Retrovirus-related Pol polyprotein from transposon

Overview
NameRetrovirus-related Pol polyprotein from transposon
Smed IDSMED30032720
Length (bp)468
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032720

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032720SMESG000064358.1 Contig2842newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032720SMESG000064358.1 Contig2842uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 9.426e-7
Identity = 22/64 (34.38%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  124 YGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKR 315
            YG P ++H D   + +S+ + E   +LG+ K+ T+PY+PQ D   ER  RT  +++  + +EK+
Sbjct: 1031 YGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKK 1094          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000025355.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:22781891:22783779:1 gene:ENSXETG00000014447.1 transcript:ENSXETT00000025355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.272e-6
Identity = 22/64 (34.38%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  124 YGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKR 315
            YG P ++H D   + +S+ + E   +LG+ K+ T+PY+PQ D   ER  RT  +++  + +EK+
Sbjct:  244 YGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTLLDMLGTLPKEKK 307          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A504YM86 (Retrovirus Pol polyprotein from transposon OS=Fasciola gigantica OX=46835 GN=FGIG_05300 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.616e-12
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  100 VRSQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEE 309
            + ++WIS+YG+P  +H D   +     L E C+ LGI+KT T+PY+PQ +ELVER  RT K+I+ + +E+
Sbjct:   26 IVNEWISRYGAPSIIHSDQGPSFDGLLLRELCRFLGIQKTRTTPYHPQGNELVERTNRTLKDILRSFVEQ 95          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5J4NFG7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0001986 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.654e-12
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRA 318
            ++WI++YG+P  +H D  +  +S+ L E C +LGIKKT T+PY+PQ + LVER  RT K ++ + LE  +A
Sbjct: 1096 NEWIARYGAPTMLHSDQGAAFESQLLKETCHLLGIKKTRTTPYHPQGNGLVERTNRTIKALLQSFLERHQA 1166          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5J4NKR9 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004666 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.669e-12
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRA 318
            ++WI++YG+P  +H D  +  +S+ L E C +LGIKKT T+PY+PQ + LVER  RT K ++ + LE  +A
Sbjct: 1096 NEWIARYGAPTMLHSDQGAAFESQLLKETCHLLGIKKTRTTPYHPQGNGLVERTNRTIKALLQSFLERHQA 1166          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5J4NXX0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005311 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.063e-11
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRA 318
            ++WI++YG+P  +H D  +  +S+ L E C +LGIKKT T+PY+PQ + LVER  RT K ++ + LE  +A
Sbjct:  608 NEWIARYGAPTMLHSDQGAAFESQLLKETCHLLGIKKTRTTPYHPQGNGLVERTNRTIKALLQSFLERHQA 678          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A2G8L0K3 (Retrovirus-related Pol polyprotein from transposon OS=Stichopus japonicus OX=307972 GN=BSL78_09288 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.847e-11
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            + ++S++G P Q+H D   N +S    E C++LG+ KT T+PY+PQSD +VER  RT + ++A V++
Sbjct:   30 TDFVSRFGVPKQIHTDQGRNFESNLFKELCQLLGVDKTRTTPYHPQSDGMVERFNRTLEEMLAKVVD 96          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000048272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000106.1:219951:223307:1 gene:ENSAMXG00000032559.1 transcript:ENSAMXT00000048272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.464e-12
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            S+W+ +YG+P  +H D  SN +S    + C++LG++KT T+P+ PQSD  VER   T + I+A   E
Sbjct:  775 SEWVCRYGAPQTLHSDQGSNFESEVFQKMCELLGVEKTRTTPFRPQSDGQVERFNATLQKILATTAE 841          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000055645.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001353.1:7814:9808:1 gene:ENSAMXG00000036557.1 transcript:ENSAMXT00000055645.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.114e-12
