Chloride channel nucleotide sensitivea

Overview
NameChloride channel nucleotide sensitivea
Smed IDSMED30032708
Length (bp)555
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chloride channel nucleotide sensitivea (SMED30032708) t-SNE clustered cells

Violin plots show distribution of expression levels for Chloride channel nucleotide sensitivea (SMED30032708) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chloride channel nucleotide sensitivea (SMED30032708) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chloride channel nucleotide sensitivea (SMED30032708) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032708SMESG000026632.1 SmedASXL_005365SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30032708SMESG000026632.1 dd_Smed_v4_3584_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30032708SMESG000026632.1 dd_Smed_v4_3584_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032708SMESG000026632.1 SMED_08823_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032708SMESG000026632.1 SMED_08823_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032708SMESG000026632.1 SmWIOct06_004489GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Human
Match: CLNS1A (chloride nucleotide-sensitive channel 1A [Source:HGNC Symbol;Acc:HGNC:2080])

HSP 1 Score: 46.9802 bits (110), Expect = 3.108e-6
Identity = 31/110 (28.18%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF--------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HA+S D +     HL +M++             + +   D+  +  T  RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHP 137          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Human
Match: CLNS1A (chloride nucleotide-sensitive channel 1A [Source:HGNC Symbol;Acc:HGNC:2080])

HSP 1 Score: 47.3654 bits (111), Expect = 3.425e-6
Identity = 31/110 (28.18%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF--------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HA+S D +     HL +M++             + +   D+  +  T  RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHP 137          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Human
Match: CLNS1A (chloride nucleotide-sensitive channel 1A [Source:HGNC Symbol;Acc:HGNC:2080])

HSP 1 Score: 47.3654 bits (111), Expect = 3.425e-6
Identity = 31/110 (28.18%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF--------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HA+S D +     HL +M++             + +   D+  +  T  RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHP 137          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Zebrafish
Match: clns1a (chloride channel, nucleotide-sensitive, 1A [Source:ZFIN;Acc:ZDB-GENE-990415-259])

HSP 1 Score: 46.2098 bits (108), Expect = 5.453e-6
Identity = 38/133 (28.57%), Postives = 65/133 (48.87%), Query Frame = 2
Query:   92 NDAVQLFQNE-------KMIDSGSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDG----------------FTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            ++ V+L Q E       K +  G++ V+E+ L W  G  +   +    I++HA+S D ++FP  HL +M++                     D +  D ES  + T +RFV + +  L  M+SA+ +CQAL+P
Sbjct:   11 SEGVRLQQAETTAVLDGKRLGLGTLFVAEAQLSWFDGSGMGFCLEYPTISLHAISRDLSAFPEEHLYVMVNAKLDDEGEAAPLEKDPDEEDEDEEDSDSESSGEITEIRFVPSDKAALEPMFSAMCDCQALHP 143          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Mouse
Match: Clns1a (chloride channel, nucleotide-sensitive, 1A [Source:MGI Symbol;Acc:MGI:109638])

HSP 1 Score: 53.5286 bits (127), Expect = 1.743e-8
Identity = 33/109 (30.28%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF-------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HAVS D  ++P  HL +M++          + D    D++  +  +  RFV + +  L  M++A+ ECQAL+P
Sbjct:   33 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKLGEESKEPLSDEDEEDNDDVEPISEFRFVPSDKSALEAMFTAMCECQALHP 141          
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Match: sp|Q28678|ICLN_RABIT (Methylosome subunit pICln OS=Oryctolagus cuniculus OX=9986 GN=CLNS1A PE=2 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 2.881e-8
Identity = 34/109 (31.19%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF-------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HAVS D  ++P  HL +M++          V D +   D+  +  +  RFV   +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHP 136          
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Match: sp|P35521|ICLN_CANLF (Methylosome subunit pICln OS=Canis lupus familiaris OX=9615 GN=CLNS1A PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.867e-8
Identity = 32/108 (29.63%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HAVS D  ++P  HL +M++          +  +   D+  +     RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDLNAYPREHLYVMVNAKFGEESKESVAEEEDSDDDVEPIAEFRFVPSDKSALEAMFTAMCECQALHP 135          
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Match: sp|Q04753|ICLN_RAT (Methylosome subunit pICln OS=Rattus norvegicus OX=10116 GN=Clns1a PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 8.423e-8
Identity = 33/109 (30.28%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF-------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HAVS D  ++P  HL +M++            D    D++  +  +  RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNARFGEESKEPFSDEDEDDNDDVEPISEFRFVPSDKSALEAMFTAMCECQALHP 136          
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Match: sp|Q61189|ICLN_MOUSE (Methylosome subunit pICln OS=Mus musculus OX=10090 GN=Clns1a PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.349e-7
Identity = 33/109 (30.28%), Postives = 58/109 (53.21%), Query Frame = 2
Query:  116 NEKMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGF-------TVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            N K + +G++ ++ES L W  G  +  S+    I++HAVS D  ++P  HL +M++            D    D++  +  +  RFV + +  L  M++A+ ECQAL+P
Sbjct:   28 NGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKLGEESKEPPSDEDEEDNDDIEPISEFRFVPSDKSALEAMFTAMCECQALHP 136          
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Match: sp|P54106|ICLN_XENLA (Methylosome subunit pICln OS=Xenopus laevis OX=8355 GN=clns1a PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 8.908e-7
Identity = 32/113 (28.32%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLD-------------GFTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            + +  G++ ++ES L W +G  +  S+    I++HA+S D  ++P  HL +M++                  +    DD+ ++  T +RFV   + DL  M+SA+ +CQAL+P
Sbjct:   28 RGLGPGTLYIAESRLSWLNGSGLGFSLEYPSISLHAISRDTAAYPEEHLYVMVNSKLADKEDKEAHMADQEEEESEDDDDDEEPITEIRFVPGEKSDLGEMFSAMCDCQALHP 140          
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Match: A0A0R3U7F2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2753 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.010e-14
Identity = 50/169 (29.59%), Postives = 83/169 (49.11%), Query Frame = 2
Query:   80 ILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTD------HTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXXT---------------------------ILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGD 487
            + F  D V  ++  +++D G + ++ES++ W+GE++  S+    I +HAVS D      +  FP+ HLL+M+DG  V  N       + D+                            +LRFV + ++DL  +Y A+ ECQALNPD +   D  + ++E+    PEGD
Sbjct:   12 VCFVTDNVSFYEETRLLDKGKLTITESSISWNGEKLQFSLAYPNICLHAVSRDPYGGDENVKFPHPHLLLMVDGERVWSNGEPSISGEGDTGMEIDGGEDVSGEENGTDFPTDEEKASFVLRFVPSDQNDLDSLYDAIAECQALNPDPE---DFSENEFEDVQEEPEGD 177          
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Match: A0A3P6PUH9 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS275 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.827e-11
Identity = 44/161 (27.33%), Postives = 69/161 (42.86%), Query Frame = 2
Query:   68 SELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVS------TDHTSFPNSHLLMMLDGFTVIXXXXXXXXXX-----------------------------------XXXTILRFVMASEDDLRLMYSALNECQALNPDTD 427
             E  +    D + L+++ K++D GS+IVSES++ W G     S+P   I +HA+S       ++  FP  HL MM++G  V      +  +                                      + +LRFV   +  L  MY+A+ +CQALNPD D
Sbjct:    8 GEPGVHLIKDNISLYEDAKLLDHGSIIVSESSVTWRGNSHQFSLPYPNICLHAISQNPYGGAENVRFPQPHLFMMVEGERVWSTGQPEVHASGDVEMVDNANNHNTESGNSSGSEENGDSDFVNDDEQPTAVLRFVPDDQRALEEMYTAIADCQALNPDPD 168          
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Match: A0A293M7P2 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.994e-11
Identity = 43/132 (32.58%), Postives = 70/132 (53.03%), Query Frame = 2
Query:   80 ILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQ-INISIPCKKIAVHAVSTDHTSFPNSHLLMMLDG-------FTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDE 451
            I    +A + F   + +  G++ ++ES + W GE     S+    +A+HAVS D TSFP   L +M+DG        T  +  + ++  D  ++ +RFV  ++  L  MY A++ECQAL+PD    I  E+E
Sbjct:   14 IRHREEATEAFIQSRQLGKGTLFIAESRVSWVGENNTGFSLEYPSVALHAVSRDLTSFPQECLYLMIDGDLDEADPMTNENGDNENNTDDPVASEIRFVPENKSSLDAMYKAMSECQALHPDPTDSISEEEE 145          
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Match: A0A1S8WS68 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_06802 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.242e-11
Identity = 44/153 (28.76%), Postives = 67/153 (43.79%), Query Frame = 2
Query:  101 VQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTD-----------HTSFPNSHLLMMLDGFTVI----------------------------------XXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDT 424
            V LF+  + +D G+V++ E    W G+    S+P ++I +HA+S D             +FP+ HLL+M+DG                                       +Q    +   ++TILRFV    + L  MY+AL ECQALNPD+
Sbjct:   18 VSLFEGSQNLDVGTVVIDERCFTWEGQSRQFSVPYQQITLHAISKDPVMAAGDQPAPENTFPHPHLLVMIDGDRPYSPPHPNGQIAGEPMAIDGAEHSDTDGSNESQEDATSQGRASDCPGETTILRFVPQDPNALDTMYAALAECQALNPDS 170          
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Match: A0A075A4P5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12668 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 5.407e-11
Identity = 44/153 (28.76%), Postives = 67/153 (43.79%), Query Frame = 2
Query:  101 VQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTD-----------HTSFPNSHLLMMLDGFTVI----------------------------------XXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDT 424
            V LF+  + +D G+V++ E    W G+    S+P ++I +HA+S D             +FP+ HLL+M+DG                                       +Q    +   ++TILRFV    + L  MY+AL ECQALNPD+
Sbjct:   18 VSLFEGSQNLDVGTVVIDERCFTWEGQSRQFSVPYQQITLHAISKDPVMAAGDQPAPENTFPHPHLLVMIDGDRPYSPPHPNGQIAGEPMAIDGAEHSDTDGSNESQEDATSQGRASDCPGETTILRFVPQDPNALDTMYAALAECQALNPDS 170          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Cavefish
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:103029541])

HSP 1 Score: 50.447 bits (119), Expect = 1.369e-7
Identity = 34/116 (29.31%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDG----------------FTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            K + +G++ V+ES L W  G  +  S+    I++HA+S D +++P  HL +M++                     +    DD+ +   T +RFV + +  L  M+SA+ ECQAL+P
Sbjct:   28 KRLGTGTLYVAESRLSWLDGSGMGFSLEYPTISLHAISRDVSAYPQEHLYVMVNKKLDDENEAEMQERAPDDEGEEESDNDDDDEGVITEIRFVPSDKAALEAMFSAMCECQALHP 143          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Cavefish
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:103029541])

HSP 1 Score: 50.447 bits (119), Expect = 1.416e-7
Identity = 34/116 (29.31%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIW-HGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDG----------------FTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            K + +G++ V+ES L W  G  +  S+    I++HA+S D +++P  HL +M++                     +    DD+ +   T +RFV + +  L  M+SA+ ECQAL+P
Sbjct:   28 KRLGTGTLYVAESRLSWLDGSGMGFSLEYPTISLHAISRDVSAYPQEHLYVMVNKKLDDENEAEMQERAPDDEGEEESDNDDDDEGVITEIRFVPSDKAALEAMFSAMCECQALHP 143          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:101164421])

HSP 1 Score: 55.4546 bits (132), Expect = 2.235e-9
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDG-FTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            + +  G++ V+E+ L W  G  +  S+    I++HA+S D +++P  HL +M++G   +    S + + ++  T +RFV   +  L  M+SA+ ECQAL+P
Sbjct:   28 QQLGCGTLYVAETRLSWFDGSGMGFSLEYPSISLHAISRDVSAYPEEHLYVMVNGKLDLGFLDSSNGDEEEVITEIRFVPRDKASLESMFSAMCECQALHP 128          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:101164421])

HSP 1 Score: 52.373 bits (124), Expect = 1.799e-8
Identity = 32/108 (29.63%), Postives = 59/108 (54.63%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXX--------XXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            + +  G++ V+E+ L W  G  +  S+    I++HA+S D +++P  HL +M++G      +        S + + ++  T +RFV   +  L  M+SA+ ECQAL+P
Sbjct:   28 QQLGCGTLYVAETRLSWFDGSGMGFSLEYPSISLHAISRDVSAYPEEHLYVMVNGKLEKAAEEEDDDGSDSSNGDEEEVITEIRFVPRDKASLESMFSAMCECQALHP 135          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:101164421])

HSP 1 Score: 49.2914 bits (116), Expect = 3.410e-7
Identity = 32/117 (27.35%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXX-----------------TILRFVMASEDDLRLMYSALNECQALNP 418
            + +  G++ V+E+ L W  G  +  S+    I++HA+S D +++P  HL +M++G    + ++   E   +                  T +RFV   +  L  M+SA+ ECQAL+P
Sbjct:   28 QQLGCGTLYVAETRLSWFDGSGMGFSLEYPSISLHAISRDVSAYPEEHLYVMVNGKLGGEGEAEMTEKAAEEEDDDGSDSSNGDEEEVITEIRFVPRDKASLESMFSAMCECQALHP 144          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:101164421])

HSP 1 Score: 49.2914 bits (116), Expect = 4.154e-7
Identity = 32/117 (27.35%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  122 KMIDSGSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXX-----------------TILRFVMASEDDLRLMYSALNECQALNP 418
            + +  G++ V+E+ L W  G  +  S+    I++HA+S D +++P  HL +M++G    + ++   E   +                  T +RFV   +  L  M+SA+ ECQAL+P
Sbjct:   28 QQLGCGTLYVAETRLSWFDGSGMGFSLEYPSISLHAISRDVSAYPEEHLYVMVNGKLGGEGEAEMTEKAAEEEDDDGSDSSNGDEEEVITEIRFVPRDKASLESMFSAMCECQALHP 144          
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Match: clns1a (chloride nucleotide-sensitive channel 1A [Source:NCBI gene;Acc:101164421])

HSP 1 Score: 46.2098 bits (108), Expect = 3.942e-6
Identity = 31/100 (31.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:  137 GSVIVSESALIWH-GEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIX-----XXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNP 418
            G + V+   L W  G  +  S+    I++HA+S D +++P  HL +M++G    +     + S + + ++  T +RFV   +  L  M+SA+ ECQAL+P
Sbjct:   31 GLIHVARVRLSWFDGSGMGFSLEYPSISLHAISRDVSAYPEEHLYVMVNGKLGEEEDDDGSDSSNGDEEEVITEIRFVPRDKASLESMFSAMCECQALHP 130          
BLAST of Chloride channel nucleotide sensitivea vs. Planmine SMEST
Match: SMESG000026632.1 (SMESG000026632.1)

HSP 1 Score: 285.804 bits (730), Expect = 4.023e-100
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:   50 MMLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA 511
            MMLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA
Sbjct:    1 MMLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA 154          
BLAST of Chloride channel nucleotide sensitivea vs. Planmine SMEST
Match: SMESG000026632.1 (SMESG000026632.1)

HSP 1 Score: 283.878 bits (725), Expect = 2.348e-99
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 2
Query:   53 MLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA 511
            MLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA
Sbjct:    1 MLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQFDDA 153          
BLAST of Chloride channel nucleotide sensitivea vs. Planmine SMEST
Match: SMESG000026632.1 (SMESG000026632.1)

HSP 1 Score: 231.876 bits (590), Expect = 4.818e-79
Identity = 129/130 (99.23%), Postives = 129/130 (99.23%), Query Frame = 2
Query:  125 MIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIXXXXXXXXXXXXXTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDS-EDEDYENGYIGPEGDNTGQFDDA 511
            MIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDS EDEDYENGYIGPEGDNTGQFDDA
Sbjct:    1 MIDSGSVIVSESALIWHGEQINISIPCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRFVMASEDDLRLMYSALNECQALNPDTDCEIDSEEDEDYENGYIGPEGDNTGQFDDA 130          
The following BLAST results are available for this feature:
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CLNS1A3.108e-628.18chloride nucleotide-sensitive channel 1A [Source:H... [more]
CLNS1A3.425e-628.18chloride nucleotide-sensitive channel 1A [Source:H... [more]
CLNS1A3.425e-628.18chloride nucleotide-sensitive channel 1A [Source:H... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clns1a5.453e-628.57chloride channel, nucleotide-sensitive, 1A [Source... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Clns1a1.743e-830.28chloride channel, nucleotide-sensitive, 1A [Source... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28678|ICLN_RABIT2.881e-831.19Methylosome subunit pICln OS=Oryctolagus cuniculus... [more]
sp|P35521|ICLN_CANLF5.867e-829.63Methylosome subunit pICln OS=Canis lupus familiari... [more]
sp|Q04753|ICLN_RAT8.423e-830.28Methylosome subunit pICln OS=Rattus norvegicus OX=... [more]
sp|Q61189|ICLN_MOUSE1.349e-730.28Methylosome subunit pICln OS=Mus musculus OX=10090... [more]
sp|P54106|ICLN_XENLA8.908e-728.32Methylosome subunit pICln OS=Xenopus laevis OX=835... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U7F23.010e-1429.59Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P6PUH91.827e-1127.33Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A293M7P23.994e-1132.58Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A1S8WS685.242e-1128.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A075A4P55.407e-1128.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clns1a1.369e-729.31chloride nucleotide-sensitive channel 1A [Source:N... [more]
clns1a1.416e-729.31chloride nucleotide-sensitive channel 1A [Source:N... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clns1a2.235e-931.68chloride nucleotide-sensitive channel 1A [Source:N... [more]
clns1a1.799e-829.63chloride nucleotide-sensitive channel 1A [Source:N... [more]
clns1a3.410e-727.35chloride nucleotide-sensitive channel 1A [Source:N... [more]
clns1a4.154e-727.35chloride nucleotide-sensitive channel 1A [Source:N... [more]
clns1a3.942e-631.00chloride nucleotide-sensitive channel 1A [Source:N... [more]
back to top
BLAST of Chloride channel nucleotide sensitivea vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026632.14.023e-100100.00SMESG000026632.1[more]
SMESG000026632.12.348e-99100.00SMESG000026632.1[more]
SMESG000026632.14.818e-7999.23SMESG000026632.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032708 ID=SMED30032708|Name=Chloride channel nucleotide sensitivea|organism=Schmidtea mediterranea sexual|type=transcript|length=555bp
CTCTTCCGATCTTTTTTTTTATTCAAATTTTATTGAAATTTAATTTTTCA
TGATGCTTGAAAATAATAGTGAATTAAACATTTTATTTTCTAATGACGCG
GTTCAGTTATTTCAAAATGAAAAAATGATAGATTCAGGATCAGTAATTGT
TAGTGAGAGTGCGCTTATATGGCATGGAGAACAAATAAATATTTCTATAC
CATGTAAAAAAATCGCAGTTCATGCAGTTTCTACAGATCACACCAGTTTT
CCAAACAGTCATTTGTTAATGATGCTGGATGGATTTACCGTAATTGATAA
TCAGTCAATGGATGATGAATCAGACGATGATTCTACAATTTTGAGATTCG
TTATGGCATCGGAAGACGACTTACGCTTAATGTACTCAGCTTTAAATGAA
TGTCAAGCTTTAAATCCAGATACTGATTGTGAAATTGATAGCGAAGATGA
AGATTATGAAAATGGATATATCGGCCCAGAAGGAGATAACACTGGTCAAT
TCGATGATGCATAAATTTGTAATTGTTGTTAATAAAAATTTATCTGTAAA
AAAAA
back to top

protein sequence of SMED30032708-orf-1

>SMED30032708-orf-1 ID=SMED30032708-orf-1|Name=SMED30032708-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MMLENNSELNILFSNDAVQLFQNEKMIDSGSVIVSESALIWHGEQINISI
PCKKIAVHAVSTDHTSFPNSHLLMMLDGFTVIDNQSMDDESDDDSTILRF
VMASEDDLRLMYSALNECQALNPDTDCEIDSEDEDYENGYIGPEGDNTGQ
FDDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039924ICln/Lot5
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0000387spliceosomal snRNP assembly
GO:0006821chloride transport
GO:0006884cell volume homeostasis
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005886plasma membrane
GO:0034709methylosome
GO:0034715pICln-Sm protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR039924ICln/Lot5PFAMPF03517Voldacscoord: 31..138
e-value: 1.5E-19
score: 70.5
IPR039924ICln/Lot5PANTHERPTHR21399CHLORIDE CONDUCTANCE REGULATORY PROTEIN ICLNcoord: 11..142
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 2..130
e-value: 6.1E-24
score: 86.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..154
NoneNo IPR availablePANTHERPTHR21399:SF0METHYLOSOME SUBUNIT PICLNcoord: 11..142