K+L         D GS   + + L Y+    G   L         +++ SY+T R              + DEGH +KN + ++ +++ +L    R++LSGTPIQN++LE +SL  F+  G LGT  +F + +  PIL SRDA++S ++   G   ++ L + V   ++RR +  + K LP KI Q + C+L  +Q ++YEDF  +  KD L K      A       S+     QA+  L+ +CNHP LV  +  E      +  S L    S +  + ++S K       +LDC + V  +S +  + ++       LDI E   L        ++RLDGS+   +R  IV+ FN   S + V +L++  GG GLNL GA+ +   + DWNP  D QAM R  R GQKK   +YRLI   ++EEKI+  Q  K   ++ V+  E    +    S++ +LF+
Sbjct: 1406 SLVICPPTLTGHWVYEVEKFL---------DQGS---VLRPLHYYGFPVGREKLRSDIGTKCNLVVASYDTVRKDIDFFSGIHFNYCVLDEGHIIKNGKTKSSKAIKRLKANHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKQFVQRFSRPILSSRDAKSSAKEQEAGVLAMEALHRQVLPFLLRRVKEDVLKDLPPKITQDLLCELSPLQLRLYEDFSNKHLKDCLDKLGDSSSASMVTENLSAKTHIFQALRYLQNVCNHPKLVLRQSEE----LTKVTSQLALSNS-SLDDIEHSAKLPALKQLLLDCGIGVQTESVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNSDPSID-VLLLTTMVGGLGLNLTGADTVIFVEHDWNPMKDLQAMDRAHRIGQKKVVNVYRLITRNSLEEKIMGLQKFKILTANTVVSAENASLQTMGTSQIFDLFN 1868          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0331654)

HSP 1 Score: 207.608 bits (527), Expect = 2.270e-55
Identity = 146/439 (33.26%), Postives = 233/439 (53.08%), Query Frame = 2
Query:  476 VAPSSLVKNWQNEINKWLAAKISCMTI--DSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSS-LQAITSLKKICNHPDLV----YDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVI 1771
            V P S +  WQ E + W A  ++ +T   D  S++ I +    F  +S  R+ +  ++ +YE      + L       +L DE HRLKN ++  Y+SL + +   R+L++GTP+QN L E ++L+HF+      T   F+  +            + ED  KG  RL + L+     I+RR +  + K LP K+EQ++  ++ S+Q+Q Y+ ++  K  D L K  G++ + S+ L  +  LKK CNH  L+    ++ M  + D    +   L +G          SGK  +LD +L  +K T + +V++ S   + LD+     + R + F RLDGS+  + R + +D FN   SQ+F F+LS++AGG G+NL  A+ + +FD DWNP ND QA AR  R GQK Q  IYRL+   ++EE+I++R   K  L   VI
Sbjct:  583 VVPLSTMTAWQREFDLW-APDMNVVTYLGDIKSRELIQQYEWQF--ESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQH-----------GNAED--KGYTRLHQQLEPY---ILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYK-WILTKNFDALRK--GKRGSTSTFLNIVIELKKCCNHAALIRPSEFELMGLQQD---EALQTLLKG----------SGKLVLLDKLLCRLKETGH-RVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVI 985          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Match: rad54l (RAD54 like [Source:ZFIN;Acc:ZDB-GENE-040426-968])

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 355/547 (64.90%), Postives = 440/547 (80.44%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             +Q P  KP IDK ++V+PSSLV+NW NE+ KWL  ++  + ID GSKD+ID  L  F++Q G RI  P+LIISYETFRLHA+VLHKG VGL++CDEGHRLKNS+NQTY +L  +N Q+RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS +D + G+++LQEL+ IVN C+IRRT  +L+KYLPVKIEQVVCC L  +Q+++Y+ F+K +AK V     G K++ SSL +ITSLKK+CNHP L+Y+K     +GF+ +    P+ YS     PQ SGK  VLD +LA+ ++TT+DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAKIV++FN+P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++TGTIEEKILQRQAHKKALSSCV+D+E+DVERHFSL EL+ELFS N  TLSDTH++F+C+RCVN  Q RPPP +SDC  DLS W+HCADK+ L D  L++ W +  +SFVF  RSHE QR  V
Sbjct:  195 LKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKKRFEIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRRTSDILSKYLPVKIEQVVCCNLTPLQKELYKLFLK-QAKPVESLQTG-KISVSSLSSITSLKKLCNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELFSLNEKTLSDTHDRFRCRRCVNGRQVRPPPDDSDCTCDLSNWHHCADKRGLRDPVLQASW-DAAVSFVFHQRSHEDQRGVV 738          

HSP 2 Score: 85.5001 bits (210), Expect = 1.135e-16
Identity = 45/93 (48.39%), Postives = 64/93 (68.82%), Query Frame = 3
Query:  153 EYISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            +YIS YRK L    ++    + + +E  I+K+LSKPFK+PIPNY+G +     R LG+RR+G + A+ DPFE+ ALVLY PP +SAH+ +K D
Sbjct:   40 KYISPYRKPLTPLTNRPFCADGNEHEAFIRKILSKPFKIPIPNYTGVL---GLRALGLRRAGVRKALHDPFEDGALVLYEPPVISAHDLIKAD 129          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 395.201 bits (1014), Expect = 1.734e-124
Identity = 218/490 (44.49%), Postives = 302/490 (61.63%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADG-FERSFSYL-PEGYSPTRFNPQYSGKFQVLDCMLAVIKSTT-NDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCK 1879
             RQGP  G+P++ +A++V P SLVKNW  E NKWL   +IS  T+D       D  +  FV+      L  VL+ISYE        L +   G+++CDEGHRLKNS  +T  +L  L+  +R++L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PILRSR    + E+   G+ER  EL ++     +RRTQ ++ +YL  +IE  V CK   +Q ++Y   +  +     L  +        L  I +LKK+CNHP L+Y+ + E+AD  +E     L PE YS   F+   SGK  VL  +L+ I+     D+VV+VSN+TQTLD+ + +C   GY + RLDG   + +R KIVD FN P+S  F+ +LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TG+IEEKI QRQ  K+ LS  V+D  +  E   FS  EL++LF ++  T   TH+   CK
Sbjct:  356 LRQGPYGGRPVMKRALVVCPGSLVKNWAAEFNKWLGRERISVYTVDQ------DHRVEDFVSSP----LCSVLVISYEMLLRSVDRLKELDFGVLICDEGHRLKNSNIKTAGALTALSCTRRLILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPILRSRQPSCTEEERCIGEERAAELFRLTGVFTLRRTQEIINQYLSERIEWTVFCKPTELQIRLYRVLLSTRPIRACLSGSHTYTHSPHLVCINALKKLCNHPALLYNTLQEKADEMYEGEVKELFPEEYSTGAFSTADSGKLLVLTDLLSAIQHVNRTDRVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSFLLLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGSIEEKIYQRQVSKQGLSGTVVDLTKKAEHISFSAEELRDLFRFDPNTTCLTHDLLNCK 835          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 389.808 bits (1000), Expect = 4.330e-123
Identity = 219/497 (44.06%), Postives = 302/497 (60.76%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADG-FERSFSYL-PEGYSPTRFNPQYSGKFQVLDCMLAVIK--STTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNI 1897
             RQGP  G+P++ +A++V P SLVKNW  E NKWL   +IS  T+D       D  +  FV+      L  VL+ISYE        L +   G+++CDEGHRLKNS  +T  +L  L+  +R++L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PILRSR    + E+   G+ER  EL ++     +RRTQ ++ +YL  +IE  V CK   +Q ++Y   +  +     L  +        L  I +LKK+CNHP L+Y+ + E+AD  +E     L PE YS   F+   SGK  VL  +L+ I        +VV+VSN+TQTLD+ + +C   GY + RLDG   + +R KIVD FN P+S  F+ +LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TG+IEEKI QRQ  K+ LS  V+D  +  E   FS  EL++LF ++  T   TH+   CK  V  I
Sbjct:  297 LRQGPYGGRPVMKRALVVCPGSLVKNWAAEFNKWLGRERISVYTVDQ------DHRVEDFVSSP----LCSVLVISYEMLLRSVDRLKELDFGVLICDEGHRLKNSNIKTAGALTALSCTRRLILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPILRSRQPSCTEEERCIGEERAAELFRLTGVFTLRRTQEIINQYLSERIEWTVFCKPTELQIRLYRVLLSTRPIRACLSGSHTYTHSPHLVCINALKKLCNHPALLYNTLQEKADEMYEGEVKELFPEEYSTGAFSTADSGKLLVLTDLLSAIHFFCLFLPRVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSFLLLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGSIEEKIYQRQVSKQGLSGTVVDLTKKAEHISFSAEELRDLFRFDPNTTCLTHDLLNCKYMVKTI 783          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 382.104 bits (980), Expect = 1.188e-122
Identity = 213/492 (43.29%), Postives = 295/492 (59.96%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFS-----YLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCK 1879
             RQGP  G+P++ +A++V P SLVKNW  E NKWL   +IS  T+D       D  +  FV+      L  VL+ISYE        L +   G+++CDEGHRLKNS  +T  +L  L+  +R++L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PILRSR    + E+   G+ER  EL ++     +RRTQ ++ +YL  +IE  V CK   +Q ++Y   +  +     L  +        L  I +LKK+CNHP L+Y+ +  R    +  +        PE YS   F+   SGK  VL  +L     T  + VV+VSN+TQTLD+ + +C   GY + RLDG   + +R KIVD FN P+S  F+ +LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TG+IEEKI QRQ  K+ LS  V+D  +  E   FS  EL++LF ++  T   TH+   CK
Sbjct:   80 LRQGPYGGRPVMKRALVVCPGSLVKNWAAEFNKWLGRERISVYTVDQ------DHRVEDFVSSP----LCSVLVISYEMLLRSVDRLKELDFGVLICDEGHRLKNSNIKTAGALTALSCTRRLILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPILRSRQPSCTEEERCIGEERAAELFRLTGVFTLRRTQEIINQYLSERIEWTVFCKPTELQIRLYRVLLSTRPIRACLSGSHTYTHSPHLVCINALKKLCNHPALLYNTLQVRMCSADEMYEGEVKELFPEEYSTGAFSTADSGKLLVLTDLLTCKLHT--EMVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSFLLLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGSIEEKIYQRQVSKQGLSGTVVDLTKKAEHISFSAEELRDLFRFDPNTTCLTHDLLNCK 559          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 387.497 bits (994), Expect = 2.673e-122
Identity = 217/491 (44.20%), Postives = 300/491 (61.10%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADG-FERSFSYL-PEGYSPTRFNPQYSGKFQVLDCMLAVIK--STTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCK 1879
             RQGP  G+P++ +A++V P SLVKNW  E NKWL   +IS  T+D       D  +  FV+      L  VL+ISYE        L +   G+++CDEGHRLKNS  +T  +L  L+  +R++L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PILRSR    + E+   G+ER  EL ++     +RRTQ ++ +YL  +IE  V CK   +Q ++Y   +  +     L  +        L  I +LKK+CNHP L+Y+ + E+AD  +E     L PE YS   F+   SGK  VL  +L+ I        +VV+VSN+TQTLD+ + +C   GY + RLDG   + +R KIVD FN P+S  F+ +LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TG+IEEKI QRQ  K+ LS  V+D  +  E   FS  EL++LF ++  T   TH+   CK
Sbjct:  283 LRQGPYGGRPVMKRALVVCPGSLVKNWAAEFNKWLGRERISVYTVDQ------DHRVEDFVSSP----LCSVLVISYEMLLRSVDRLKELDFGVLICDEGHRLKNSNIKTAGALTALSCTRRLILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPILRSRQPSCTEEERCIGEERAAELFRLTGVFTLRRTQEIINQYLSERIEWTVFCKPTELQIRLYRVLLSTRPIRACLSGSHTYTHSPHLVCINALKKLCNHPALLYNTLQEKADEMYEGEVKELFPEEYSTGAFSTADSGKLLVLTDLLSAIHFFCLFLPRVVLVSNHTQTLDLLQDVCDQIGYKWCRLDGQTPVGQRQKIVDSFNSPHSSSFLLLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGSIEEKIYQRQVSKQGLSGTVVDLTKKAEHISFSAEELRDLFRFDPNTTCLTHDLLNCK 763          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:407922])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 361/544 (66.36%), Postives = 438/544 (80.51%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V PSSLVKNW NE++KWL  +I  + ID GSK++IDK L+ F+NQ G R+  P+LIISYETFRLHA+VLH+GSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS  D  KG+E+L+EL+ +VN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+K+      L     K++ SSL +ITSLKK+CNHP L+Y+K  E  +GF+ + +  P GYS     PQ SGK  VLD +LAV +ST++DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK CFIYRL++TGTIEEKI QRQ HKKALSSCV+D+E+DVERHFS+ ELKELF  N  T SDTH+KFKC+RCVN  Q RPPP  +DC SDLSQW HCADK+ L+D  L S W +  I+F F H+SHE+QR
Sbjct:  199 LRQSPDAKPEIEKAVVVCPSSLVKNWYNEVSKWLGGRIQPLAIDGGSKEEIDKKLSGFMNQHGMRVPSPILIISYETFRLHAEVLHRGSVGLVICDEGHRLKNSENQTYQALNSLNTVRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASAADRQKGEEKLKELIGVVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQSELYKLFLKQAKPAEDLNEG--KISVSSLSSITSLKKLCNHPSLIYEKCVEEEEGFQGALNLFPSGYSTKSVEPQLSGKMLVLDYILAVTRSTSSDKVVLVSNYTQTLDLFEKLCRTRRYLYVRLDGTMSIKKRAKIVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCFIYRLLSTGTIEEKIFQRQTHKKALSSCVVDEEQDVERHFSIGELKELFILNENTTSDTHDKFKCRRCVNGHQVRPPPDGTDCTSDLSQWNHCADKRGLQDPVLVSAW-DAAITFTFHHQSHEEQR 739          

HSP 2 Score: 85.1149 bits (209), Expect = 2.256e-16
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  156 YISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            +IS +RK L    ++    +   +E  I+ +LSKPFK+PIPNY G +     R LG++++G + A+ DPFEE ALVLY PP+LSAH+ LKVD
Sbjct:   45 WISPFRKPLAQLTNRPTCLDSKQHEAFIRSILSKPFKIPIPNYQGGL---GLRALGIKKAGIRRALHDPFEEGALVLYEPPQLSAHDLLKVD 133          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:407922])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 361/544 (66.36%), Postives = 438/544 (80.51%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V PSSLVKNW NE++KWL  +I  + ID GSK++IDK L+ F+NQ G R+  P+LIISYETFRLHA+VLH+GSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS  D  KG+E+L+EL+ +VN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+K+      L     K++ SSL +ITSLKK+CNHP L+Y+K  E  +GF+ + +  P GYS     PQ SGK  VLD +LAV +ST++DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK CFIYRL++TGTIEEKI QRQ HKKALSSCV+D+E+DVERHFS+ ELKELF  N  T SDTH+KFKC+RCVN  Q RPPP  +DC SDLSQW HCADK+ L+D  L S W +  I+F F H+SHE+QR
Sbjct:  202 LRQSPDAKPEIEKAVVVCPSSLVKNWYNEVSKWLGGRIQPLAIDGGSKEEIDKKLSGFMNQHGMRVPSPILIISYETFRLHAEVLHRGSVGLVICDEGHRLKNSENQTYQALNSLNTVRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASAADRQKGEEKLKELIGVVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQSELYKLFLKQAKPAEDLNEG--KISVSSLSSITSLKKLCNHPSLIYEKCVEEEEGFQGALNLFPSGYSTKSVEPQLSGKMLVLDYILAVTRSTSSDKVVLVSNYTQTLDLFEKLCRTRRYLYVRLDGTMSIKKRAKIVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCFIYRLLSTGTIEEKIFQRQTHKKALSSCVVDEEQDVERHFSIGELKELFILNENTTSDTHDKFKCRRCVNGHQVRPPPDGTDCTSDLSQWNHCADKRGLQDPVLVSAW-DAAITFTFHHQSHEEQR 742          

HSP 2 Score: 85.1149 bits (209), Expect = 2.024e-16
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  156 YISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            +IS +RK L    ++    +   +E  I+ +LSKPFK+PIPNY G +     R LG++++G + A+ DPFEE ALVLY PP+LSAH+ LKVD
Sbjct:   48 WISPFRKPLAQLTNRPTCLDSKQHEAFIRSILSKPFKIPIPNYQGGL---GLRALGIKKAGIRRALHDPFEEGALVLYEPPQLSAHDLLKVD 136          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:407922])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 362/575 (62.96%), Postives = 439/575 (76.35%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVN---------------------------C----CIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V PSSLVKNW NE++KWL  +I  + ID GSK++IDK L+ F+NQ G R+  P+LIISYETFRLHA+VLH+GSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS  D  KG+E+L+EL+ +VN                           C    C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+K+      L     K++ SSL +ITSLKK+CNHP L+Y+K  E  +GF+ + +  P GYS     PQ SGK  VLD +LAV +ST++DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK CFIYRL++TGTIEEKI QRQ HKKALSSCV+D+E+DVERHFS+ ELKELF  N  T SDTH+KFKC+RCVN  Q RPPP  +DC SDLSQW HCADK+ L+D  L S W +  I+F F H+SHE+QR
Sbjct:  199 LRQSPDAKPEIEKAVVVCPSSLVKNWYNEVSKWLGGRIQPLAIDGGSKEEIDKKLSGFMNQHGMRVPSPILIISYETFRLHAEVLHRGSVGLVICDEGHRLKNSENQTYQALNSLNTVRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASAADRQKGEEKLKELIGVVNRSVIAFFCLCHSFSPFRLANCLSRFDMCFTFRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQSELYKLFLKQAKPAEDLNEG--KISVSSLSSITSLKKLCNHPSLIYEKCVEEEEGFQGALNLFPSGYSTKSVEPQLSGKMLVLDYILAVTRSTSSDKVVLVSNYTQTLDLFEKLCRTRRYLYVRLDGTMSIKKRAKIVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCFIYRLLSTGTIEEKIFQRQTHKKALSSCVVDEEQDVERHFSIGELKELFILNENTTSDTHDKFKCRRCVNGHQVRPPPDGTDCTSDLSQWNHCADKRGLQDPVLVSAW-DAAITFTFHHQSHEEQR 770          

HSP 2 Score: 85.1149 bits (209), Expect = 2.316e-16
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  156 YISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            +IS +RK L    ++    +   +E  I+ +LSKPFK+PIPNY G +     R LG++++G + A+ DPFEE ALVLY PP+LSAH+ LKVD
Sbjct:   45 WISPFRKPLAQLTNRPTCLDSKQHEAFIRSILSKPFKIPIPNYQGGL---GLRALGIKKAGIRRALHDPFEEGALVLYEPPQLSAHDLLKVD 133          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:407922])

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 328/544 (60.29%), Postives = 404/544 (74.26%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V PSSLVKNW NE++KWL  +I  + ID GSK++IDK L+ F+NQ G R+  P+LIISYETFRLHA+VLH+GSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS  D  KG+E+L+EL+ +VN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+K+      L     K++ SSL +ITSLKK+CNHP L+Y+K  E  +GF+ + +  P GYS     PQ SGK  VLD +LAV +ST++DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK CFIYRL++             H    S C+  Q   V         K++F   I T      +FKC+RCVN  Q RPPP  +DC SDLSQW HCADK+ L+D  L S W +  I+F F H+SHE+QR
Sbjct:  202 LRQSPDAKPEIEKAVVVCPSSLVKNWYNEVSKWLGGRIQPLAIDGGSKEEIDKKLSGFMNQHGMRVPSPILIISYETFRLHAEVLHRGSVGLVICDEGHRLKNSENQTYQALNSLNTVRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASAADRQKGEEKLKELIGVVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQSELYKLFLKQAKPAEDLNEG--KISVSSLSSITSLKKLCNHPSLIYEKCVEEEEGFQGALNLFPSGYSTKSVEPQLSGKMLVLDYILAVTRSTSSDKVVLVSNYTQTLDLFEKLCRTRRYLYVRLDGTMSIKKRAKIVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCFIYRLLSVCC---------THHWHFSKCIAAQIIPVT--------KDIF---IET-----AQFKCRRCVNGHQVRPPPDGTDCTSDLSQWNHCADKRGLQDPVLVSAW-DAAITFTFHHQSHEEQR 717          

HSP 2 Score: 85.1149 bits (209), Expect = 1.800e-16
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  156 YISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            +IS +RK L    ++    +   +E  I+ +LSKPFK+PIPNY G +     R LG++++G + A+ DPFEE ALVLY PP+LSAH+ LKVD
Sbjct:   48 WISPFRKPLAQLTNRPTCLDSKQHEAFIRSILSKPFKIPIPNYQGGL---GLRALGIKKAGIRRALHDPFEEGALVLYEPPQLSAHDLLKVD 136          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:407922])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 299/447 (66.89%), Postives = 360/447 (80.54%), Query Frame = 2
Query:  719 GHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
            GHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS  D  KG+E+L+EL+ +VN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+K+      L     K++ SSL +ITSLKK+CNHP L+Y+K  E  +GF+ + +  P GYS     PQ SGK  VLD +LAV +ST++DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK CFIYRL++TGTIEEKI QRQ HKKALSSCV+D+E+DVERHFS+ ELKELF  N  T SDTH+KFKC+RCVN  Q RPPP  +DC SDLSQW HCADK+ L+D  L S W +  I+F F H+SHE+QR
Sbjct:   55 GHRLKNSENQTYQALNSLNTVRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASAADRQKGEEKLKELIGVVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQSELYKLFLKQAKPAEDLNEG--KISVSSLSSITSLKKLCNHPSLIYEKCVEEEEGFQGALNLFPSGYSTKSVEPQLSGKMLVLDYILAVTRSTSSDKVVLVSNYTQTLDLFEKLCRTRRYLYVRLDGTMSIKKRAKIVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCFIYRLLSTGTIEEKIFQRQTHKKALSSCVVDEEQDVERHFSIGELKELFILNENTTSDTHDKFKCRRCVNGHQVRPPPDGTDCTSDLSQWNHCADKRGLQDPVLVSAW-DAAITFTFHHQSHEEQR 498          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Match: Rad54l (RAD54 like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:894697])

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 352/546 (64.47%), Postives = 433/546 (79.30%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KG+VGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+SRDA AS  D  +G+ERL+EL+ IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++   +  L+    K++ SSL +ITSLKK+CNHP L+YDK     DGFE +    P GY+     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF+ +  +LSDTH++  C+RCVNN Q  PPP  SDC SDL+QW H  DK+ L+D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIEKAVVVSPSSLVKNWYNEVEKWLGGRIQPLAIDGGSKDEIDRKLEGFMNQRGARVPSPILIISYETFRLHVGVLKKGNVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKSRDAAASEADRQRGEERLRELIGIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPEEELREG--KMSVSSLSSITSLKKLCNHPALIYDKCVAEEDGFEGTLGIFPPGYNSKAVEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRVRRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKICYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFTLDEASLSDTHDRLHCRRCVNNRQVWPPPDGSDCTSDLAQWNHSTDKRGLQDEVLQAAWDASSTAITFVFHQRSHEEQR 744          

HSP 2 Score: 85.1149 bits (209), Expect = 1.446e-16
Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP EE ALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Match: Rad54l (RAD54 like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:894697])

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 352/546 (64.47%), Postives = 433/546 (79.30%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KG+VGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+SRDA AS  D  +G+ERL+EL+ IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++   +  L+    K++ SSL +ITSLKK+CNHP L+YDK     DGFE +    P GY+     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF+ +  +LSDTH++  C+RCVNN Q  PPP  SDC SDL+QW H  DK+ L+D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIEKAVVVSPSSLVKNWYNEVEKWLGGRIQPLAIDGGSKDEIDRKLEGFMNQRGARVPSPILIISYETFRLHVGVLKKGNVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKSRDAAASEADRQRGEERLRELIGIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPEEELREG--KMSVSSLSSITSLKKLCNHPALIYDKCVAEEDGFEGTLGIFPPGYNSKAVEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRVRRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKICYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFTLDEASLSDTHDRLHCRRCVNNRQVWPPPDGSDCTSDLAQWNHSTDKRGLQDEVLQAAWDASSTAITFVFHQRSHEEQR 744          

HSP 2 Score: 85.1149 bits (209), Expect = 1.446e-16
Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP EE ALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Match: Rad54b (RAD54 homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:3605986])

HSP 1 Score: 407.527 bits (1046), Expect = 1.913e-129
Identity = 241/568 (42.43%), Postives = 330/568 (58.10%), Query Frame = 2
Query:  434 QGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLAA-KISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKM------SERADGFERSF-----SYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKS-TTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCKRC--------------VNNIQTRPPPSESDC-----NSDLSQWYH-CADKKSLEDVALKSVWNNNIISFVF 2032
            QGP  GKP+I K +IV P SLV NW+ E  KWL + +I   T+D       D  +  F+N +     + VLIISYE        +     GL++CDEGHRLKNS  +T  +L  L+ +K V+L+GTP+QNDL E+F+LV FVN GILG+ S +++ YE PI+ SR+  +S E+   G+ R  EL ++    I+RRTQ ++ KYLP KIE VV C+  ++Q ++Y   ++ ++    L+   E  A   L  I +LKK+CNHP L++  +      S   +  ER+      S  P GY+P +F+ + SGK QVL  +LAVI      +KV++VSNY QTL++ E +CK  GY   RLDG   + +R  IVD FN  YS +F+F+LSSKAGG GLNLIG + L ++D DWNPA D QAM+RVWRDGQK    IYRL+ TGTIEEKI QRQ  K+ LS  V+D     E   FS+ ELK LF+ +  +   TH+   C+ C              V + Q +  P +SD       S L QW H   D  +L D  L+ +  N  +SF F
Sbjct:  324 QGPYGGKPVIKKTLIVTPGSLVNNWRKEFQKWLGSERIKIFTVDQ------DHKVEEFINST----FHSVLIISYEMLLRSLDQIKTIPFGLLICDEGHRLKNSSIKTTTALSSLSCEKTVILTGTPVQNDLQEFFALVDFVNPGILGSLSSYRKIYEEPIIISREPSSSKEERELGERRATELTRLTGRFILRRTQEVINKYLPPKIENVVFCRPGALQIELYRKLLRSQSVRFCLQGLLENSAH--LICIGALKKLCNHPCLLFSSVKGKEFSSSCEENEERNLCQGLLSVFPAGYNPLQFSEEESGKLQVLVKLLAVIHELRPTEKVILVSNYRQTLNVLEEVCKRHGYACARLDGQTPVSQRQHIVDSFNSKYSTDFIFLLSSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQRQISKQGLSGAVVDLTRSSEHIQFSVEELKNLFTLHESSHCVTHDLLDCE-CTGEKGHTEDASEGPVASRQCQFGPQKSDALRPLSMSQLKQWKHFSGDHLNLPDPFLERIREN--VSFFF 876          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Match: Ercc6 (excision repair cross-complementing rodent repair deficiency, complementation group 6 [Source:MGI Symbol;Acc:MGI:1100494])

HSP 1 Score: 239.58 bits (610), Expect = 5.189e-66
Identity = 154/466 (33.05%), Postives = 246/466 (52.79%), Query Frame = 2
Query:  458 IDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGS----KDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQS--LLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEG-YSPTRFNP-QYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            +   +IV P++++  W  E + W       +  ++GS    K+ + +++ Y          + VLI SY   RL    + +     ++ DEGH+++N       +  Q     R++LSG+P+QN+L E +SL  F+  G LGT   F   +  PI     + ASP       +    L   +N  ++RR +S   ++  LP K EQV+ C+L   Q ++Y++F+  KA   +L   GE   FS L A   L+KICNHPDL          G  ++ S  PE      +F   + SGK  V++ +L +       +V++ S   Q L I E+  +   Y ++++DG+ +I  R  ++ K+N+  S  FVF+L+++ GG G+NL GANR+ ++DPDWNP+ D QA  R WR GQKKQ  +YRL+  GTIEEKI  RQ  K+ L++ V+ ++    R F  ++L ELF+
Sbjct:  562 LGPTIIVCPTTVMHQWVKEFHTWWPPFRVAVLHETGSYTHKKERLIRDIVY---------CHGVLITSYSYIRLMQDDISRHDWHYVILDEGHKIRNPNAAVTLACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFIDSKAVYRILN--GENQIFSGLVA---LRKICNHPDLF--------SGGPKNASGPPEDELEEEQFGHWRRSGKMIVVESLLKIWHRQ-GQRVLLFSQSRQMLHILEVFLRAHKYSYLKMDGTTTIASRQPLITKYNEDTSI-FVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDLYELFT 1002          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Match: Chd2 (chromodomain helicase DNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2448567])

HSP 1 Score: 228.409 bits (581), Expect = 4.142e-62
Identity = 152/438 (34.70%), Postives = 231/438 (52.74%), Query Frame = 2
Query:  470 VIVAPSSLVKNWQNEINKWLAAKISCMTI--DSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKER-LQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLV-YDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVI 1771
            +IV P S + +WQ E   W A +I+ +    D  S++ I +    +++    R+ +  LI +YE       VL   +   +  DE HRLKN ++  Y++LI      R+L++GTP+QN L E +SL+HF    I+    EF   +E             EDH KG+E   Q L K++   ++RR +  + K LP K+EQ++  ++ ++Q+Q Y+  + R  K +     G    F  L  +  LKK CNH  L+   + SER  G E   S +           + SGK  +LD +L  ++   N +V++ S   + LDI       + Y F RLDGS+  + R + +D FN   S++F F+LS++AGG G+NL  A+ + +FD DWNP ND QA AR  R GQKKQ  IYRL+  GT+EE+I++R   K  L   VI
Sbjct:  537 LIVVPLSTLTSWQREFEIW-APEINVVVYIGDLMSRNTIRE--YEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHF----IMPEKFEFWEDFE-------------EDHGKGRENGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGF--LNIVMELKKCCNHCYLIKAPEDSERESGQEVLQSLI-----------RSSGKLILLDKLLTRLRERGN-RVLIFSQMVRMLDILAEYLTIKHYPFQRLDGSIKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGTVEEEIIERAKKKMVLDHLVI 940          
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Match: sp|O12944|RAD54_CHICK (DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus OX=9031 GN=RAD54L PE=2 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 363/544 (66.73%), Postives = 436/544 (80.15%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KA++V+PSSLV+NW NE+ KWL  +I  + ID GSK++ID+ L   +NQ G R+  P+LIISYETFRLHA+ L KGSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFKRH+E PIL+ RDA+AS  +  KG+ERL+EL+ IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y++F+K +AK V     G K+  SSL +ITSLKK+CNHP L+YDK  E  +GF  +    P GYS     PQ SGK  VLD +LAV KST+NDKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++TGTIEEKI QRQ HKKALSSCV+D+E+DVERHFSL ELKELFS N  T+SDTH+K KC+RCVN  Q RPPP  SDC SDLSQW HCADK+ L+D  LK+ W +  ++F F H SHE+QR
Sbjct:  190 LRQSPDCKPEIEKAMVVSPSSLVRNWYNEVEKWLGGRIQPLAIDGGSKEEIDRKLVGSMNQRGLRVPSPILIISYETFRLHAEALQKGSVGLVICDEGHRLKNSENQTYQALNSLNTPRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKRHFELPILKGRDADASEAERQKGEERLKELISIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQAELYKNFLK-QAKPVEELKEG-KINVSSLSSITSLKKLCNHPALIYDKCVEEEEGFMGALDLFPAGYSTKSVEPQLSGKMLVLDYILAVTKSTSNDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKVVERFNSPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKIFQRQTHKKALSSCVVDEEQDVERHFSLGELKELFSLNETTISDTHDKIKCRRCVNGHQVRPPPEGSDCTSDLSQWNHCADKRGLQDSVLKAAW-DAAVTFTFHHHSHEEQR 730          

HSP 2 Score: 84.3445 bits (207), Expect = 1.968e-15
Identity = 46/94 (48.94%), Postives = 60/94 (63.83%), Query Frame = 3
Query:  147 PYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            P   ++N R LC+ + +        +E  I+ +LSKPFKVPIPNY G       R LG++R+G +  + DPFEE ALVLY PP LSAHEQLK+D
Sbjct:   43 PLTQLTN-RPLCLDSSQ--------HEAFIRSILSKPFKVPIPNYKGPT---GLRALGIKRAGLRSPLHDPFEEGALVLYEPPLLSAHEQLKID 124          
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Match: sp|P70270|RAD54_MOUSE (DNA repair and recombination protein RAD54-like OS=Mus musculus OX=10090 GN=Rad54l PE=1 SV=2)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 352/546 (64.47%), Postives = 433/546 (79.30%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP I+KAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KG+VGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+SRDA AS  D  +G+ERL+EL+ IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++   +  L+    K++ SSL +ITSLKK+CNHP L+YDK     DGFE +    P GY+     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF+ +  +LSDTH++  C+RCVNN Q  PPP  SDC SDL+QW H  DK+ L+D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIEKAVVVSPSSLVKNWYNEVEKWLGGRIQPLAIDGGSKDEIDRKLEGFMNQRGARVPSPILIISYETFRLHVGVLKKGNVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKSRDAAASEADRQRGEERLRELIGIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPEEELREG--KMSVSSLSSITSLKKLCNHPALIYDKCVAEEDGFEGTLGIFPPGYNSKAVEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRVRRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKICYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFTLDEASLSDTHDRLHCRRCVNNRQVWPPPDGSDCTSDLAQWNHSTDKRGLQDEVLQAAWDASSTAITFVFHQRSHEEQR 744          

HSP 2 Score: 85.1149 bits (209), Expect = 1.012e-15
Identity = 41/70 (58.57%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP EE ALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Match: sp|Q92698|RAD54_HUMAN (DNA repair and recombination protein RAD54-like OS=Homo sapiens OX=9606 GN=RAD54L PE=1 SV=2)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 356/547 (65.08%), Postives = 430/547 (78.61%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN--NNIISFVFWHRSHEKQR 2059
             RQ P  KP IDKAV+V+PSSLVKNW NE+ KWL  +I  + ID GSKD+ID+ L  F+NQ G R+  P+LIISYETFRLH  VL KGSVGL++CDEGHRLKNSENQTYQ+L  LN  +RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+H+E PIL+ RDA AS  D   G+ERL+EL  IVN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q ++Y+ F+++ K  + LL+    K++ SSL +ITSLKK+CNHP L+YDK  E  DGF  +    P GYS     PQ SGK  VLD +LAV +S ++DKVV+VSNYTQTLD+ E +C+ R Y++VRLDG+MSIKKRAK+V++FN P S +FVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C+IYRL++ GTIEEKI QRQ+HKKALSSCV+D+E+DVERHFSL ELKELF  +  +LSDTH++  C+RCVN+ Q RPPP  SDC SDL+ W HC DK  L D  L++ W+  +  I+FVF  RSHE+QR
Sbjct:  201 LRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEG---KMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQR 744          

HSP 2 Score: 86.2705 bits (212), Expect = 4.533e-16
Identity = 41/70 (58.57%), Postives = 53/70 (75.71%), Query Frame = 3
Query:  219 NYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
             +E  I+ +LSKPFKVPIPNY G +    SR LG++R+G + A+ DP E+DALVLY PP LSAH+QLK+D
Sbjct:   69 QHEAFIRSILSKPFKVPIPNYQGPL---GSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLD 135          
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Match: sp|B4MX21|RAD54_DROWI (DNA repair and recombination protein RAD54-like OS=Drosophila willistoni OX=7260 GN=okr PE=3 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 313/541 (57.86%), Postives = 410/541 (75.79%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWN-NNIISFVFWHRSH 2047
             RQ    KP I KA+IV+PSSLVKNW+ E  KWL  ++ C+ ++ GSK+D  K L  F   +  R+  PVL+ISYETFR++A +L +  VG+++CDEGHRLKNS+N TYQ+L+ L  ++RVLLSGTPIQNDL EYFSLV+FVN  +LGTA++FKR++E PIL+ ++ ++S ++  +  E+ QEL+ +VN CIIRRT  +LTKYLPVK E V+C +L SVQ + Y +F+K       L    EK + ++L  IT+LKK+C+HPDL+Y+KM  R  GFE S + LP  Y P   NP+ SGKF +LD MLA I++ ++DKVV++SNYTQTLD+ E + + R Y FVRLDG+M+IKKR+K+VD+FNDP +  F+FMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKK C+IYRL+A+G+IEEKILQRQ HKK+LSS +ID  E  E+HF+  +LK+LFS++   LSDTHEK KCKRC+ N+QT+PPP ++DC S LSQW+HC++ + L D  L   W  +  +SFVF HRS 
Sbjct:  200 LRQSCECKPTITKAIIVSPSSLVKNWEKEFTKWLHGRMHCLAMEGGSKEDTIKALEQFSMNTSTRLGTPVLLISYETFRIYANILCQNEVGMVICDEGHRLKNSDNLTYQALMGLKTKRRVLLSGTPIQNDLTEYFSLVNFVNPEMLGTAADFKRNFENPILKGQNTDSSDKERERALEKTQELIGLVNQCIIRRTNQILTKYLPVKFEMVICVRLTSVQLEFYTNFLKSDKVRRSLADCNEKASLTALADITTLKKLCSHPDLIYEKMLARDKGFENSQNILPTNYKPKDLNPELSGKFMLLDFMLATIRANSDDKVVLISNYTQTLDLFEQLARKRKYTFVRLDGTMTIKKRSKVVDRFNDPENDCFLFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEKHFTRDDLKDLFSFDSKILSDTHEKLKCKRCLQNVQTKPPPEDTDCTSHLSQWFHCSNNRGLPDDILAQAWTASKCVSFVFHHRSQ 740          

HSP 2 Score: 64.6994 bits (156), Expect = 2.274e-9
Identity = 34/69 (49.28%), Postives = 46/69 (66.67%), Query Frame = 3
Query:  222 YEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            YE  I K+L++ FKVPI NY      G +R LG+RRS  + A+ DP   +ALVLY+PP  S HE++K+D
Sbjct:   69 YELAIAKVLARKFKVPIANYVPDY--GGNRCLGVRRSIVRRALHDPQACNALVLYTPPVYSEHERMKMD 135          
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Match: sp|O76460|RAD54_DROME (DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster OX=7227 GN=okr PE=1 SV=1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 312/544 (57.35%), Postives = 415/544 (76.29%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNN-NIISFVFWHRSHEKQ 2056
             RQGP  KP I+KA++V+PSSLVKNW+ E  KWL  ++ C+ ++ G+K++  + L  F   S  R+  PVL+ISYETFR++A++L K  VG+++CDEGHRLKNS+N TYQ+L+ L  ++RVLLSGTPIQNDL EY+SLV+FVN  +LGTA+ FKR++E+ ILR ++ +++ ++  +  E+ QEL+ +V+ CIIRRT  +LTKYLPVK E V+C KL ++Q ++Y +F+K       L    EK + ++L  IT+LKKIC+HPDL+Y+K++ R  GFE S + LP  Y P   NP+ SGKF +LD MLA I++  NDKVV++SNYTQTLD+ E + + R Y FVRLDG+MSIKKR+K+VD+FNDP S  F+FMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKK C+IYRL+A+G+IEEKILQRQ HKK+LSS +ID  E  E+HF+  +LK+LF+++   LSDTH+K KCKRCV NIQ +PPP ++DC S LSQWYHC++ + L D  L   W +   +SFVF HRS  ++
Sbjct:  203 LRQGPECKPTINKAIVVSPSSLVKNWEKEFTKWLHGRLLCLPMEGGTKENTIRALEQFSMTSA-RLGTPVLLISYETFRIYAEILCKYEVGMVICDEGHRLKNSDNLTYQALMGLKTKRRVLLSGTPIQNDLTEYYSLVNFVNPEMLGTAAVFKRNFESAILRGQNTDSTEQERQRAIEKTQELIGLVDQCIIRRTNQILTKYLPVKFEMVICAKLTAIQLELYTNFLKSDQVRRSLADCNEKASLTALADITTLKKICSHPDLIYEKLTAREKGFENSQNVLPSNYKPKDLNPELSGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFNDPESDSFLFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEKHFTRDDLKDLFTFDANILSDTHDKLKCKRCVQNIQMKPPPEDTDCTSHLSQWYHCSNNRGLPDNILAQAWMDCKCVSFVFHHRSQAQE 745          

HSP 2 Score: 58.5362 bits (140), Expect = 2.148e-7
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  222 YEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            YE  I K+L++ FKVP+ NY      G  R+LG+RR  S+  + DP   +ALVL+ PP  + HE++ +D
Sbjct:   72 YELAIAKVLARKFKVPMDNYVPDY--GGKRVLGVRRCISRRPLHDPMACNALVLFHPPAYTEHERMGMD 138          
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Match: A0A5K4EYX4 (DNA repair and recombination protein rad54-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 393/557 (70.56%), Postives = 461/557 (82.76%), Query Frame = 2
Query:  431 RQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLK---AAG---EKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGY-----SPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
            RQGP GKP+IDKAVIV PSSL++NW NE  KWL  KI  + IDSGSK+DID  L  F++Q+G RI  P+LIISYETFRLHA VLHKGSVGL+LCDEGHRLKNSENQTYQ+L+QL   +RVLLSGTPIQNDLLEYFSLVHFVN G+LGTASEF+RHYE PILR RDA+A+ ED  KG+E LQELL IV  CIIRRTQ+LLTKYLPVKIEQVVCC L+  Q ++Y DF+KR A++V LK   A G   +K++ SSL +IT LKK+CNHPDLVY+KM+   DGF  + SY P  Y     S     P+ SGKFQVLDC+LAVIKSTT+DKVV++SNYTQTLD+ E +C  RGY FVRLDG+M+IKKRAK+V++FNDP S++FVFMLSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKKQC+IYRLI+TGTIEEK+LQRQAHKKALSSCV+DQ+E+VERHFSL +L+ELF Y+  TLSDTH++FKC+RCVN++Q +P P  +DCNSD SQW HC  KK+L D  LK+ W+   ISFVFWH SHE+QR TV
Sbjct:  151 RQGPEGKPIIDKAVIVTPSSLLRNWYNEFQKWLHGKIHPLAIDSGSKEDIDSKLAGFLSQAGRRIPSPILIISYETFRLHASVLHKGSVGLVLCDEGHRLKNSENQTYQALVQLKCPRRVLLSGTPIQNDLLEYFSLVHFVNMGLLGTASEFRRHYEIPILRGRDADATNEDQKKGEEILQELLGIVTRCIIRRTQALLTKYLPVKIEQVVCCNLVGSQREVYSDFVKRMAREVSLKMNIADGLRNDKLSISSLASITHLKKLCNHPDLVYEKMTANTDGFHNALSYFPANYQGSLESNASVKPELSGKFQVLDCLLAVIKSTTSDKVVLISNYTQTLDLFERLCLQRGYNFVRLDGTMTIKKRAKVVEQFNDPTSRDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKQCYIYRLISTGTIEEKMLQRQAHKKALSSCVVDQQEEVERHFSLDDLRELFMYHSETLSDTHDRFKCRRCVNSVQIKPAPEGTDCNSDFSQWNHCYTKKALNDPVLKATWDTGCISFVFWHYSHEEQRKTV 707          

HSP 2 Score: 91.6633 bits (226), Expect = 2.523e-15
Identity = 51/101 (50.50%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  120 KRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLK 422
            K  PD  HSP ++ +++RK     D       D +E  I+ +LSKPF+VPI NY+GS  S   R+LG+RR+ S++A+ DPFEEDALVLYSPPE++AH+ LK
Sbjct:   34 KNVPD--HSPVDF-NSFRKSSPACDYS-----DPHENLIRNILSKPFRVPIINYNGS--SNDVRVLGVRRNTSRVALHDPFEEDALVLYSPPEVTAHDALK 124          
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Match: A0A3Q0KUE8 (DNA repair and recombination protein rad54-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 393/558 (70.43%), Postives = 461/558 (82.62%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLK---AAG---EKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGY-----SPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             RQGP GKP+IDKAVIV PSSL++NW NE  KWL  KI  + IDSGSK+DID  L  F++Q+G RI  P+LIISYETFRLHA VLHKGSVGL+LCDEGHRLKNSENQTYQ+L+QL   +RVLLSGTPIQNDLLEYFSLVHFVN G+LGTASEF+RHYE PILR RDA+A+ ED  KG+E LQELL IV  CIIRRTQ+LLTKYLPVKIEQVVCC L+  Q ++Y DF+KR A++V LK   A G   +K++ SSL +IT LKK+CNHPDLVY+KM+   DGF  + SY P  Y     S     P+ SGKFQVLDC+LAVIKSTT+DKVV++SNYTQTLD+ E +C  RGY FVRLDG+M+IKKRAK+V++FNDP S++FVFMLSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKKQC+IYRLI+TGTIEEK+LQRQAHKKALSSCV+DQ+E+VERHFSL +L+ELF Y+  TLSDTH++FKC+RCVN++Q +P P  +DCNSD SQW HC  KK+L D  LK+ W+   ISFVFWH SHE+QR TV
Sbjct:  192 LRQGPEGKPIIDKAVIVTPSSLLRNWYNEFQKWLHGKIHPLAIDSGSKEDIDSKLAGFLSQAGRRIPSPILIISYETFRLHASVLHKGSVGLVLCDEGHRLKNSENQTYQALVQLKCPRRVLLSGTPIQNDLLEYFSLVHFVNMGLLGTASEFRRHYEIPILRGRDADATNEDQKKGEEILQELLGIVTRCIIRRTQALLTKYLPVKIEQVVCCNLVGSQREVYSDFVKRMAREVSLKMNIADGLRNDKLSISSLASITHLKKLCNHPDLVYEKMTANTDGFHNALSYFPANYQGSLESNASVKPELSGKFQVLDCLLAVIKSTTSDKVVLISNYTQTLDLFERLCLQRGYNFVRLDGTMTIKKRAKVVEQFNDPTSRDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKQCYIYRLISTGTIEEKMLQRQAHKKALSSCVVDQQEEVERHFSLDDLRELFMYHSETLSDTHDRFKCRRCVNSVQIKPAPEGTDCNSDFSQWNHCYTKKALNDPVLKATWDTGCISFVFWHYSHEEQRKTV 749          

HSP 2 Score: 91.6633 bits (226), Expect = 2.756e-15
Identity = 51/101 (50.50%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  120 KRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLK 422
            K  PD  HSP ++ +++RK     D       D +E  I+ +LSKPF+VPI NY+GS  S   R+LG+RR+ S++A+ DPFEEDALVLYSPPE++AH+ LK
Sbjct:   34 KNVPD--HSPVDF-NSFRKSSPACDYS-----DPHENLIRNILSKPFRVPIINYNGS--SNDVRVLGVRRNTSRVALHDPFEEDALVLYSPPEVTAHDALK 124          
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Match: G7Y737 (DNA repair and recombination protein RAD54 and RAD54-like protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_102015 PE=4 SV=1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 385/556 (69.24%), Postives = 460/556 (82.73%), Query Frame = 2
Query:  431 RQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAA-----GEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGY-----SPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
            RQGP  KP IDKAV+V PSSLVKNW NE  KWL  K+  +TIDSGSK++ID  L  F+ QSG RI  PVLIISYETFRLH+  LHKG VGL+LCDEGHRLKNSENQTYQ+L+QLN  +RVLLSGTPIQNDLLEYFSLVHFVN G+LGTA++F+R +ETPILR RDA+A+ +D  KG+E+LQELL IVN CIIRRTQ+LLTKYLPVKIEQVVCC L  VQ  +Y DF+ RKA++V  + +     G  ++ SSL +IT LKK+CNHPDLVYDKM+  +DGF  + ++ P  Y     S   F P  SGKFQVLD +LA+I++TT+DKVV++SNYTQTLD+ E +C  RGY++VRLDG+M+IKKRAKIV++FNDP SQEF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK+C+IYRLI+TGTIEEK+LQRQAHKKALSSCV+DQ+E+VERHFSL +LKELF++++ T+SDTH++FKC+RCVN +Q +PPP +SDCN DLS W HC  KK L DV LKS W+   ISFVFWH SHE+QR+TV
Sbjct:   59 RQGPEAKPTIDKAVVVTPSSLVKNWYNEFYKWLQGKVHPLTIDSGSKEEIDTKLATFLAQSGRRIPTPVLIISYETFRLHSSALHKGEVGLVLCDEGHRLKNSENQTYQALVQLNCSRRVLLSGTPIQNDLLEYFSLVHFVNMGLLGTAADFRRRFETPILRGRDADATEDDQKKGEEKLQELLVIVNRCIIRRTQALLTKYLPVKIEQVVCCSLTPVQRMVYADFVARKAREVAARLSMDSGRGPALSVSSLASITHLKKLCNHPDLVYDKMATNSDGFVDALAHFPRDYRGSLESNAPFRPDLSGKFQVLDYLLALIRTTTSDKVVLISNYTQTLDLFERLCSMRGYIYVRLDGTMTIKKRAKIVERFNDPTSQEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKECYIYRLISTGTIEEKMLQRQAHKKALSSCVVDQQEEVERHFSLGDLKELFTFHVDTVSDTHDRFKCRRCVNQVQIKPPPPDSDCNCDLSMWNHCYGKKLLNDVILKSTWDTGAISFVFWHYSHEQQRLTV 614          
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Match: A0A095A0M5 (DNA repair and recombination protein RAD54-like OS=Schistosoma haematobium OX=6185 GN=MS3_09244 PE=4 SV=1)

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 389/555 (70.09%), Postives = 455/555 (81.98%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLK---AAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGY-----SPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             RQGP GKP+IDKAV+V PSSL++NW NE  KWL  KI  + IDSGSK+DID  L  F++Q+G RI  P+LIISYETFRLHA VLHKGSVGL+LCDEGHRLKNSENQTYQ+L+QL   +RVLLSGTPIQNDLLEYFSLVHFVN G+LGTASEF+R YE PILR RDA+A+ ED  KG+E LQELL IV  CIIRRTQ+LLTKYLPVKIEQVVCC L+  Q ++Y DF+KR  ++V LK   A   +   SSL +IT LKK+CNHPDLVY+KM    DGF  + SY P  Y     S     P+ SGKFQVLDC+LAVIKSTT+DKVV++SNYTQTLD+ E +C  RGY FVRLDG+M+IKKRAK+V++FNDP S++FVFMLSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKKQC+IYRLI+TGTIEEK+LQRQAHKKALSSCV+DQ+E+VERHFSL +L+ELF Y+  TLSDTH++FKC+RCVN++Q +PPP  +DCNSD SQW HC  KK+L D  LK+ W+   ISFVFWH SHE+QR TV
Sbjct:  197 LRQGPEGKPIIDKAVVVTPSSLLRNWYNEFQKWLHGKIHPLAIDSGSKEDIDSKLAGFLSQTGRRIPSPILIISYETFRLHASVLHKGSVGLVLCDEGHRLKNSENQTYQALVQLKCPRRVLLSGTPIQNDLLEYFSLVHFVNMGLLGTASEFRRRYEIPILRGRDADATKEDQKKGEEILQELLGIVTRCIIRRTQALLTKYLPVKIEQVVCCNLVGSQREVYSDFVKRMVREVSLKMNSADDSRNDKSSLASITHLKKLCNHPDLVYEKMVANTDGFHNALSYFPANYQGSLESNASVKPELSGKFQVLDCLLAVIKSTTSDKVVLISNYTQTLDLFERLCLQRGYNFVRLDGTMTIKKRAKVVEQFNDPTSRDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKQCYIYRLISTGTIEEKMLQRQAHKKALSSCVVDQQEEVERHFSLDDLRELFMYHFETLSDTHDRFKCRRCVNSVQIKPPPEGTDCNSDFSQWNHCYTKKTLNDSVLKATWDTGCISFVFWHYSHEEQRKTV 751          

HSP 2 Score: 90.1225 bits (222), Expect = 8.882e-15
Identity = 41/69 (59.42%), Postives = 57/69 (82.61%), Query Frame = 3
Query:  216 DNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLK 422
            +++E  I+ +LSKPF+VPI NY+GS  S   R+LG+RR+ S++A+ DPFEEDALVLYSPPE++AH+ LK
Sbjct:   63 NSHENLIRNILSKPFRVPIINYNGS--SSDVRVLGVRRNTSRVALHDPFEEDALVLYSPPEVTAHDALK 129          
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Match: A0A4S2LPM0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005740 PE=4 SV=1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 382/557 (68.58%), Postives = 459/557 (82.41%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAA-----GEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGY-----SPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             RQGP  KP IDKAV+V PSSLVKNW NE  KWL  K+  +TIDSGSK++ID  L  F+ QSG RI  P+LIISYETFRLH+  LHKG VGL+LCDEGHRLKNSENQTYQ+L+QL+  +RVLLSGTPIQNDLLEYFSLVHFVN G+LGTA++F+R +ETPILR RDA+A+ +D  KG+E+LQELL IVN CIIRRTQ+LLTKYLPVKIEQVVCC L   Q  +Y DF+ RKA++V  + +     G  ++ SSL +IT LKK+CNHPDLVYDKM+  +DGF  + ++ P  Y     S   F P  SGKFQVLD +LA+I++TT+DKVV++SNYTQTLD+ E +C  RGY++VRLDG+M+IKKRAKIV++FNDP SQEF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK+C+IYRLI+TGTIEEK+LQRQAHKKALSSCV+DQ+E+VERHFSL +LKELF++++ T+SDTH++FKC+RCVN +Q +PPP +SDCN DLS W HC  KK L DV LKS W+   ISFVFWH SHE+QR+TV
Sbjct:  195 LRQGPEAKPTIDKAVVVTPSSLVKNWYNEFYKWLQGKVHPLTIDSGSKEEIDTKLVTFLAQSGRRIPTPILIISYETFRLHSSALHKGEVGLVLCDEGHRLKNSENQTYQALVQLSCSRRVLLSGTPIQNDLLEYFSLVHFVNMGLLGTAADFRRRFETPILRGRDADATEDDQKKGEEKLQELLVIVNRCIIRRTQALLTKYLPVKIEQVVCCSLTPGQRMVYADFVARKAREVAARLSMDSGRGPALSVSSLASITHLKKLCNHPDLVYDKMATNSDGFVDALTHFPRDYRGSLESNAPFRPDLSGKFQVLDYLLALIRTTTSDKVVLISNYTQTLDLFERLCSMRGYIYVRLDGTMTIKKRAKIVERFNDPTSQEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKECYIYRLISTGTIEEKMLQRQAHKKALSSCVVDQQEEVERHFSLGDLKELFTFHVDTVSDTHDRFKCRRCVNQVQIKPPPPDSDCNCDLSMWNHCYGKKLLNDVILKSTWDTGAISFVFWHYSHEQQRLTV 751          

HSP 2 Score: 94.3597 bits (233), Expect = 4.225e-16
Identity = 55/137 (40.15%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   18 MKRSQAPSKSGETAFXXXXXXXXXXXXXGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            M+RS APS+ G +A +         +   K+     K  + +SP  ++S +RK     ++ N      +E+ I+ +L+KPFKVPI NY GS +   S+ LG+RRS S++A+ DP+EE AL+L++PPELSAH+ LK D
Sbjct:    1 MRRSLAPSQIG-SATAVLSQSLQPPNKISKQTPATLKTLDGYSPSAFLSPFRKPLSELNQSN-----THEDLIRSILAKPFKVPIVNYHGSCI--ESKALGLRRSTSRVALHDPYEEGALILFTPPELSAHDALKQD 129          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:103036648])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 356/547 (65.08%), Postives = 445/547 (81.35%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             RQ P  KP IDKA++V+PSSLV+NW NE+ KWL  ++  + ID GSK++ID+ L  F++Q G R+  P+LIISYETFRLHA+VLHKG VGL++CDEGHRLKNS+NQTYQ+L  +N Q+RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+AS +D + G+E+L+EL+ +VN C+IRRT  +L+KYLPVKIEQVVCC+L  +Q+++Y+ F+K +AK V     G K++ SSL +ITSLKK+CNHP L+Y+K  +  +GF  +    P GYS     PQ SGK  VLD +LA+ +STT+DKVV+VSNYTQTLD+ E +C+TR Y++VRLDG+MSIKKRAKIV++FN P + EF+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQ+K C+IYRL++TGTIEEKILQRQAHKKALSSCV+D+E+DVERHFSL EL+ELF+ N  TLSDTH++F+C+RCVN  Q RPPP +SDC SDLS W HCADK+ L+D  L++ W +  +SFVF  RSHE QR  V
Sbjct:  199 LRQSPDFKPEIDKAIVVSPSSLVRNWYNEVAKWLGGRVQPVAIDGGSKEEIDRKLVNFISQHGLRVPTPILIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYQALNAMNAQRRVLISGTPIQNDLLEYFSLVHFVNAGILGTAQEFKKRFEIPILKGRDADASDKDRAVGEEKLKELISVVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQKELYKLFLK-QAKPVESLQQG-KISVSSLSSITSLKKLCNHPSLIYEKCVDGEEGFAGAMDLFPPGYSTKGVEPQLSGKMLVLDYILAMTRSTTSDKVVLVSNYTQTLDLFEKLCRTRKYLYVRLDGTMSIKKRAKIVERFNSPSNPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQRKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELFALNEETLSDTHDRFRCRRCVNGRQVRPPPEDSDCTSDLSCWQHCADKRGLKDPVLQASW-DAAVSFVFHQRSHEDQRGAV 742          

HSP 2 Score: 88.1965 bits (217), Expect = 1.372e-17
Identity = 48/105 (45.71%), Postives = 69/105 (65.71%), Query Frame = 3
Query:  117 IKRKPDEVHSPYEYISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            IKRK +E      YIS YRK L    ++    + + +E  I+ +LS+PFK+PIPNY+GS+     R LG++++G + A+ DPFE+ ALVLY PP +SAHE +K D
Sbjct:   32 IKRKKEEKDCRESYISPYRKPLTQLTNRPVCVDSNAHEAFIRSILSRPFKIPIPNYTGSL---GLRALGLKKAGVRKALHDPFEDGALVLYEPPVISAHELIKAD 133          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 421.394 bits (1082), Expect = 7.196e-137
Identity = 225/527 (42.69%), Postives = 318/527 (60.34%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYD--KMSERADGFERSFS--YLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTT-NDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLED 1984
             +QGP  G+P++ + ++V P SLVKNW  E NKWL   +I   T+D     + D  +  FV+      L PV++ISYE      +VL K    L++CDEGHRLKNS  +T  +L  L  ++RV+L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PI+RSR    + E+   G+ER  EL ++ +   +RRTQ ++  +LP ++E  V C+   +Q Q+Y   +  ++    +           L  I +LKK+CNHP L+Y+  K+SE  D    S S    PE YS   F    SGK  VL  +L  I+     DKVV+VSNYTQTLD+ + +C   GY + RLDG   + +R +IV+ FN PYS  F+F+LSSKAGG GLNL+GA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TGTIEEK+ QRQ  K+ LS  V+D ++  E   FS  EL++LF++   T   TH+   C + ++  +  PPP     N +LS    C  ++ L D
Sbjct:  142 LKQGPYGGQPVLKRGLVVCPGSLVKNWGAEFNKWLGRERIRVFTVDQVCGSEGDNRVQDFVSSP----LCPVMVISYEMLLRSIEVLKKLDFSLVICDEGHRLKNSNIKTAGALTALACERRVILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPIIRSRQPTCTEEERFMGEERAAELARLTSVFTLRRTQEIINHFLPERLEWTVFCRPTELQVQLYNALLSTRSVRACISGYNTLNHSPHLACINALKKLCNHPGLLYNTVKVSESTDELYESLSVKLFPEAYSTGNFCTADSGKLLVLTDLLKAIQHVNRTDKVVLVSNYTQTLDLLQDLCTHLGYTWCRLDGQTPVAQRQRIVESFNSPYSSHFLFLLSSKAGGVGLNLVGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGTIEEKMYQRQVSKQGLSGTVVDLKKKAEHISFSAEELRDLFTFEANTSCLTHDLPHCLQELSK-EIPPPPLRKRVNFELS---FCLRRQKLTD 660          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 410.609 bits (1054), Expect = 1.518e-131
Identity = 220/521 (42.23%), Postives = 310/521 (59.50%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFS--YLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKS 1975
             +QGP  G+P++ + ++V P SLVKNW  E NKWL   +I   T+D       D  +  FV+      L PV++ISYE      +VL K    L++CDEGHRLKNS  +T  +L  L  ++RV+L+GTP+QNDL E++S++ FVN GILGT++ +++ YE PI+RSR    + E+   G+ER  EL ++ +   +RRTQ ++  +LP ++E  V C+   +Q Q+Y   +  ++    +           L  I +LKK+CNHP L+Y+ + E  D    S S    PE YS   F    SGK  VL  +L  I+      VV+VSNYTQTLD+ + +C   GY + RLDG   + +R +IV+ FN PYS  F+F+LSSKAGG GLNL+GA+ L ++D DWNPAND QAMARVWRDGQKK   IYR + TGTIEEK+ QRQ  K+ LS  V+D ++  E   FS  EL++LF++   T   TH+   C+ C+ +  T  P S +       Q  H A+  S
Sbjct:  260 LKQGPYGGQPVLKRGLVVCPGSLVKNWGAEFNKWLGRERIRVFTVDQ------DNRVQDFVSSP----LCPVMVISYEMLLRSIEVLKKLDFSLVICDEGHRLKNSNIKTAGALTALACERRVILTGTPVQNDLQEFYSIIEFVNPGILGTSAAYRKIYEEPIIRSRQPTCTEEERFMGEERAAELARLTSVFTLRRTQEIINHFLPERLEWTVFCRPTELQVQLYNALLSTRSVRACISGYNTLNHSPHLACINALKKLCNHPGLLYNTVKESTDELYESLSVKLFPEAYSTGNFCTADSGKLLVLTDLLKAIQ------VVLVSNYTQTLDLLQDLCTHLGYTWCRLDGQTPVAQRQRIVESFNSPYSSHFLFLLSSKAGGVGLNLVGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRFLTTGTIEEKMYQRQVSKQGLSGTVVDLKKKAEHISFSAEELRDLFTFEANTSCLTHDLLDCQ-CLGDGST--PGSVTVAEGRACQLGHRANSSS 761          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 234.958 bits (598), Expect = 1.680e-64
Identity = 152/463 (32.83%), Postives = 242/463 (52.27%), Query Frame = 2
Query:  458 IDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTK--YLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQY---SGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            +   VIV P++++  W  E + W       +  ++GS     + L   +  +G+ IL    I SY   R+    + K     ++ DEGH+++N       +  Q     R +LSG+P+QN+L E +SL  FV  G LGT   F   +  PI     + ASP       +    L   +N  ++RR ++ +     LP K EQV+ C+L   Q ++Y+DF+   +K+V     G+   FS L A   L+KICNHPDL          G  R    +PE       +  Y   SGK  V++ +L +     + +V++ +   Q L+I E+  +  GY F+++DG+ +I  R  ++ ++N+     FVF+L++K GG G+NL GANR+ ++DPDWNP+ D QA  R WR GQK+Q  +YRL+  GTIEEKI  RQ  K+ L++ V+ ++    R F  +++ ELF+
Sbjct:  544 LGPTVIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKREKLIPEI-AAGHGIL----ITSYSYVRIMQDYIQKYDWHYVILDEGHKIRNPNAGVTVACKQFRTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDSINPYLLRRMKADVKANLALPDKSEQVLFCRLTEDQRKVYQDFLD--SKEVYQILNGDMQVFSGLIA---LRKICNHPDLF--------SGGPRLLKGVPEEELSEEEHFGYWKRSGKLIVVESLLRLWYKQGH-RVLLFTQSRQMLEILEVFVRGNGYSFLKMDGTTTIASRQPLIARYNEDI---FVFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKQQVTVYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELFT 983          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 220.32 bits (560), Expect = 1.070e-60
Identity = 143/451 (31.71%), Postives = 229/451 (50.78%), Query Frame = 2
Query:  470 VIVAPSSLVKNWQNEINKWLAA-KISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELL-KIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDV-LLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSE 1813
            +++ P S + NW NE  +W+   K  C+  D  ++         F+        + V + SYE       V  K +   ++ DE HR+KN +++  + + +     R+LL+GTP+QN+L E +SL++F+   +  +AS+F   ++T             ++  G ++L E L  ++   ++RR +  + K LP K E  +   L  +Q + Y   +    KD+ +L +AG+      L  +  L+K CNHP L         DG E    Y  + +  T      SGK   LD +L  ++     +V++ S  T+ LDI E  C  RGY + RLDG+   + R K +D FN P S +F+FMLS++AGG G+NL  A+ + ++D DWNP  D QAM R  R GQKK   ++RLI   T+EE+I++R   K  L S VI Q   +E+   L +
Sbjct:   28 MVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDAR-------AAFIRDVMMPGEWDVCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASDFDSWFDT-------------NNCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRIL---MKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF--------DGAEPGPPYTTDTHLVTN-----SGKMLALDKLLPKVQEQ-GSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGRLIEQQNKLGK 441          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008546.1 (pep scaffold:Pmarinus_7.0:GL478142:26283:34743:1 gene:ENSPMAG00000007719.1 transcript:ENSPMAT00000008546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 319/548 (58.21%), Postives = 406/548 (74.09%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKR-KAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFS----LSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQ 2056
             RQ P  KP IDK ++VAPSSLVKNW NE+ KWL  +++ + ID GSK +IDK L  F+ Q G RI  P+LIISYETFRLHA+VLH+G VGL++CDEGHRLKN+ENQTYQ+L  LN Q+RVL+SGTPIQNDLLEYFSLVHFVN GILGTA EFK+ +E PIL+ RDA+A+     +G+ERLQEL+ IVN C+IRRT  +L+KYLPVKIEQVVCC+L ++Q  +Y+ F+++ K    L  A    ++ SSL +IT LKK+CNHP L++DK  E  +GFE +    P GY+P    PQ SGK  VLD +LAV +STT+DKVV+VSNYTQTLD+ E +C+ R Y++VRLDGSMSIKKRAK+VD+FN+  S EFVFMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQ+K C+IYRL++  +    + Q      +  +C ++ E   + +FS    ++++K  F     +LS    +FKC+RCVN IQ RPP   +DC S+LSQW+H  DK+ L+D  L + W +  ++F F HRSHE +
Sbjct:  200 LRQSPDAKPEIDKVMVVAPSSLVKNWFNEVAKWLGGRVTPLAIDGGSKGEIDKMLESFMAQHGLRIPNPILIISYETFRLHAEVLHRGRVGLVICDEGHRLKNAENQTYQALNSLNAQRRVLISGTPIQNDLLEYFSLVHFVNCGILGTAQEFKKKFELPILKGRDADATDALKRRGEERLQELIGIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTALQAGLYKLFLRQNKTASELSTAKNGTISASSLSSITQLKKLCNHPSLIFDKCVEGEEGFEGALELFPSGYNPKLLEPQLSGKMLVLDYILAVTRSTTSDKVVLVSNYTQTLDLFERLCRARSYLYVRLDGSMSIKKRAKVVDQFNNSSSPEFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQRKSCYIYRLVSV-SPTWALYQTSGVSLSHHTC-LEFEIKSQGYFSQYSFITQIKITFKC---SLSGVMGRFKCRRCVNGIQVRPPAEGTDCTSNLSQWHHSGDKRHLQDRVLTAAW-DAAVTFTFHHRSHEPR 741          

HSP 2 Score: 77.0258 bits (188), Expect = 8.495e-15
Identity = 38/92 (41.30%), Postives = 61/92 (66.30%), Query Frame = 3
Query:  156 YISNYRK-LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            ++S YRK L   ++  +  +   +E  I+ +L+KPFK+PIPNY+G +     + LG+RR G++  + DP+ + ALVLY PPE++AH+ LK D
Sbjct:   46 FVSPYRKPLATLDNSPHSSDGAAHEAFIRSILAKPFKIPIPNYNGPL---GVKALGVRRHGARRPLHDPYVDGALVLYKPPEVTAHDLLKAD 134          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Match: rad54b (RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-50])

HSP 1 Score: 382.104 bits (980), Expect = 1.908e-121
Identity = 213/498 (42.77%), Postives = 296/498 (59.44%), Query Frame = 2
Query:  428 FRQGPTG-KPLIDKAVIVAPSSLVKNWQNEINKWLAA-KISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKA-KDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEG--------YSPTRFNPQYSGKFQVLDCML-AVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERH---FSLSELKELFSYNIGTLSDTHEKFKC 1876
             RQGP G +P + K +IV P SLV+NW  E NKWL   +I   T+D   K          V +     +YPVLIISYE        +     GL++CDEGHRLKNS  +T  ++  L  ++R+LL+GTPIQNDL E++S+V FVN GILG+A+ F++ +E PI++S    AS ED   G+ R  EL ++    ++RRTQ +  +YLP K E VV C+   +Q Q+Y   +   A +  L +   ++     L  I++LKK+CN P L+Y  + ++ D  E +   L +G        Y+P   +   SGK +VL  +L A+ + T  ++VV+VSN TQ LD+    C + GY +VRLDG+  + +R  +++ FN  +S   VF+LSSKAGG GLNL+GA+RL ++D DWNPAND QAMARVWRDGQ K   IYR + TGTIEEKI QRQ  K+ LS  V+D           FSL EL+ LF+ + GT   TH+   C
Sbjct:  226 LRQGPYGNRPSLHKVLIVTPGSLVRNWSREFNKWLGVERIRVFTVDQEHK----------VEEFMKSPIYPVLIISYEMVLRCIDAVRVIPFGLVICDEGHRLKNSSIKTASAIDSLPCKRRILLTGTPIQNDLQEFYSIVEFVNPGILGSAAAFRKVFEEPIVQSHQPSASLEDKQLGETRAAELQRLTGLFVLRRTQEINQRYLPPKREFVVMCRPTPLQIQLYRRLLASPAVRSCLNRVTTDRSPH--LVCISALKKLCNDPCLLYKTLQKKQDSEEEADVSLYDGLYEEFSLIYNPESTSKLESGKLRVLARLLEAMHQKTPVERVVLVSNSTQMLDVLARCCSSWGYSWVRLDGTTPVSQRQHLLENFNSRFSTHSVFLLSSKAGGVGLNLVGASRLVLYDIDWNPANDMQAMARVWRDGQHKTVHIYRFLTTGTIEEKIYQRQVSKQGLSGSVVDAASSARSEHIRFSLEELRNLFTLHEGTCCFTHDLLGC 711          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 212.616 bits (540), Expect = 2.917e-59
Identity = 131/374 (35.03%), Postives = 208/374 (55.61%), Query Frame = 2
Query:  722 HRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQS--LLTKYLPVKIEQVVCCKLISVQE-QIYEDFM-KRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            H  +N++N+ + +        R++LSG+P+QN+L E +SL  FV  G LGT   F   +  PI +   + AS        +    L   +   ++RR ++   +   LP K EQV      + Q  Q+Y+ F+  R+ + VL +   E+  F+   A+ +L+KICNHPDL+   ++   DGF         GY       + SGK  V++ +L + +   + +V++ +   Q LDI E   +  GY ++++DG+ SI  R  ++DKFN   S  F+F+L++  GG G+NL GANR+ +FDPDWNP+ D QA  R WR GQ +Q  IYRL++ GTIEEKI  RQ  K+ L++ V+ ++   +R F  ++L ELF+
Sbjct:  186 HPCRNADNKIFPNCFMFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQVKALLKYNFQRSQVYQKFLDSREVQQVLNR---ERQVFT---ALITLRKICNHPDLLTGGLNAEDDGF---------GYW------RRSGKLLVVEALLRMWRRQGH-RVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKDESM-FMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVL-KDPRQQRFFKANDLFELFA 535          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.379 bits (529), Expect = 3.367e-59
Identity = 136/437 (31.12%), Postives = 217/437 (49.66%), Query Frame = 2
Query:  470 VIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKER-LQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQ 1777
            ++V P S V +WQ E   W       + +   S  ++ +   + ++Q   ++ +  L+ +YE       VL   +   +  DE HRLKN ++  Y+SLI+     R+L++GTP+QN L E +SL+HF+         +F            DA      H  G +     L K +   ++RR +  + + LP K+EQ++  ++   Q+  Y+  + R  K +     G    F  L  +  LKK CNH  L+     E  D  +   S +           + SGK  +LD +L  ++ T + +V++ S   + LDI       + + F RLDGS+  ++R + +D FN   S++F F+LS++AGG G+NL  A+ + +FD DWNP ND QA AR  R GQKKQ  IYRL+  GT+EE I++R   K  L   VI +
Sbjct:   38 LLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEW-IHQQTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKFSAWEDF------------DAV-----HGSGSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGSTSGF--LNIMMELKKCCNHCYLIKLPEDENVDKHDALQSLV-----------RSSGKLILLDKLLCRLRETGH-RVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQR 442          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Match: ercc6 (excision repair cross-complementation group 6 [Source:ZFIN;Acc:ZDB-GENE-070228-1])

HSP 1 Score: 213.001 bits (541), Expect = 3.151e-58
Identity = 149/474 (31.43%), Postives = 238/474 (50.21%), Query Frame = 2
Query:  458 IDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTY-----FVNQSGYRILYPVLIIS-------YETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQS--LLTKYLPVKIEQVVCCKLISVQE-QIYEDFM-KRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            +  +++V P++++  W  E + W       +  +SGS     K +       F N    R L P  ++         E +RL  + + K +V L L                   Q     R++LSG+P+QN+L E +SL  FV  G LGT   F   +  PI +   + AS        +    L   +   ++RR ++   +   LP K EQV      + Q  Q+Y+ F+  R+ + VL +   E+  F+   A+ +L+KICNHPDL+   ++   D         P G+   R     SGK  V++ +L + +   + +V++ +   Q LDI E   +  GY ++++DG+ SI  R  ++DKFN   S  F+F+L++  GG G+NL GANR+ +FDPDWNP+ D QA  R WR GQ +Q  IYRL++ GTIEEKI  RQ  K+ L++ V+ ++   +R F  ++L ELF+
Sbjct:  124 LGPSLVVCPTTVMHQWVREFHTWWPQFRVAVLHESGSYSGKKKYMHRVIVFCFNNLQNERKLVPERLVDDLASRKMREVYRLRFQRVIKKNVALFLA------------------QFRTPHRIILSGSPVQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITQGGYSNASDVQVQTAYKCACVLRDTIKPFLLRRMKADVKVNLALPDKNEQVKALLKYNFQRSQVYQKFLDSREVQQVLNR---ERQVFT---ALITLRKICNHPDLLTGGLNAEDD------ELAPSGFGYWR----RSGKLLVVEALLRMWRRQGH-RVLLFTQSRQMLDILEKFVQGEGYSYMKMDGTTSIATRQPLIDKFNKDESM-FMFLLTTHVGGIGVNLTGANRVIIFDPDWNPSTDTQARERAWRIGQLRQVTIYRLVSAGTIEEKIYHRQIFKQFLTNRVL-KDPRQQRFFKANDLFELFA 560          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Match: RAD54 (DNA-dependent ATPase that stimulates strand exchange; modifies the topology of double-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; member of the SWI/SNF family of DNA translocases; forms nuclear foci upon DNA replication stress [Source:SGD;Acc:S000003131])

HSP 1 Score: 499.975 bits (1286), Expect = 7.578e-166
Identity = 267/552 (48.37%), Postives = 362/552 (65.58%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAK-ISCMTIDS------GSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLV-YDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRC-VNNIQTRPPPSESDCNSDLSQWYHCADKKSLE---DVALKSVWNNNIISFVFWHRSH 2047
             RQGP GK LIDK +IV PSSLV NW NE+ KWL    ++ + +D       G    + + +  +    G  I+ PVLIISYET R +   L   +VGL+L DEGHRLKN ++ T+ +L  ++  +RV+LSGTPIQNDL EYF+L+ F N G+LG+ +EF++++E PILR RDA+A+ ++ +KG+ +LQ+L  IV+  IIRRT  +L KYLP K E V+   L  +Q ++Y   +K +    ++K  G       L+AI  LKK+CNHP+L+ ++   +  D  E    Y   G        +YS KF +L+  L  IK+ ++DK+V++SNYTQTLD+ E MC+ + Y  VRLDG+MSI KR K+VD+FNDP  QEF+F+LSSKAGGCG+NLIGANRL + DPDWNPA D+QA+ARVWRDGQKK CFIYR I+TGTIEEKI QRQ+ K +LSSCV+D +EDVER FS   L++LF  N  T+ +THE + CKRC     Q +  P+      D + W H  +  +LE   D  LK+  + N ISF F + SH
Sbjct:  353 LRQGPQGKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVGGS---QPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETYHCKRCNAQGKQLKRAPAM--LYGDATTWNHL-NHDALEKTNDHLLKNEHHYNDISFAFQYISH 898          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Match: RDH54 (DNA-dependent ATPase; DNA recombination/repair translocase, supercoils DNA and promotes DNA strand opening; stimulates strand exchange by modifying dsDNA topology; involved in recombinational repair of DNA double-strand breaks (DSBs) during mitosis and meiosis; phosphorylated in Mec1p-, Rad53p-dependent way in response to one DSB; contributes to remodelling of nucleosomes; proposed to be involved in crossover interference; interacts with Dmc1p; stimulates Dmc1p and Rad51p [Source:SGD;Acc:S000000277])

HSP 1 Score: 343.969 bits (881), Expect = 9.976e-106
Identity = 206/497 (41.45%), Postives = 297/497 (59.76%), Query Frame = 2
Query:  443 TGKPLID---KAVIVAPSSLVKNWQNEINKWL-AAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGS--VGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDA--EASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLV--------YDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFN-DPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALS------SCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHE 1864
            +G PL     K ++V P +L+ NW+ E  KWL  ++I  +T+ S +  D+DK      N    +  Y VLII YE     ++ L K    + +++CDEGHRLKN  ++   +L  L++++++LL+GTPIQNDL E+F+++ F+N GILG+ + FKR +  PI R+RD     + E   KG+ER +E+++I    I+RRT ++L KYLP K + ++ CK  S Q   ++D ++    D      G+    SSL  IT LKK+CN P LV        + K ++  D + RS +               SGK +VL  +L  I+  T +KVVVVSNYTQTLDI E +    G    RLDGS+  K+R  IV  FN +P    F F+LS+K+GG GLNL+GA+RL +FD DWNP+ D QAM+R+ RDGQKK CFIYRL+ TG I+EKILQRQ  K +LS      S + ++E   +  F+  +LK+LFS +  T S+TH+
Sbjct:  378 SGIPLTGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGVLTLSSRNSPDMDK--MAVRNFLKVQRTYQVLIIGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFILRRTNAILEKYLPPKTDIILFCKPYSQQILAFKDILQGARLDF-----GQLTFSSSLGLITLLKKVCNSPGLVGSDPYYKSHIKDTQSQDSYSRSLN---------------SGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNPAI--FGFLLSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSVHTDTKSNTHD 850          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Match: RAD26 (Protein involved in transcription-coupled nucleotide excision repair; repairs UV-induced DNA lesions; recruitment to DNA lesions is dependent on an elongating RNA polymerase II; homolog of human CSB protein [Source:SGD;Acc:S000003796])

HSP 1 Score: 228.794 bits (582), Expect = 1.005e-63
Identity = 142/405 (35.06%), Postives = 228/405 (56.30%), Query Frame = 2
Query:  635 VLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRG-----YVFVRLDGSMSIKKRAKIVDKFNDPYSQEF-VFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            +LI +Y   R+H+  L K      + DEGH+++N +++   +  +L    R++LSGTPIQN+L E +SL  F+  G LGT   F++ +  PI     A A+      G +    L  +++  ++RR ++ + K LP K E V+ CKL   Q   Y +F+   + D+     G++   + L  I  L+KICNHPDL+ D+ ++R              ++P   +P+ SGK QV+  +L ++      K ++ +   Q LDI E    T+        ++R+DG+ +IK R  +VD+FN+   + F VF+L+++ GG G+NL GANR+ +FDPDWNP+ D QA  R WR GQK++  IYRL+  G+IEEKI  RQ  K+ L++ ++   +  +R F + EL +LFS
Sbjct:  443 ILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLH--SSDLNQIQNGKR---NVLFGIDILRKICNHPDLL-DRDTKR--------------HNPDYGDPKRSGKMQVVKQLL-LLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIKGRQSLVDRFNN---ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQ-KRFFKIHELHDLFS 822          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 218.779 bits (556), Expect = 2.916e-60
Identity = 140/449 (31.18%), Postives = 231/449 (51.45%), Query Frame = 2
Query:  470 VIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERL--QELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSL-QAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQY---------SGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQ 1777
            +I+ P S + NW+ E  KW     +  +  D  ++ DI +N+            + VLI SYE        L + +   I+ DE HR+KN ++   Q +     + R+L++GTP+QN+L E ++L++F+   I G +  F   +E             +++S+  + +  Q+L  ++N  ++RR ++ + K L  KIE  V   +  +Q Q Y+  +++   D +  A G++   + L   +  L+K CNHP                   YL EG  P    P Y         SGK  +LD +L  +K   + +V++ S  ++ LDI E  C  R + + R+DGS S ++R + +D++N P S++FVF+L+++AGG G+NL+ A+ + +FD DWNP  D QAM R  R GQKKQ  +YR +    IEEK+++R A K  L   VI Q
Sbjct:  237 LIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL-------EARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFE-------------QNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDI-DAVNGAVGKREGKTRLLNIVMQLRKCCNHP-------------------YLFEGAEP---GPPYTTDEHLIFNSGKMIILDKLLKRLKEKGS-RVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQ 641          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Match: MOT1 (Essential protein involved in regulation of transcription; removes Spt15p (TBP) from DNA via its C-terminal ATPase activity; may have a role in ensuring that soluble TBP is available to bind TATA-less promoters; forms a complex with TBP that binds TATA DNA with high affinity but with altered specificity; the Mot1p-Spt15p-DNA ternary complex contains unbent DNA; coregulates transcription with Spt16p through assembly of preinitiation complex and organization of nucleosomes [Source:SGD;Acc:S000006003])

HSP 1 Score: 210.305 bits (534), Expect = 3.774e-57
Identity = 153/493 (31.03%), Postives = 255/493 (51.72%), Query Frame = 2
Query:  467 AVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLK-------AAGEKVAFSSLQAITSLKKICNHPDLV----YDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYT---QTLDICEL-----MCKTRGY-------VFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEK 1867
            ++I+ P SL  +W+NE +++ A  +  +    G        LT     S   I+    + SY+  R    VL+K      + DEGH +KNS+++  +++ ++    R++L+GTPIQN++LE +SL  F+  G LGT   F+  +  PI  SR+++ S ++   G   L+ L K V   ++RR +  +   LP KI Q   C+L  +Q+Q+Y DF K K K+V+ K       A G++  F   QA+  ++K+CNHP LV    + ++++  D  +++   L +  +  + +   +  F+       + K  + D+   + N     + L  C+L     M +   +        ++RLDGS+  + R K+V KFN+  S +   +L++K GG GLNL GA+ +   + DWNP ND QAM R  R GQKK   +YR+I  GT+EEKI+  Q  K  ++S V++Q+          +L +LF  +  T  D  EK
Sbjct: 1335 SLIICPPSLTGHWENEFDQY-APFLKVVVYAGGPT----VRLTLRPQLSDADII----VTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLYMDFTK-KQKNVVEKDIENSEIADGKQHIF---QALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPDNVTSQDNEEK 1813          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Match: EDO36092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJN9])

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 358/556 (64.39%), Postives = 433/556 (77.88%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEK-----VAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKK--------QCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQ 2056
             RQGP+ +P++ K +IVAPSSLVKNW NE+ KWL  +I+ + IDSGSKD+ID+NL  +++Q G R   PVLIISYETFRLHA  LH GSVGL++CDEGHRLKN E+QTYQ+L +LN  +RVLLSGTPIQNDLLEYFSLVHFVNQGILGT SEFKR +ETPILR RDA+A+  +H KG ERL EL  +VN CIIRRT ++L+KYLP+K+EQVVCC+L ++Q  IY+  +  KA  + L A G K     V+ SSL  ITSLKK+CNHP+L+Y+K     +GFE      P+ +      P+ SGK QVLD +LAV K+T++DKVV+VSNYTQTLD+ E +C+ R Y  VRLDGSMSIKKR KIVD+FNDP   +F+FMLSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKK        Q FIYRL++TGTIEEKI QRQAHKKALSSCV+D+EE+VE+HFS+ +L++LF  N  TLSDTH+KFKC+RCVNNIQ  PPP  +DC ++LS W HCA  K LED  LK  W++  ISFVF  +SHEKQ
Sbjct:  200 LRQGPSAQPIVSKVIIVAPSSLVKNWYNELYKWLGNRINALAIDSGSKDEIDRNLERYMSQQGSRTPTPVLIISYETFRLHAAALHNGSVGLVICDEGHRLKNLESQTYQALNKLNATRRVLLSGTPIQNDLLEYFSLVHFVNQGILGTVSEFKRKFETPILRGRDADATDAEHKKGIERLTELASLVNKCIIRRTAAILSKYLPIKVEQVVCCRLTALQTAIYKRLIHSKALKIKL-AEGSKGKPGGVSTSSLGFITSLKKLCNHPELIYEKAQMEDEGFEGVLEMFPQKFDLKNVQPELSGKMQVLDYILAVTKATSDDKVVLVSNYTQTLDLFEKLCRQRRYQHVRLDGSMSIKKRQKIVDRFNDPKGGDFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKKAIFDLLLQVFIYRLLSTGTIEEKIFQRQAHKKALSSCVVDEEENVEKHFSVEQLRDLFRLNEETLSDTHDKFKCRRCVNNIQAHPPPQGTDCTANLSLWNHCASSKGLEDTFLKGAWSSG-ISFVFHQKSHEKQ 753          

HSP 2 Score: 87.0409 bits (214), Expect = 1.035e-17
Identity = 43/78 (55.13%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  213 IDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGRDQL 446
            I  +E  I+ LLSKPFKVPIPNY GS LS   R LG+RR G + ++ DP+EEDALVLY PP L+A +QL +D  + ++
Sbjct:   66 ISAHEALIRSLLSKPFKVPIPNYKGSSLS---RGLGLRRKGPRRSLHDPYEEDALVLYEPPPLTAQQQLSMDIEKQEV 140          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Match: EDO39293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK4])

HSP 1 Score: 379.793 bits (974), Expect = 5.251e-120
Identity = 221/572 (38.64%), Postives = 322/572 (56.29%), Query Frame = 2
Query:  431 RQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKM--------SERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRC--VNNIQTRP----------------PPSESDCN---SDLSQWYHCADKKSLEDVALKSVWN-NNIISFVFWHRSHE 2050
            +QGP  G+P+ ++ +I+ P SLVKNW  E  KWL   ++    + S      D  +  F+       +YPVLIISYE F      +      L +CDE HRLKNS  +T   +  L  ++RVLL+GTPIQNDL E+ +L+   N G+LGT   F+R YE PI+  +   A+ ED   G+ R  EL ++     +RRT  +  KYLP K+E VV C+   +Q  +Y   +  +     L+A+    + + L+ I +LKK+CNHP L+Y            ++   ++      PE    +  +   SGK  VL+ ML  I  T  ++VV+VSNY+QTLDI + +C  + Y ++RLDGS    KR  +V++FN  + Q+FVF+LSSKAGG GLNLIGA+RL ++D DWNPAND QAMARVWRDGQ+++  IYRL+ TGTIEEKI QRQ  K+ LS  V D  + V+  FS  ++K+LF+ +  T+  TH+  +C+RC  V   +  P                PP+E   N   ++L +W H      L ++   ++    + I+FVF +  +E
Sbjct:  274 KQGPYGGQPVCNRILIITPGSLVKNWCAEFRKWLGNERMRVFPVTS------DMRVKEFIISP----IYPVLIISYEMFIRSQDDIMNIKFDLFICDEAHRLKNSAIKTTTLISGLKTRRRVLLTGTPIQNDLKEFHTLIELCNPGVLGTL--FRRVYEQPIVNGQQPGATSEDKLLGQTRASELNRLTRLFFLRRTSEINEKYLPPKVEMVVFCRPAHLQVTLYRHLLTSRFLRGCLRASCP--SSTHLECIGALKKLCNHPTLLYSASQGANTLGDEDQVSLYDGLLKLFPECNDASELSIAQSGKLTVLNSMLEEIHCT-GERVVLVSNYSQTLDILQKLCTVKKYRYLRLDGSTPTAKRQSLVERFNAKHCQDFVFLLSSKAGGVGLNLIGASRLILYDIDWNPANDLQAMARVWRDGQRRRVVIYRLLTTGTIEEKIYQRQTTKQGLSGAVADDRKQVKVDFSQEDVKDLFTLDELTVCSTHDLLQCQRCNRVQQAEKEPDPSCVQTMTRACQLGMPPTEKKMNVSIAELMKWQHFPSPLCLTELCDDAILRAEDHITFVFRNEVNE 830          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Match: EDO29059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Q4])

HSP 1 Score: 267.7 bits (683), Expect = 6.648e-85
Identity = 133/220 (60.45%), Postives = 161/220 (73.18%), Query Frame = 2
Query: 1049 IEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEK-----VAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYR 1693
            +EQVVCC+L  +Q  IY+  +  KA  + L A G K     V+ SSL  ITSLKK+CNHP+L+Y+K     +GFE      P+ +      P+ SGK QVLD +LAV K+T++DKVV+VSNYTQTLD+ E +C+ R Y  VRLDGSMSIKKR KIVD+FNDP   +F+FMLSSKAGGCGLNLIGANRL MFDPDWNPAND+QAMARVWRDGQKK+    R
Sbjct:    5 VEQVVCCRLTPLQTAIYKRLIHSKALKIKL-AEGSKGKPGGVSTSSLGFITSLKKLCNHPELIYEKAQMEDEGFEGVREMFPQKFDLKNVQPELSGKMQVLDYILAVTKATSDDKVVLVSNYTQTLDLFEKLCRQRRYQHVRLDGSMSIKKRQKIVDRFNDPKGGDFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKKASYRR 223          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Match: EDO32522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUV1])

HSP 1 Score: 238.039 bits (606), Expect = 1.093e-68
Identity = 169/555 (30.45%), Postives = 271/555 (48.83%), Query Frame = 2
Query:  464 KAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTY-----FV------------------NQSGYRILYPVLIISYETFRLHA-------------KVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFS--YLPE------------------------------------GYSPTRFNPQYSGKFQVLDCMLAVIKST--TNDKVVVVSNYTQTLDICELMCKTRGYVF------------------VRLDGSMSIKKRAKIVDKFNDPYSQE-FVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIG 1843
            K + + P + ++NW +E N WL  K S    ++G     D N+ Y     F+                  N+SG      VL+I YE +R+ A             K L K    L++CDEGHR+KN++     +L ++  ++RV+L+G P+QN+L+EY+ +V FV    LG   EF   +E PI+  +  +++P D    + R   L  ++   + RR+QS+L K LP K E V+   + S+Q Q+Y+ ++     D LLK+ G     + ++   +  KI NHPD+ +  +  + D  +R+ S   LP+                                     Y P  F  +  GK  +L     +I+ +    +K+++ S    TL I E    +R   F                   RLDGS S ++R ++++ FND  S E  +FMLS++AG  G+NL+GA+R+ +FD  WNP +D QA+ RV+R GQ + C IYRLIATGT+E+KI  RQ  K+ +++ V+D E + E +F+  E+  L    +G
Sbjct:   56 KVLCIVPINTIQNWLSEFNSWLPGKPSEEMSENGEPIR-DYNVRYREFKVFLLGDNQKSTVARAKVIGEWNESG-----GVLLIGYELYRILALSTPCMASNKCIQKALCKPGPDLVICDEGHRIKNNQANISHALKKIKTRRRVVLTGYPLQNNLVEYWCMVDFVRPNFLGNRHEFSNMFERPIMNGQCCDSTPADMKLMRFRAHVLHSLLEGFVQRRSQSVLMKALPPKNEHVILVNMSSIQSQLYKAYI-----DYLLKSVGH---LNPIKGFHTCMKIWNHPDIFFSTLEGKTDS-QRNDSPLTLPDQEDSNSGLASSLPSSSQSVDQTPIFSNLDWAKQIMRNYKP--FIAEQGGKMVLL---FEIIEESLKLGEKILIFSQSLSTLSIIEEFLNSRVVPFFPGRQSDPSTKWARNKSYFRLDGSTSAQERERLINAFNDNSSNEVLLFMLSTRAGCLGVNLVGASRVVVFDSSWNPCHDVQAVCRVYRYGQVRPCHIYRLIATGTMEKKIYDRQVSKQGVANRVVD-ELNPEANFTKQEIMSLICEEVG 589          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Match: EDO46132 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM3])

HSP 1 Score: 212.616 bits (540), Expect = 7.984e-60
Identity = 145/501 (28.94%), Postives = 246/501 (49.10%), Query Frame = 2
Query:  434 QGPTGKPLIDKAV--IVAPSSLVKNWQNEINKWLAAKISC-------MTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLK----------------------AAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERS--------------FSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHF 1801
            QGP+GK    K V  IV P S++ NW++E++ W   ++         M +D  +K  +D                 V++ +Y+T R++       +   ++ DE H+LK+   +  ++  +L VQ+R  L+GTP+QN   E + ++ + N G LG+   F   Y   I + +  +A+  + + G+ R  +    +N  ++RRT+ L+ ++LP K ++VV C L   QE +Y   ++     ++ K                       +GE +    ++      K+ NH  L+   + +  D  +R+                 L E    T  NP+Y GK +VLD +L + +     KV++ S  T+ L+I E     RG VF RLDG  S  +R ++V +FN      F+ ++S+KAGG GLN  GAN + +FDP WNP+ND QA  R +R GQ++   + RLI++GTIEE +  RQ +K+ +++  I    +  R+F
Sbjct:   71 QGPSGK---QKGVFLIVCPGSMLYNWKDELDTWGYFRVKMYHGSSKEMVMDQAAKGKLD-----------------VVLTTYDTLRINVTEFDCVNWLAVVMDEVHKLKDPSAKNTKAAKRLKVQRRFGLTGTPLQNRWSELWCVLDWANPGCLGSNLRFDAFYGKAIRKGQRHDANKRELALGRTRSSQFQSKLNNWMLRRTKDLIAQHLPHKDDKVVFCSLTPFQEDVYMALLQSPDVQLVRKKDYRCDCGSGQNRGKCCYSCCPVSGEPLKSLLMRCFQLFLKVANHAALLMPGVKQTDDQRKRAKAICEGVLTRHPHFVQSLAENSFQTLSNPEYCGKMKVLDKLLRMFEKDKC-KVLLFSYSTELLNILENYVIGRGLVFSRLDGQTSPAQRMRVVREFNGN-RDIFICLVSTKAGGLGLNFTGANVVIIFDPTWNPSNDLQAQDRAYRIGQRRDVQVLRLISSGTIEEMMYLRQIYKQQMANTAISGSTE-RRYF 548          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:101160723])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 348/544 (63.97%), Postives = 435/544 (79.96%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
             RQ P GKP IDKA++V+PSSLV+NW NE+ KWL  ++S + ID GSK++ID+ L  FV+Q+G R+  P+LIISYETFRLHA VLH+G VGL++CDEGHRLKN++NQTYQ+L  +  Q+RVL+SGTPIQNDLLEYFSLVHFVN GILG+A +FK+ +E PIL+ RDA+AS  D   G+E+L+EL+ IVN C+IRRT  +L+KYLPVK+EQVVCC+L  +Q ++Y  F+ R+AK +     G  +  SSL +ITSLKK+CNHP L++DK     +GF+ +    P GYS     PQ SGK  VLD +LA+ ++TT+DKVV+VSNYTQTLD+ E +C++R Y++VRLDGSMSIKKRAK+V++FN P S +F+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C++YRL+ TGTIEEKILQRQAHKKALSSCV+D+E+DVERHFSL EL+ELF+ N  T SDTH+KF+C+RCVN  Q RPP   +DC SDLSQW HC DK+ L D  LK+ W +  +SFVF  RSHE+QR
Sbjct:  190 LRQSPDGKPEIDKAIVVSPSSLVRNWYNEVGKWLGGRVSPVAIDGGSKEEIDRQLVNFVSQNGLRVPTPILIISYETFRLHAAVLHRGRVGLVICDEGHRLKNADNQTYQALNAMKAQRRVLISGTPIQNDLLEYFSLVHFVNAGILGSAQDFKKRFELPILKGRDADASDADRRAGEEKLKELIGIVNRCLIRRTSDILSKYLPVKVEQVVCCRLTPLQAELYRLFL-RQAKPLQTLQQGS-MNVSSLSSITSLKKLCNHPTLIHDKCVSGEEGFDGALDLFPPGYSSKEVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRSRRYLYVRLDGSMSIKKRAKMVERFNSPSSPDFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYVYRLLTTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELFTLNEETASDTHDKFRCRRCVNGRQVRPPAEGADCTSDLSQWNHCFDKRGLLDPVLKASW-DAAVSFVFHQRSHEEQR 730          

HSP 2 Score: 87.8113 bits (216), Expect = 1.644e-17
Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 3
Query:  177 LCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD 428
            LC  N +    + D +E  I+ +LSKPFKVPIPNY GS+     R LG++RSG + A+ DPF EDALVLY PP LSAH+ ++ D
Sbjct:   45 LCQLN-RPTCTDADKHEAFIRSILSKPFKVPIPNYCGSL---GIRALGLKRSGVRKALHDPFAEDALVLYEPPNLSAHDLIRAD 124          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Match: rad54l (RAD54 like [Source:NCBI gene;Acc:101160723])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 288/447 (64.43%), Postives = 357/447 (79.87%), Query Frame = 2
Query:  719 GHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQR 2059
            GHRLKN++NQTYQ+L  +  Q+RVL+SGTPIQNDLLEYFSLVHFVN GILG+A +FK+ +E PIL+ RDA+AS  D   G+E+L+EL+ IVN C+IRRT  +L+KYLPVK+EQVVCC+L  +Q ++Y  F+ R+AK +     G  +  SSL +ITSLKK+CNHP L++DK     +GF+ +    P GYS     PQ SGK  VLD +LA+ ++TT+DKVV+VSNYTQTLD+ E +C++R Y++VRLDGSMSIKKRAK+V++FN P S +F+FMLSSKAGGCGLNLIGANRL MFDPDWNPANDEQAMARVWRDGQKK C++YRL+ TGTIEEKILQRQAHKKALSSCV+D+E+DVERHFSL EL+ELF+ N  T SDTH+KF+C+RCVN  Q RPP   +DC SDLSQW HC DK+ L D  LK+ W +  +SFVF  RSHE+QR
Sbjct:   40 GHRLKNADNQTYQALNAMKAQRRVLISGTPIQNDLLEYFSLVHFVNAGILGSAQDFKKRFELPILKGRDADASDADRRAGEEKLKELIGIVNRCLIRRTSDILSKYLPVKVEQVVCCRLTPLQAELYRLFL-RQAKPLQTLQQGS-MNVSSLSSITSLKKLCNHPTLIHDKCVSGEEGFDGALDLFPPGYSSKEVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRSRRYLYVRLDGSMSIKKRAKMVERFNSPSSPDFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYVYRLLTTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELFTLNEETASDTHDKFRCRRCVNGRQVRPPAEGADCTSDLSQWNHCFDKRGLLDPVLKASW-DAAVSFVFHQRSHEEQR 483          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Match: rad54b (RAD54 homolog B [Source:NCBI gene;Acc:101169636])

HSP 1 Score: 422.165 bits (1084), Expect = 1.270e-134
Identity = 240/571 (42.03%), Postives = 333/571 (58.32%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFM-KRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADG-------FERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKS-TTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCK----RCVNNI--QTRPPPSESDCN-----------------SDLSQWYH-CADKKSLEDVALKSVWNNNIISFVF 2032
             +QGP  GKP+  + ++V P SLV+NW+ E NKWL   +IS  T+D       D  +  FV       L+ VL+ISYE      + + K   GLI+CDEGHRLKNS  +T  +L  L+  +RV+L+GTP+QNDL E+ +++ FVN GILG+ + +++ YE PILRSR    + E+   G+ER  EL ++    I+RRTQ ++ +YLP +++  + C+  ++Q+++Y+  +  R  +D +    G     + L  IT+LKK+CNHP L+Y  + ER +        +ER     PE YS   FN   SGK  VL  +LA I+  + +D+VV+VSNYTQTLD+ + +CK  GY F RLDG     +R ++VD FN  YSQ F+F+LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYRL+  GTIEE+I QRQ  K+ LS  V+D  +  E   FS SEL++LFS    T   TH+   C       VN++  +   P S   C                  S+L QW H   D  S  D  L   ++   I+F F
Sbjct:  372 LKQGPYGGKPVAKRVLVVTPGSLVQNWKAEFNKWLGRERISVFTVDQ------DHRIEQFV----LSPLHSVLVISYEMLLRCLEQVQKVEFGLIICDEGHRLKNSSIKTSSALTSLSCDRRVILTGTPVQNDLQEFHAIIEFVNPGILGSPTAYRKLYEEPILRSRQPSCTEEERVLGEERAAELSRLTGMFILRRTQEIINRYLPPRVDWTLFCEPSALQQELYQRLLCHRVFRDCM---QGSTQTSTHLACITALKKLCNHPGLLYATVKERTESGTLESSLYERLADLFPETYSLAGFNTADSGKLLVLSDLLAAIRQLSPSDRVVLVSNYTQTLDLLQDLCKHMGYTFCRLDGQTPTGQRQRLVDGFNSSYSQNFLFLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRLLTAGTIEERIYQRQVSKQGLSGTVVDMGKGAEHTSFSSSELRDLFSLT-ETPCLTHDLLNCGCSMDGAVNDVVEEEEDPTSGRPCQLGRQGDRKGQTQKHLSMSELMQWRHFSGDAHSFSDPYLD--YSRKHITFAF 926          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Match: rad54b (RAD54 homolog B [Source:NCBI gene;Acc:101169636])

HSP 1 Score: 411.764 bits (1057), Expect = 5.131e-134
Identity = 244/575 (42.43%), Postives = 330/575 (57.39%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLA-AKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFR--LHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFM-KRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVY---DKMSERADG------FERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKS-TTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVER-HFSLSELKELFSYNIGTLSDTHEKFKCK----RCVNNIQT--RPPPSESDCN-----------------SDLSQWYH-CADKKSLEDVALKSVWNNNIISFVF 2032
             +QGP  GKP+  + ++V P SLV+NW+ E NKWL   +IS  T+D       D  +  FV       L+ VL+ISYE     L  KV      GLI+CDEGHRLKNS  +T  +L  L+  +RV+L+GTP+QNDL E+ +++ FVN GILG+ + +++ YE PILRSR    + E+   G+ER  EL ++    I+RRTQ ++ +YLP +++  + C+  ++Q+++Y+  +  R  +D +    G     + L  IT+LKK+CNHP L+Y    K S    G      +ER     PE YS   FN   SGK  VL  +LA I+  + +D+VV+VSNYTQTLD+ + +CK  GY F RLDG     +R ++VD FN  YSQ F+F+LSSKAGG GLNLIGA+ L ++D DWNPAND QAMARVWRDGQKK   IYRL+  GTIEE+I QRQ  K+ LS  V+D  +  E   FS SEL++LFS    T   TH+   C       VN   T    P S   C                  S+L QW H   D  S  D  L   ++   I+F F
Sbjct:   80 LKQGPYGGKPVAKRVLVVTPGSLVQNWKAEFNKWLGRERISVFTVDQ------DHRIEQFV----LSPLHSVLVISYEMLLRCLEQKV----EFGLIICDEGHRLKNSSIKTSSALTSLSCDRRVILTGTPVQNDLQEFHAIIEFVNPGILGSPTAYRKLYEEPILRSRQPSCTEEERVLGEERAAELSRLTGMFILRRTQEIINRYLPPRVDWTLFCEPSALQQELYQRLLCHRVFRDCM---QGSTQTSTHLACITALKKLCNHPGLLYATVKKGSRMTSGTLESSLYERLADLFPETYSLAGFNTADSGKLLVLSDLLAAIRQLSPSDRVVLVSNYTQTLDLLQDLCKHMGYTFCRLDGQTPTGQRQRLVDGFNSSYSQNFLFLLSSKAGGVGLNLIGASHLVLYDIDWNPANDIQAMARVWRDGQKKTVHIYRLLTAGTIEERIYQRQVSKQGLSGTVVDMGKGAEHTSFSSSELRDLFSLT-ETPCLTHDLLNCGCSMDGAVNGRHTDEEDPTSGRPCQLGRQGDRKGQTQKHLSMSELMQWRHFSGDAHSFSDPYLD--YSRKHITFAF 634          
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Match: ercc6 (ERCC excision repair 6, chromatin remodeling factor [Source:NCBI gene;Acc:101166245])

HSP 1 Score: 228.409 bits (581), Expect = 1.944e-62
Identity = 153/470 (32.55%), Postives = 238/470 (50.64%), Query Frame = 2
Query:  437 GPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTK--YLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQY---SGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFS 1831
            GPT        VIV P++++  W  E + W       +  ++GS     + L   +        + +LI SY   R    +L +     I+ DEGH+++N       +  Q     R +LSG+P+QN+L E +SL  FV  G LGT   F   +  PI     + ASP       +    L   +N  ++RR ++ +     LP K EQV+ C+L   Q Q+Y+ F+   +K+V     G+   FS L A   L+KICNHPDL          G  R    +PE       +  +   SGK  V++ +L +     + +V++ S   Q LDI E+  +   Y ++++DG+ +I  R  ++ ++N   S  F+F+L++K GG G+NL GANR+ ++DPDWNP+ D QA  R WR GQ  Q  IYRL+  GTIEEKI  RQ  K+ L++ V+ ++    R F  +++ ELF+
Sbjct:  558 GPT--------VIVCPATVMHQWVKEFHTWWPPFRVAVLHETGSFTSKKEKLIPEIAS-----CHGILITSYSAVRNLQDILIRYDWHYIILDEGHKIRNPNAAVTAACKQFQTPHRFILSGSPMQNNLKELWSLFDFVFPGKLGTLPVFMEQFSVPITMGGYSNASPVQVQTAYKCACVLRDTINPYLLRRMKADVKANLSLPDKNEQVLFCRLTEEQRQVYQSFLD--SKEVYQILNGDMQVFSGLIA---LRKICNHPDLF--------SGGPRMLKGIPEDQLTEEEHFGFWRRSGKLIVVESLLRLWFKQGH-RVLLFSQSRQMLDILEVFVRENNYSYLKMDGTTTIASRQPLIARYNQDRSI-FIFLLTTKVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQTLQVTIYRLLTAGTIEEKIYHRQIFKQFLTNRVL-KDPKQRRFFKSNDIYELFT 998          
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Match: SMESG000049182.1 (SMESG000049182.1)

HSP 1 Score: 1137.09 bits (2940), Expect = 0.000e+0
Identity = 544/547 (99.45%), Postives = 545/547 (99.63%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
             RQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQL+VQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKM ERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV
Sbjct:  255 LRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLSVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMCERADGFERSFSYLPEGYSPTRFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 801          

HSP 2 Score: 252.292 bits (643), Expect = 1.927e-72
Identity = 136/142 (95.77%), Postives = 138/142 (97.18%), Query Frame = 3
Query:   21 KRSQAPSKSGETAFXXXXXXXXXXXXXGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGRDQL 446
            KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD  +  +
Sbjct:   54 KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDLDKQNI 195          
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Match: SMESG000049182.1 (SMESG000049182.1)

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 295/297 (99.33%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYS 1318
             RQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQL+VQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKM ERADGFERSFSYLPEGYSPTRFNPQYS
Sbjct:  255 LRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLSVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMCERADGFERSFSYLPEGYSPTRFNPQYS 551          

HSP 2 Score: 251.136 bits (640), Expect = 4.415e-74
Identity = 136/142 (95.77%), Postives = 138/142 (97.18%), Query Frame = 3
Query:   21 KRSQAPSKSGETAFXXXXXXXXXXXXXGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGRDQL 446
            KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD  +  +
Sbjct:   54 KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDLDKQNI 195          
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Match: SMESG000049182.1 (SMESG000049182.1)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 295/297 (99.33%), Query Frame = 2
Query:  428 FRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPTRFNPQYS 1318
             RQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQL+VQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKM ERADGFERSFSYLPEGYSPTRFNPQYS
Sbjct:  206 LRQGPTGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLSVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAAGEKVAFSSLQAITSLKKICNHPDLVYDKMCERADGFERSFSYLPEGYSPTRFNPQYS 502          

HSP 2 Score: 250.751 bits (639), Expect = 2.210e-74
Identity = 136/142 (95.77%), Postives = 138/142 (97.18%), Query Frame = 3
Query:   21 KRSQAPSKSGETAFXXXXXXXXXXXXXGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGRDQL 446
            KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVD  +  +
Sbjct:    5 KRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPYEYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSGHSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDLDKQNI 146          
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Match: SMESG000049182.1 (SMESG000049182.1)

HSP 1 Score: 512.301 bits (1318), Expect = 2.728e-179
Identity = 242/242 (100.00%), Postives = 242/242 (100.00%), Query Frame = 2
Query: 1343 MLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 2068
            MLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV
Sbjct:    1 MLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNIQTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSHEKQRITV 242          
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Match: SMESG000074988.1 (SMESG000074988.1)

HSP 1 Score: 304.679 bits (779), Expect = 2.962e-91
Identity = 200/528 (37.88%), Postives = 285/528 (53.98%), Query Frame = 2
Query:  428 FRQGP-TGKPLIDKAVIVAPSSLVKNWQNEINKWLAAKISCMTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSVGLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVHFVNQGILGTASE-FKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNCCIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKA--KDVLLKAAGEKVAFSSLQAITSLKKICNHPDL----VYDKMSERAD-------------------------GFERSFSYLPEGYSPTRFNPQ-YSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGYVFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRLFMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHKKALSSCVIDQEEDVE--RHFSLSELKELFSYNIGTLSD----THEKFKCKRCVN 1891
              QGP   + LI K +IV PSSLV NW+NE  KW+  +I    +   S D   +  T  +  S       VLI+SYE    + + LH  S  LI+CDE HRLK+  N+T+ ++  L +++R+LL+GTP+QND+ E+F+LV F N G+LG + E F++ +  PI  +R+  AS +   +G E    L ++    I+RRT+ + T YLP K E ++ C    VQ+Q+Y+  ++ K+  KD L        A  +L  I  L+K+CN P L    V DK +   +                          FE S        S  +      SGK  V   ML  +K+   +K+V+VS++TQTLD+ E +CK       R+DGS     R +IV  FN    +E V +LS KAGG GLNLIGANR+ ++D DWNPA D QAMAR+WRDGQK +  +YRLI TGT+EE +LQRQ  K+ LS+ +ID          FS  EL+ +F+++I +       TH+   C  C N
Sbjct:  253 LNQGPYENETLIQKCLIVCPSSLVLNWKNEFEKWIGTQIIPFCV---SGDVSIEKFTQSLKNS-------VLILSYEMLLRNVEFLHGLSFDLIVCDEAHRLKHGSNKTFIAVESLQIKRRILLTGTPLQNDMDEFFNLVQFANPGVLGCSKESFRQRFVNPINAAREPGASNQAIEEGCEASLILQRLTQSFILRRTEIVNTLYLPTKDEYIIFCLPTPVQKQLYKMLVECKSLQKD-LESEEFNGTAIDALACILMLRKLCNDPILLIRYVMDKENRSTELDNCYIEKMESLSLVEDIRKKLQNLEFENSTWKEILAMSVEKLGDHLLSGKLWVTAQMLMRLKN--GEKLVLVSHFTQTLDLLEKLCKNLDIALQRIDGSTPSALRMRIVSDFNRISCKE-VLLLSCKAGGEGLNLIGANRIILYDLDWNPATDAQAMARIWRDGQKSRVCVYRLITTGTVEESLLQRQVAKQQLSTSLIDLSSSKSNLNTFSKEELRNIFTFHIDSAIPFGCWTHQLLNCDCCEN 766          
The following BLAST results are available for this feature:
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAD54L9.440e-1765.08RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826][more]
RAD54L9.440e-1765.08RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826][more]
RAD54L9.440e-1765.08RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826][more]
RAD54L1.578e-13758.26RAD54 like [Source:HGNC Symbol;Acc:HGNC:9826][more]
FSBP2.640e-12941.65fibrinogen silencer binding protein [Source:HGNC S... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad-544.883e-957.93pep chromosome:WBcel235:I:9065087:9070264:1 gene:W... [more]
Y116A8C.131.323e-8434.41pep chromosome:WBcel235:IV:16950066:16962868:1 gen... [more]
Y116A8C.131.319e-8334.41pep chromosome:WBcel235:IV:16950065:16962868:1 gen... [more]
chd-31.339e-5729.93Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
let-4181.580e-5530.51pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
okr2.143e-857.35gene:FBgn0002989 transcript:FBtr0077673[more]
Chd35.074e-6230.86gene:FBgn0023395 transcript:FBtr0074998[more]
Hel89B5.989e-5631.19gene:FBgn0022787 transcript:FBtr0301715[more]
Hel89B5.989e-5631.19gene:FBgn0022787 transcript:FBtr0344471[more]
Chd12.270e-5533.26gene:FBgn0250786 transcript:FBtr0331654[more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad54l1.135e-1664.90RAD54 like [Source:ZFIN;Acc:ZDB-GENE-040426-968][more]
rad54b1.734e-12444.49RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
rad54b4.330e-12344.06RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
rad54b1.188e-12243.29RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
rad54b2.673e-12244.20RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad54l2.256e-1666.36RAD54 like [Source:NCBI gene;Acc:407922][more]
rad54l2.024e-1666.36RAD54 like [Source:NCBI gene;Acc:407922][more]
rad54l2.316e-1662.96RAD54 like [Source:NCBI gene;Acc:407922][more]
rad54l1.800e-1660.29RAD54 like [Source:NCBI gene;Acc:407922][more]
rad54l0.000e+066.89RAD54 like [Source:NCBI gene;Acc:407922][more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rad54l1.446e-1664.47RAD54 like (S. cerevisiae) [Source:MGI Symbol;Acc:... [more]
Rad54l1.446e-1664.47RAD54 like (S. cerevisiae) [Source:MGI Symbol;Acc:... [more]
Rad54b1.913e-12942.43RAD54 homolog B (S. cerevisiae) [Source:MGI Symbol... [more]
Ercc65.189e-6633.05excision repair cross-complementing rodent repair ... [more]
Chd24.142e-6234.70chromodomain helicase DNA binding protein 2 [Sourc... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O12944|RAD54_CHICK1.968e-1566.73DNA repair and recombination protein RAD54-like (F... [more]
sp|P70270|RAD54_MOUSE1.012e-1564.47DNA repair and recombination protein RAD54-like OS... [more]
sp|Q92698|RAD54_HUMAN4.533e-1665.08DNA repair and recombination protein RAD54-like OS... [more]
sp|B4MX21|RAD54_DROWI2.274e-957.86DNA repair and recombination protein RAD54-like OS... [more]
sp|O76460|RAD54_DROME2.148e-757.35DNA repair and recombination protein RAD54-like OS... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EYX42.523e-1570.56DNA repair and recombination protein rad54-related... [more]
A0A3Q0KUE82.756e-1570.43DNA repair and recombination protein rad54-related... [more]
G7Y7370.000e+069.24DNA repair and recombination protein RAD54 and RAD... [more]
A0A095A0M58.882e-1570.09DNA repair and recombination protein RAD54-like OS... [more]
A0A4S2LPM04.225e-1668.58Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad54l1.372e-1765.08RAD54 like [Source:NCBI gene;Acc:103036648][more]
rad54b7.196e-13742.69RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
rad54b1.518e-13142.23RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
ercc61.680e-6432.83excision repair cross-complementation group 6 [Sou... [more]
smarca11.070e-6031.71SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008546.18.495e-1558.21pep scaffold:Pmarinus_7.0:GL478142:26283:34743:1 g... [more]
rad54b1.908e-12142.77RAD54 homolog B [Source:ZFIN;Acc:ZDB-GENE-060810-5... [more]
ercc62.917e-5935.03excision repair cross-complementation group 6 [Sou... [more]
ENSPMAT00000004254.13.367e-5931.12pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
ercc63.151e-5831.43excision repair cross-complementation group 6 [Sou... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD547.578e-16648.37DNA-dependent ATPase that stimulates strand exchan... [more]
RDH549.976e-10641.45DNA-dependent ATPase; DNA recombination/repair tra... [more]
RAD261.005e-6335.06Protein involved in transcription-coupled nucleoti... [more]
ISW22.916e-6031.18ATP-dependent DNA translocase involved in chromati... [more]
MOT13.774e-5731.03Essential protein involved in regulation of transc... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360921.035e-1764.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392935.251e-12038.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290596.648e-8560.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325221.093e-6830.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461327.984e-6028.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad54l1.644e-1763.97RAD54 like [Source:NCBI gene;Acc:101160723][more]
rad54l0.000e+064.43RAD54 like [Source:NCBI gene;Acc:101160723][more]
rad54b1.270e-13442.03RAD54 homolog B [Source:NCBI gene;Acc:101169636][more]
rad54b5.131e-13442.43RAD54 homolog B [Source:NCBI gene;Acc:101169636][more]
ercc61.944e-6232.55ERCC excision repair 6, chromatin remodeling facto... [more]
back to top
BLAST of DNA repair and recombination protein rad54-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049182.11.927e-7299.45SMESG000049182.1[more]
SMESG000049182.14.415e-7498.99SMESG000049182.1[more]
SMESG000049182.12.210e-7498.99SMESG000049182.1[more]
SMESG000049182.12.728e-179100.00SMESG000049182.1[more]
SMESG000074988.12.962e-9137.88SMESG000074988.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032723 ID=SMED30032723|Name=DNA repair and recombination protein rad54-related|organism=Schmidtea mediterranea sexual|type=transcript|length=2261bp
ATCTATATAAATCTTATATGAAGAGAAGTCAAGCTCCTAGCAAATCTGGA
GAAACAGCTTTCTCTAGTCCCATTTCAATAAATTCTATAAATGATATCAA
TGGCAAGCGAAACTCCATTAAAAGGAAACCTGATGAAGTCCATTCGCCTT
ATGAATATATATCTAATTACAGAAAATTATGCGTAACTAATGATAAAGAA
AATGAAGAAAATATCGACAATTATGAAGAAAAGATAAAAAAACTATTGTC
GAAGCCATTCAAAGTGCCAATTCCTAATTATTCAGGCAGCGTGTTGAGTG
GCCACTCACGAATCCTTGGCATGAGAAGGAGCGGCAGCAAAATCGCTATG
TTTGACCCATTCGAGGAGGACGCTCTCGTGCTATACAGTCCTCCAGAATT
GTCTGCTCATGAGCAACTGAAAGTTGATTTCGGCAGGGACCAACTGGTAA
GCCTCTCATTGACAAAGCAGTTATTGTGGCGCCAAGCAGCTTGGTAAAGA
ACTGGCAGAATGAGATCAACAAATGGCTCGCAGCCAAGATCAGCTGCATG
ACCATCGATTCTGGATCCAAGGACGACATTGACAAAAATTTAACTTATTT
TGTCAATCAAAGCGGCTATCGGATTTTATATCCAGTGCTGATTATCTCAT
ATGAGACCTTTCGGTTGCACGCAAAGGTTCTTCACAAGGGCTCAGTAGGC
CTCATTTTATGTGACGAGGGCCACCGATTGAAAAATTCCGAAAACCAAAC
CTATCAGTCCCTCATCCAATTGAACGTCCAGAAGCGAGTTCTACTATCGG
GTACACCGATTCAGAATGATTTGCTGGAATATTTCAGCTTGGTGCATTTT
GTCAATCAGGGAATCCTTGGCACTGCCTCGGAGTTCAAACGGCATTACGA
AACACCGATATTGCGCAGTCGCGATGCTGAAGCATCACCGGAGGACCACA
GCAAAGGCAAGGAGAGATTGCAGGAACTGCTGAAGATCGTCAACTGCTGT
ATAATCCGCCGGACGCAATCGCTGCTCACCAAATACCTGCCCGTCAAGAT
CGAGCAAGTCGTCTGCTGCAAGCTCATCTCGGTCCAGGAACAGATCTATG
AGGATTTCATGAAGCGCAAGGCGAAAGATGTGCTACTGAAGGCCGCCGGA
GAGAAAGTGGCGTTCTCATCGCTCCAAGCCATCACCTCATTGAAGAAGAT
CTGCAACCATCCCGATCTCGTCTATGACAAAATGAGCGAGCGTGCCGACG
GATTTGAAAGGAGTTTCAGTTACCTGCCGGAGGGATATTCCCCTACTCGG
TTCAATCCGCAATATTCAGGTAAGTTCCAGGTGCTCGATTGTATGCTGGC
GGTAATCAAGAGCACTACCAATGACAAGGTGGTCGTCGTGTCTAATTACA
CACAAACGCTTGACATTTGCGAGCTAATGTGCAAGACACGAGGATACGTG
TTTGTCAGGCTCGATGGATCCATGTCCATTAAGAAGCGCGCTAAAATTGT
CGACAAGTTCAATGACCCTTATAGCCAGGAATTTGTGTTCATGTTGAGTA
GCAAGGCAGGAGGGTGCGGGTTGAATCTGATTGGCGCTAACCGACTGTTC
ATGTTTGACCCAGACTGGAATCCAGCCAATGACGAGCAAGCCATGGCGCG
AGTCTGGCGTGACGGACAGAAGAAGCAATGTTTCATTTACAGATTAATAG
CTACTGGAACGATTGAAGAGAAAATTCTCCAGCGCCAGGCACATAAGAAA
GCATTAAGTAGTTGTGTAATTGACCAAGAAGAAGACGTAGAAAGACATTT
CAGTTTATCGGAGTTGAAGGAATTGTTCTCGTATAATATAGGGACGTTGT
CAGACACCCACGAGAAATTCAAGTGCAAGCGGTGTGTTAACAACATTCAA
ACTAGACCGCCCCCATCAGAATCCGATTGCAATAGTGACCTTTCCCAATG
GTACCACTGTGCCGATAAGAAATCTCTCGAGGATGTCGCATTGAAGAGTG
TTTGGAATAACAATATAATATCTTTTGTATTTTGGCACCGATCACACGAG
AAGCAGCGAATAACTGTTTAATATATTTATTAATTAATTGCGTGAATTAT
TCTGTCAAATTATTATTGGATATTGCAAGCATTTACCGTGCTTTCGGGCT
TTGTTTTGATAATAAATTGATCCGGAATAAGCAATAGATTTTTCATGTCG
ATGAACGACAGCACCATATAAGGAACATGGGAAATTACGGAGGACGAGAT
TCGAGTGCGTG
back to top

protein sequence of SMED30032723-orf-1

>SMED30032723-orf-1 ID=SMED30032723-orf-1|Name=SMED30032723-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
LYKSYMKRSQAPSKSGETAFSSPISINSINDINGKRNSIKRKPDEVHSPY
EYISNYRKLCVTNDKENEENIDNYEEKIKKLLSKPFKVPIPNYSGSVLSG
HSRILGMRRSGSKIAMFDPFEEDALVLYSPPELSAHEQLKVDFGRDQLVS
LSLTKQLLWRQAAW*
back to top

protein sequence of SMED30032723-orf-2

>SMED30032723-orf-2 ID=SMED30032723-orf-2|Name=SMED30032723-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
MTIDSGSKDDIDKNLTYFVNQSGYRILYPVLIISYETFRLHAKVLHKGSV
GLILCDEGHRLKNSENQTYQSLIQLNVQKRVLLSGTPIQNDLLEYFSLVH
FVNQGILGTASEFKRHYETPILRSRDAEASPEDHSKGKERLQELLKIVNC
CIIRRTQSLLTKYLPVKIEQVVCCKLISVQEQIYEDFMKRKAKDVLLKAA
GEKVAFSSLQAITSLKKICNHPDLVYDKMSERADGFERSFSYLPEGYSPT
RFNPQYSGKFQVLDCMLAVIKSTTNDKVVVVSNYTQTLDICELMCKTRGY
VFVRLDGSMSIKKRAKIVDKFNDPYSQEFVFMLSSKAGGCGLNLIGANRL
FMFDPDWNPANDEQAMARVWRDGQKKQCFIYRLIATGTIEEKILQRQAHK
KALSSCVIDQEEDVERHFSLSELKELFSYNIGTLSDTHEKFKCKRCVNNI
QTRPPPSESDCNSDLSQWYHCADKKSLEDVALKSVWNNNIISFVFWHRSH
EKQRITV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016817hydrolase activity, acting on acid anhydrides
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR000330SNF2_N
IPR027417P-loop_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 289..373
e-value: 5.7E-20
score: 82.3
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 264..372
e-value: 5.8E-17
score: 62.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 262..415
score: 15.966
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 155..456
e-value: 4.2E-130
score: 435.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.850coord: 177..432
e-value: 4.2E-130
score: 435.4
NoneNo IPR availablePANTHERPTHR45629FAMILY NOT NAMEDcoord: 1..499
NoneNo IPR availablePANTHERPTHR45629:SF6DNA REPAIR AND RECOMBINATION PROTEIN RAD54-LIKEcoord: 1..499
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 256..384
e-value: 1.71498E-60
score: 193.077
NoneNo IPR availableCDDcd18067DEXHc_RAD54Acoord: 3..155
e-value: 4.22741E-81
score: 250.465
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 27..225
e-value: 6.5E-38
score: 130.3
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 1..154
e-value: 1.2E-49
score: 170.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 1..105
score: 13.332
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 158..496
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 17..155