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            S+W+ +YG+P  +H D  SN +S    + C++LG++KT T+P+ PQSD  VER   T + I+A   E
Sbjct:  321 SEWVCRYGAPQTLHSDQGSNFESEVFQKMCEILGVEKTRTTPFRPQSDGQVERFNATLQKILATTAE 387          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000052614.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001686.1:18497:23810:-1 gene:ENSAMXG00000038033.1 transcript:ENSAMXT00000052614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 4.440e-12
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            S+W+ +YG+P  +H D  SN +S    + C++LG++KT T+P+ PQSD  VER   T + I+A   E
Sbjct:  600 SEWVCRYGAPQTLHSDQGSNFESEVFQKMCELLGVEKTRTTPFRPQSDGQVERFNATLQKILATTAE 666          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 8.152e-12
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  109 QWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            +WI +YG+P  +H D   N +S    E C++L + K+ TSPY PQSD L+ER  RT  ++++  ++
Sbjct:   89 EWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVD 154          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 9.908e-12
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  109 QWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            +WI +YG+P  +H D   N +S    E C++L + K+ TSPY PQSD L+ER  RT  ++++  ++
Sbjct:  125 EWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVD 190          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 7.010e-13
Identity = 28/69 (40.58%), Postives = 44/69 (63.77%), Query Frame = 1
Query:  109 QWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKR 315
            +W+ ++G+P  +H D   N +S    E C +L I K+ TSPY+PQSD LVER  RT  +++A  +E+ +
Sbjct:   90 EWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDNQ 158          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 5.743e-12
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 1
Query:   97 RVRSQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLE 306
            ++ S+W+ +YG+P ++H D  +N +S      C++LGI KT T+P+ PQSD  VER   T +  +AA  E
Sbjct: 1529 KIVSEWVCRYGAPYELHSDQGANFESAVFQGMCELLGINKTRTTPFRPQSDGQVERFNATLQKTLAATAE 1598          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000044989.1 (pep primary_assembly:ASM223467v1:1:17572028:17576089:-1 gene:ENSORLG00000028051.1 transcript:ENSORLT00000044989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.163e-11
Identity = 28/76 (36.84%), Postives = 48/76 (63.16%), Query Frame = 1
Query:   88 SKIRVRSQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKR 315
            +K+ +R +W  KYG P+++H D   N +S  + E CK+ G+KKT T+P++PQ +   ER  RT  +++  +  EK+
Sbjct:  966 AKVLLR-EWFMKYGVPERLHSDQGRNFESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPPEKK 1040          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000042487.1 (pep primary_assembly:ASM223467v1:4:23584510:23586585:1 gene:ENSORLG00000030583.1 transcript:ENSORLT00000042487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.357e-11
Identity = 28/76 (36.84%), Postives = 48/76 (63.16%), Query Frame = 1
Query:   88 SKIRVRSQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKR 315
            +K+ +R +W  KYG P+++H D   N +S  + E CK+ G+KKT T+P++PQ +   ER  RT  +++  +  EK+
Sbjct:  341 AKVLLR-EWFMKYGVPERLHSDQGRNFESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPPEKK 415          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000041485.1 (pep primary_assembly:ASM223467v1:15:30019002:30023522:-1 gene:ENSORLG00000028547.1 transcript:ENSORLT00000041485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 7.174e-10
Identity = 27/72 (37.50%), Postives = 46/72 (63.89%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRAK 321
            + +I  YG P+++H D  S+ +SR + E C + GIKK+ T+PY+P+ +  VER  RT  N++  +  E++ K
Sbjct: 1042 NDFIVHYGIPERLHSDQGSDFESRLVGELCDMTGIKKSRTTPYHPRGNP-VERFNRTLLNMLGTLDNEQKVK 1112          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000001337.1 (SMESG000001337.1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.492e-20
Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  112 WISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRAK 321
            WISK+G   ++H D  SN   +   EY K+L IKKTFTSPYYPQSD LVERL  T K  ++AV+EEK+ +
Sbjct:   17 WISKFGVTGRIHSDCGSNFLLQLFLEYYKILSIKKTFTSPYYPQSDGLVERLLGTAKRKLSAVIEEKKTR 86          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000015193.1 (SMESG000015193.1)

HSP 1 Score: 60.077 bits (144), Expect = 3.675e-11
Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query:   88 SKIRVRSQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAA 297
            SK+ + + WI KYG P  +  D   N +S++L E    LGI++ F SPY  QS+ LVER  RT +++  A
Sbjct:  111 SKLTLMNNWIYKYGKPQSILTDRGGNFESKYLKEKLGQLGIRQEFASPYQHQSNGLVERTIRTMRDLHVA 180          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.146e-11
Identity = 27/73 (36.99%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  106 SQWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAVLEEKRAKT 324
            ++WI K+G+P ++H D   N ++R + E  K  GI+  F+SPY+  ++ ++ER FRT +  I A L E   K 
Sbjct: 3344 NKWILKFGAPKELHVDCGKNFEARSIKELAKTAGIELIFSSPYHHNTNGIIERQFRTIREYINASLNEGGRKN 3416          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000009449.1 (SMESG000009449.1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.080e-11
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  139 QVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNIIAAV 300
            ++H D  +N QS    E CK L +KKT +SPYYPQS+ L+ER FR+ K +I + 
Sbjct:   97 RIHSDNGTNFQSELFKELCKTLKVKKTESSPYYPQSNGLIERAFRSMKELIQST 150          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000034046.1 (SMESG000034046.1)

HSP 1 Score: 54.6842 bits (130), Expect = 5.033e-10
Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  109 QWISKYGSPDQVH*DFESNLQSRFLPEYCKVLGIKKTFTSPYYPQSDELVERLFRTTKNII----AAVLEEK 312
            QWI K+G P  +  D     +S FL E   VLGI + F+SPY  QS+ LVE   RT +++I      V EEK
Sbjct:   41 QWIYKFGKPRSILSDRGKCFESAFLKEKLGVLGINQEFSSPYQHQSNGLVECTIRTMRDLITTSLGGVSEEK 112          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000006041.19.426e-734.38pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000025355.11.272e-634.38pep primary_assembly:Xenopus_tropicalis_v9.1:1:227... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YM866.616e-1244.29Retrovirus Pol polyprotein from transposon OS=Fasc... [more]
A0A5J4NFG79.654e-1245.07Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5J4NKR99.669e-1245.07Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5J4NXX01.063e-1145.07Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A2G8L0K31.847e-1141.79Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048272.12.464e-1241.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000055645.13.114e-1241.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052614.14.440e-1241.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031920.18.152e-1239.39pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000058127.19.908e-1239.39pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.17.010e-1340.58pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000040305.15.743e-1240.00pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000044989.12.163e-1136.84pep primary_assembly:ASM223467v1:1:17572028:175760... [more]
ENSORLT00000042487.12.357e-1136.84pep primary_assembly:ASM223467v1:4:23584510:235865... [more]
ENSORLT00000041485.17.174e-1037.50pep primary_assembly:ASM223467v1:15:30019002:30023... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001337.18.492e-2055.71SMESG000001337.1[more]
SMESG000015193.13.675e-1141.43SMESG000015193.1[more]
SMESG000029259.14.146e-1136.99SMESG000029259.1[more]
SMESG000009449.16.080e-1148.15SMESG000009449.1[more]
SMESG000034046.15.033e-1043.06SMESG000034046.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032720 ID=SMED30032720|Name=Retrovirus-related Pol polyprotein from transposon|organism=Schmidtea mediterranea sexual|type=transcript|length=468bp
ATATTAGTTGGTCAGCATTTTTATTACTTTGTTTGTGTACTCTTGACCGG
TGTAAGTTGAAAAACTTATTATCGCAAGTATTTAAATTCAAAAATTAGGG
TTAGGTCGCAATGGATTTCAAAGTACGGATCTCCGGATCAAGTACACTAA
GATTTTGAAAGTAACTTACAATCAAGATTTTTACCCGAATACTGTAAAGT
ATTAGGAATTAAGAAAACGTTTACATCACCATACTACCCACAGAGTGATG
AACTGGTAGAACGGTTATTTAGAACGACTAAAAACATAATTGCAGCGGTG
TTAGAGGAGAAAAGAGCAAAGACTGGTAATGGAGTTCGGATTAAGAATAA
AGGTTAATACGAAACACGTTCAAGACTATTACGTCCAGCAGCTGCAACTA
AATACATCAGACATTCACGAAAAAGTAAGAGAAAATATGGATATACAAAG
AGAGTATATCGCCAGCAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration