Rhodopsin

Overview
NameRhodopsin
Smed IDSMED30032702
Length (bp)1271
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rhodopsin (SMED30032702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rhodopsin (SMED30032702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30032702SMESG000025307.1 dd_Smed_v4_12867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032702SMESG000025307.1 dd_Smed_v4_12867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032702SMESG000025307.1 dd_Smed_v6_12867_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30032702SMESG000025307.1 dd_Smed_v6_12867_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rhodopsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 157.532 bits (397), Expect = 1.297e-42
Identity = 111/347 (31.99%), Postives = 181/347 (52.16%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFN--NLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC-------QKKQSQT-----TQNLSTITRHV 1048
             V  P+   Y + G  IL +GL G + N  VI  F RS+ L TP+N+F+ +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T    + +R+ + ++  W   +  S+PP  GW+ YV EGL  SCS+D    +   ++YTMLL    F L L  II CY+ IF  +R+  + ++       N  +L + +  + E K+  +   V L FVLSW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC        ++ S+      + + ST+T H 
Sbjct:   62 TVDVPDHAHYTL-GTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTP----YMSSVPAVIAKASAIHNPIIYAITHPKYR------VAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHT 397          
BLAST of Rhodopsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 149.443 bits (376), Expect = 1.310e-39
Identity = 111/358 (31.01%), Postives = 181/358 (50.56%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIR-----------SKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFN--NLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC-------QKKQSQT-----TQNLSTITRHV 1048
             V  P+   Y + G  IL +GL G + N  VI  F R           S+ L TP+N+F+ +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T    + +R+ + ++  W   +  S+PP  GW+ YV EGL  SCS+D    +   ++YTMLL    F L L  II CY+ IF  +R+  + ++       N  +L + +  + E K+  +   V L FVLSW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC        ++ S+      + + ST+T H 
Sbjct:   62 TVDVPDHAHYTL-GTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTP----YMSSVPAVIAKASAIHNPIIYAITHPKYR------VAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHT 408          
BLAST of Rhodopsin vs. Ensembl Human
Match: OPN4 (opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449])

HSP 1 Score: 149.443 bits (376), Expect = 1.733e-39
Identity = 110/354 (31.07%), Postives = 180/354 (50.85%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIR-----------SKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFN--NLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC-------QKKQSQT-----TQNLSTITRHV 1048
            P+   Y + G  IL +GL G + N  VI  F R           S+ L TP+N+F+ +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T    + +R+ + ++  W   +  S+PP  GW+ YV EGL  SCS+D    +   ++YTMLL    F L L  II CY+ IF  +R+  + ++       N  +L + +  + E K+  +   V L FVLSW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC        ++ S+      + + ST+T H 
Sbjct:   66 PDHAHYTL-GTVILLVGLTGMLGNLTVIYTFCRAVLRGVTVMMQSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTP----YMSSVPAVIAKASAIHNPIIYAITHPKYR------VAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHT 408          
BLAST of Rhodopsin vs. Ensembl Human
Match: RRH (retinal pigment epithelium-derived rhodopsin homolog [Source:HGNC Symbol;Acc:HGNC:10450])

HSP 1 Score: 122.479 bits (306), Expect = 8.876e-31
Identity = 90/322 (27.95%), Postives = 153/322 (47.52%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNN--LQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQS 1009
             GSV ++ E   ++I   Y++  G+   I N  V+ +FI+ K L TP+N  + +L  +D  + +IG+P    S  Y SW F  +GC VYA      GM SI +L V+AV+R+  +  P    + +T    I  ++  W  G+  ++ P++GW  Y  +    +C+ +         SYTM +I   F++ LT +  CY  +   ++          T+S N     +I  +K+   +I M       F+++W PY++V + A      +    + +  P  FAKS T  NP IY++   +F+R +      L    CQ  Q+
Sbjct:   16 DGSVFSQTE---HNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPTNAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVAVDRYLTICLP-DVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRKNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTS---DCTESLNRDWSDQIDVTKMSVIMICM-------FLVAWSPYSIVCLWASFGDPKKIPPPMAIIAP-LFAKSSTFYNPCIYVVANKKFRRAM------LAMFKCQTHQT 316          
BLAST of Rhodopsin vs. Ensembl Human
Match: RHO (rhodopsin [Source:HGNC Symbol;Acc:HGNC:10012])

HSP 1 Score: 111.309 bits (277), Expect = 9.050e-27
Identity = 86/334 (25.75%), Postives = 157/334 (47.01%), Query Frame = 2
Query:   77 EAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTM---LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGS---VLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAV 1060
            E + + +   Y+  + + G   N   + V ++ K L TP N  + +L  +D  +   GF   + +S +  ++F  +GC +  F  ++ G  +++ L V+A+ER+  V  P+   +      +I  V   W + +  + PPL GW+RY+ EGLQ SC  D +    +  + +    + +  F + +  I  CY ++ F V++   + +          +     K E+++  M   + + F++ W PYA V       + T +GS    + + IPA+FAKS  I NPVIYI+   QF+       C+L  I C K      +  +T+++   S V
Sbjct:   33 EPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFR-FGENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQ----------ESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFY----IFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRN------CMLTTICCGKNPLGDDEASATVSKTETSQV 345          
BLAST of Rhodopsin vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 83.9593 bits (206), Expect = 1.886e-17
Identity = 82/362 (22.65%), Postives = 149/362 (41.16%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYV--LEGLQISCSFDMFDTSWQSKSYTML-LIGTFLLILTAIIICYVKIFFKVRDQIK-EMRIVYTKS--------------------------FNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTIL---------ALCNVLTEKGSVLIVAIPAYFAKSFT-ICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTT 1018
            H  +  +P   V   + +  L I L G + N  V+ + ++ + L T  NIF+ +L  S+ L+C    P   +++ Y+ W F    C +       +   S F L  IA++R+N V  P +  + ++ + ++   +  W + V++ +P   GW   V  L GL      + +  +   K YT L LI  FL     +  CY  IF ++R +++ +++ +  +S                            N QR+     +R+   +   + L F  +W P+ +VT++         +     T      IV++ A+     T + NP +Y    P FK  L K L    + P      QT+
Sbjct:   16 HPDMTNEPTVLV--TFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHK--QKLSSRSAMMIALLIWVISVVVCMP--YGWYMDVEKLNGLCGEYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTS 371          
BLAST of Rhodopsin vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 83.5741 bits (205), Expect = 2.696e-17
Identity = 82/362 (22.65%), Postives = 149/362 (41.16%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYV--LEGLQISCSFDMFDTSWQSKSYTML-LIGTFLLILTAIIICYVKIFFKVRDQIK-EMRIVYTKS--------------------------FNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTIL---------ALCNVLTEKGSVLIVAIPAYFAKSFT-ICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTT 1018
            H  +  +P   V   + +  L I L G + N  V+ + ++ + L T  NIF+ +L  S+ L+C    P   +++ Y+ W F    C +       +   S F L  IA++R+N V  P +  + ++ + ++   +  W + V++ +P   GW   V  L GL      + +  +   K YT L LI  FL     +  CY  IF ++R +++ +++ +  +S                            N QR+     +R+   +   + L F  +W P+ +VT++         +     T      IV++ A+     T + NP +Y    P FK  L K L    + P      QT+
Sbjct:   41 HPDMTNEPTVLV--TFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHK--QKLSSRSAMMIALLIWVISVVVCMP--YGWYMDVEKLNGLCGEYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTS 396          
BLAST of Rhodopsin vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 83.1889 bits (204), Expect = 3.541e-17
Identity = 82/362 (22.65%), Postives = 149/362 (41.16%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYV--LEGLQISCSFDMFDTSWQSKSYTML-LIGTFLLILTAIIICYVKIFFKVRDQIK-EMRIVYTKS--------------------------FNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTIL---------ALCNVLTEKGSVLIVAIPAYFAKSFT-ICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTT 1018
            H  +  +P   V   + +  L I L G + N  V+ + ++ + L T  NIF+ +L  S+ L+C    P   +++ Y+ W F    C +       +   S F L  IA++R+N V  P +  + ++ + ++   +  W + V++ +P   GW   V  L GL      + +  +   K YT L LI  FL     +  CY  IF ++R +++ +++ +  +S                            N QR+     +R+   +   + L F  +W P+ +VT++         +     T      IV++ A+     T + NP +Y    P FK  L K L    + P      QT+
Sbjct:   59 HPDMTNEPTVLV--TFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHK--QKLSSRSAMMIALLIWVISVVVCMP--YGWYMDVEKLNGLCGEYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTS 414          
BLAST of Rhodopsin vs. Ensembl Celegans
Match: npr-5 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6F3C9])

HSP 1 Score: 77.0258 bits (188), Expect = 4.466e-15
Identity = 81/374 (21.66%), Postives = 163/374 (43.58%), Query Frame = 2
Query:   95 IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNR-----YVLEGLQISCSFDMFDTSWQSKSY-----TMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTE--KGSVLIVAIPAY-FAKSFTICNPVIYI-LNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENLRGNRNSISETLIKMDCE 1174
            +YG ++  +G+FG   NG V+    R+K L +  N+F+ +L+ +D ++     P     +  + W F    C++   S S +   + + L  I++++F  +  P  T + V++++++      W +  +I++P L+ +       YV  G    C     + +WQS++      T +++  F++ +  I  CY KI  KV   +      + +S    QR   +  ++K+ Y+   + + F+  W P  ++ ++       E  K      AI A+  A S  + NP+++  L   Q +  L K+L              +T+ +S+    V              N+IR S     R N + + +  + +DCE
Sbjct:   61 LYG-FLFVLGIFG---NGGVLWAVARNKRLQSARNVFLLNLIFTDLILVFTAIPVTPWYAMTKDWAFGSVMCHLVPLSNSCSVFVTSWSLTAISLDKFLHINDP--TKQPVSIRQALAITFLIWIVSTLINLPYLMSFEHVDGSFYVQPGETPYCGHFCDEANWQSENSRKIYGTTVMLLQFVVPMAVITYCYFKILQKVSKDMIIQNAQFCQSLTQKQRSDATSRKKKVNYILIAMVVTFIGCWLPLTLLNLVKDFKKEPEWLKRQPFFWAINAHVIAMSLVVWNPLLFFWLTRKQKRSGLSKIL-------------NSTEIVSSFASRVS-------------NSIRRSTFR--RNNIDRVRKKQVVLDCE 400          
BLAST of Rhodopsin vs. Ensembl Celegans
Match: npr-5 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q6F3C9])

HSP 1 Score: 75.0998 bits (183), Expect = 1.364e-14
Identity = 69/306 (22.55%), Postives = 141/306 (46.08%), Query Frame = 2
Query:   95 IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNR-----YVLEGLQISCSFDMFDTSWQSKSY-----TMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTE--KGSVLIVAIPAY-FAKSFTICNPVIYI-LNYPQFKRELYKLL 970
            +YG ++  +G+FG   NG V+    R+K L +  N+F+ +L+ +D ++     P     +  + W F    C++   S S +   + + L  I++++F  +  P  T + V++++++      W +  +I++P L+ +       YV  G    C     + +WQS++      T +++  F++ +  I  CY KI  KV   +      + +S    QR   +  ++K+ Y+   + + F+  W P  ++ ++       E  K      AI A+  A S  + NP+++  L   Q +  L K+L
Sbjct:   61 LYG-FLFVLGIFG---NGGVLWAVARNKRLQSARNVFLLNLIFTDLILVFTAIPVTPWYAMTKDWAFGSVMCHLVPLSNSCSVFVTSWSLTAISLDKFLHINDP--TKQPVSIRQALAITFLIWIVSTLINLPYLMSFEHVDGSFYVQPGETPYCGHFCDEANWQSENSRKIYGTTVMLLQFVVPMAVITYCYFKILQKVSKDMIIQNAQFCQSLTQKQRSDATSRKKKVNYILIAMVVTFIGCWLPLTLLNLVKDFKKEPEWLKRQPFFWAINAHVIAMSLVVWNPLLFFWLTRKQKRSGLSKIL 360          
BLAST of Rhodopsin vs. Ensembl Fly
Match: Rh6 (gene:FBgn0019940 transcript:FBtr0347603)

HSP 1 Score: 134.035 bits (336), Expect = 3.490e-35
Identity = 93/322 (28.88%), Postives = 154/322 (47.83%), Query Frame = 2
Query:   77 EAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFK---RELYKLLCVLKQIPCQKKQSQTTQNLS 1030
            E   + I G  I  +G      N  V+ +F  SK L TPSN+FV +L  SDF++    FP ++L+ FY +WI     C +Y    S+ G  SI+ + +IA +R+  +   +   K +T   ++  ++  WT+    ++ PL GWNRYV EG   +C  D F   W ++SY ++  +  +L  L  II         +R+Q K+M +    S  N +  K   +E KL  +       +  +W PY ++    +   +    S L     + FAK+  +CNP++Y L++P++K   RE    L   K       ++Q T  +S
Sbjct:   43 EPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMAR-KPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFAVAAHEKAMREQAKKMNVA---SLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESM--HLSPLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGKDDLTSDSRTQATAEIS 358          
BLAST of Rhodopsin vs. Ensembl Fly
Match: Rh2 (gene:FBgn0003248 transcript:FBtr0083697)

HSP 1 Score: 127.102 bits (318), Expect = 1.969e-32
Identity = 88/346 (25.43%), Postives = 170/346 (49.13%), Query Frame = 2
Query:   29 EMKNLTMFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFF---------KVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK--LLCVLKQIPCQKKQSQTTQNLST 1033
            +M +L   + S     +  +  I G++ L I +  C  NG V+ +F  +K L TP+N+ V +L  SDF +     P ++++ +Y++W+     C +YA   S+ G  SI+ + +IA +R+N +   +     +T+K SI  ++  W + V  ++ PL+GW+ YV EG   +CS D     W  +SY ++    F+      +ICY   F           +R+Q K+M +   +S  +  +  E K+ +  +     ++L+F ++W PY ++    L  +  +  + L     A FAK+  + NP++Y +++P+++  L +   +CV       K  +  +   +T
Sbjct:   37 DMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTP-MTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSY-LITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALT---TISLWF-MAWTPYLVICYFGLFKI--DGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETT 374          
BLAST of Rhodopsin vs. Ensembl Fly
Match: ninaE (gene:FBgn0002940 transcript:FBtr0083857)

HSP 1 Score: 122.479 bits (306), Expect = 7.415e-31
Identity = 82/321 (25.55%), Postives = 157/321 (48.91%), Query Frame = 2
Query:  104 VYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFF---------KVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK--LLCVLKQIPCQKKQSQTTQNLST 1033
             Y++ IG+     NG VI +F  +K L TP+N+ V +L  SDF I     P + ++ ++++W+     C +YA   S  G  SI+ + +I+++R+  +   +   + +T+  ++  +   W +  I  + P  GW+RYV EG   SC  D  +  W  +SY ++    F+  +   +ICY   F           +R+Q K+M +   +S  + ++  E K+ +  +     +TL+F ++W PY ++  + L     E  + L     A FAKS    NP++Y +++P+++  L +    CV  ++   K     +Q  ++
Sbjct:   55 AYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAG-RPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSY-LIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVAL---VTITLWF-MAWTPYLVINCMGLFKF--EGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATAS 367          
BLAST of Rhodopsin vs. Ensembl Fly
Match: Rh7 (gene:FBgn0036260 transcript:FBtr0076020)

HSP 1 Score: 118.627 bits (296), Expect = 6.551e-29
Identity = 97/365 (26.58%), Postives = 170/365 (46.58%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPL--VGWNRYVLEGLQISCSFDMFDTSWQSKSYTML-LIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKE-SKVERKLIYMGFNVTLFFVLSWGPYAMVTIL---ALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLL---CVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENLRGNRN 1138
            P++  + I       I + GC+ N  VI +F   K L TP+NI V +L   DFL+  I  P  + ++  +        C +Y F   ++G  +I  L  IA++R+N V +PLQ ++  +  RS   ++  W    + ++ P   +G + YV EG   +CSFD  +    ++ +  L  +  + + LT+I+  Y  I          +++V+T S   +Q  K+ +K E+KL ++   +   + L+W PYA+V ++    L   +T  GS+    IPA F K+    +P +Y   +P+F+ E+  L     VL+++        +T   S +TR   S         T    + +   EN   N N
Sbjct:  111 PKSSTFLIMAALYCLISVVGCVGNAFVIFMFANRKSLRTPANILVMNLAICDFLML-IKCPIAIYNNIKEGPALGDIACRLYGFVGGLSGTCAIGTLTAIALDRYNVVVHPLQPLRRCSRLRSYLIILLIWCYSFLFAVMPALDIGLSVYVPEGFLTTCSFDYLNKEMPARIFMALFFVAAYCIPLTSIVYSYFYI----------LKVVFTAS--RIQSNKDKAKTEQKLAFIVAAIIGLWFLAWSPYAIVAMMGVFGLERHITPLGSM----IPALFCKTAACVDPYLYAATHPRFRVEVRMLFYGRGVLRRV--------STTRSSYMTRSRSSFTHRLRTSTTGEGGMGDHRMENYLMNNN 450          
BLAST of Rhodopsin vs. Ensembl Fly
Match: Rh5 (gene:FBgn0014019 transcript:FBtr0342591)

HSP 1 Score: 107.842 bits (268), Expect = 1.192e-25
Identity = 83/322 (25.78%), Postives = 153/322 (47.52%), Query Frame = 2
Query:   47 MFHGSVVTKPEAFVYDIYGVYILFI-----GLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVG-WNRYVLEGLQISCSFDMFDTSWQSKSY-TMLLIGTFLLILTAIIICYVKIFFKVR-------DQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLL 970
            M H       EA +Y   G YI FI      +FG   NG VI +F  SK L TPSN+ + +L   D  +CT   P  ++++     +    GC +YA +  I+GM +      IA +R+  +  P+     ++  + +  ++  W      S+ PL   W RY  EG   +CSFD    + +++ +   + + ++++ +T I++ Y K+F  VR       +Q K+M +   KS +         VE ++      + + F+L+W PY++V ++  C    +  +  +  +P    KS +  +P +Y  ++P+++ EL + L
Sbjct:   36 MVHAHWRGFREAPIYYHAGFYIAFIVLMLSSIFG---NGLVIWIFSTSKSLRTPSNLLILNLAIFDLFMCT-NMPHYLINATVGYIVGGDLGCDIYALNGGISGMGASITNAFIAFDRYKTISNPID--GRLSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLTTCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNV---KSLSANANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIG-CFGEQQLITPFVSMLPCLACKSVSCLDPWVYATSHPKYRLELERRL 347          
BLAST of Rhodopsin vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 175.637 bits (444), Expect = 1.055e-48
Identity = 105/315 (33.33%), Postives = 174/315 (55.24%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQK 1000
             V  P+   Y I G  IL +G+ G + N  VI  F RS+ L TP+N+F+ +L  +DFL+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  ++  W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  II CY  IF  +R   + + +I      ++++R +  K E K+  +   V L +V+SW PY+ V + A     ++  +  + ++PA  AK+  I NP+IY + +P+++      L + K IPC +
Sbjct:   67 TVDVPDHAHYTI-GAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQAPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAG-YSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYR------LAIAKYIPCLR 373          
BLAST of Rhodopsin vs. Ensembl Zebrafish
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 175.637 bits (444), Expect = 1.209e-48
Identity = 105/315 (33.33%), Postives = 174/315 (55.24%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQK 1000
             V  P+   Y I G  IL +G+ G + N  VI  F RS+ L TP+N+F+ +L  +DFL+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  ++  W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  II CY  IF  +R   + + +I      ++++R +  K E K+  +   V L +V+SW PY+ V + A     ++  +  + ++PA  AK+  I NP+IY + +P+++      L + K IPC +
Sbjct:   68 TVDVPDHAHYTI-GAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQAPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAG-YSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYR------LAIAKYIPCLR 374          
BLAST of Rhodopsin vs. Ensembl Zebrafish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 171.4 bits (433), Expect = 3.005e-47
Identity = 103/317 (32.49%), Postives = 174/317 (54.89%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKS--FNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQ 985
            P+   Y I G  IL +G+ G + N  V+  F +S+ L TP+N+F+ +L  +DFL+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L +IAV+R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SCS+D    S   ++YTMLL    F + L  II CY  IF  +R+  + +  +  +    +++++I   K E K+  +   V L +V+SW PY+ V + A     ++LT      + ++PA  AK+  I NP+IY + +P+++  + K       LLCV ++
Sbjct:   64 PDHAHYTI-GSVILAVGITGMVGNLLVMYAFCKSRSLRTPANMFIINLAVTDFLMCVTQTPIFFTTSLHKRWIFGEKGCELYAFCGALFGICSMITLMIIAVDRYFVITRPLASIGVMSRKRALLILSAAWAYSMGWSLPPFFGWSAYVPEGLLTSCSWDYMTFSPSVRAYTMLLFTFVFFIPLFVIIYCYFFIFKAIRETNRAVGKINGEGGPRDSIKKIHRMKNEWKMAKIALIVILLYVISWSPYSCVALTAFAGYADMLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYRSAIAKYIPCLGVLLCVPRR 375          
BLAST of Rhodopsin vs. Ensembl Zebrafish
Match: opn4.1 (opsin 4.1 [Source:NCBI gene;Acc:352918])

HSP 1 Score: 158.688 bits (400), Expect = 4.219e-43
Identity = 98/310 (31.61%), Postives = 167/310 (53.87%), Query Frame = 2
Query:   65 VTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNL-QRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQI 988
            V  P+   Y I G  IL +G+ G I N  V+ VF RS+ L T  N+F+ +L  +DFL+     P    +S ++ W+F    C +YAF  ++ G+ S+  L  IA +R  A+  PL  V  V+ +++   ++  W   +  S+PP  GW+ YV EGLQ SCS+D    +   ++YT+LL +  F + L  I  CY  IF  +R   KE+R +     + + +R++    E K+  +   V + F++SW PY++V + A     +   +  + ++PA  AK+  I NP+IY + +P+++  + + + VL+ I
Sbjct:   57 VDVPDHAHY-IIGSVILIVGITGVIGNALVVYVFCRSRTLRTAGNMFIVNLAVADFLMSVTQSPVFFAASLHRRWVFGERPCELYAFCGALFGICSMMTLTAIAADRCLAITQPLALVSRVSRRKAGAVLVVVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTPSVRAYTILLFVFVFFIPLGIIGSCYFAIFQTIRAAGKEIRELDCGETHKVYERMQN---EWKMAKVALVVIVLFIISWSPYSVVALTATAG-YSHFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRVAIARYIPVLRPI 361          
BLAST of Rhodopsin vs. Ensembl Zebrafish
Match: opn4xb (opsin 4xb [Source:NCBI gene;Acc:563080])

HSP 1 Score: 154.836 bits (390), Expect = 1.923e-42
Identity = 96/295 (32.54%), Postives = 161/295 (54.58%), Query Frame = 2
Query:   86 VYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKREL 958
            V+ I    IL IG  G   N  V+  F  +K L +  N F+ +L  SDFL+     P   ++  Y+ W+F   GC +YAF  ++ G+ S+  L  I+++R+  +  PLQT++  + +R+   ++C W   +  S+ PL+GW+ Y+ EGL  SC++D    S  +KSYTM+L    F + L+ I+ CY+ +F  VR   +++ ++ ++  ++  + +  + E KL  +   V + +VLSW PYA VT++A     +VLT     L    PA  AKS  I NP IY + + +++  L
Sbjct:   17 VHYIIAFLILIIGTLGVSGNALVMFAFYSNKKLRSLPNYFIMNLAVSDFLMAITQSPIFFINCLYKEWMFGELGCKIYAFCGALFGITSMINLLAISIDRYLVITKPLQTIQWNSKRRTGLAILCIWLYSLAWSLAPLIGWSSYIPEGLMTSCTWDYVSPSPANKSYTMMLCCFVFFIPLSIILYCYLFMFLSVRQASRDLEMLSSQK-SSFVKQQSMRSEWKLAKIAAVVIVVYVLSWAPYACVTLVAWAGHQDVLTPYSKTL----PAVLAKSSAIYNPFIYAIIHNKYRATL 306          
BLAST of Rhodopsin vs. Ensembl Xenopus
Match: ENSXETT00000039733.1 (melanopsin-B-like [Source:NCBI gene;Acc:100485437])

HSP 1 Score: 164.466 bits (415), Expect = 7.705e-45
Identity = 103/308 (33.44%), Postives = 167/308 (54.22%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKES-KVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLI---VAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLK 982
            P   +Y I G +IL IG  G I N  V+  F  +K L T  N F+ +L  SDFL+     P   LSS ++ WI    GC VYAF  ++ G+ S+  L  I+V R+  +  PLQ+++  + KR++  ++  W    + S+ PL+GW+ YV EGL+ISC++D   ++  +KSYTM+L    F + L  I  CY  +F  +R   + ++ +   S+     +  + K E K+  + F + + +VLSW PYA VT++A        G  L      +PA  AK+  I NP+IY + +P+++  ++K +  L+
Sbjct:   25 PAQVLYTI-GSFILIIGFVGIIGNLLVLYAFYSNKKLRTAPNYFIMNLAISDFLMSATQAPVCFLSSLHREWILGEIGCNVYAFCGALFGITSMMTLLAISVNRYIVITKPLQSIQWSSKKRTLQVIVLVWMYSFMWSLAPLLGWSSYVPEGLRISCTWDYVTSTTSNKSYTMMLCCCVFFIPLIIISHCYFFMFLAIRSTGRNVQKL--GSYGRQSFLTPTMKNEWKMAKIAFVIIIVYVLSWSPYACVTLIAWAG----HGKSLTPYSKTVPAVIAKASAIYNPIIYGIIHPKYRETIHKTVPCLR 325          
BLAST of Rhodopsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 154.836 bits (390), Expect = 9.225e-42
Identity = 100/312 (32.05%), Postives = 172/312 (55.13%), Query Frame = 2
Query:   83 FVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYT----KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V+ + G  IL +G+ G + N  VI  F RS+ L +P+N+F+ +L  +DFL+     P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIA++R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL    F + L  II CY+ IF  +++  + ++ + T    +S    Q++K    E K+  +   V L +V+SW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + K IPC
Sbjct:   35 HVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKMKN---EWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYR------MAIAKYIPC 333          
BLAST of Rhodopsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 154.836 bits (390), Expect = 1.387e-41
Identity = 100/312 (32.05%), Postives = 172/312 (55.13%), Query Frame = 2
Query:   83 FVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYT----KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V+ + G  IL +G+ G + N  VI  F RS+ L +P+N+F+ +L  +DFL+     P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIA++R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL    F + L  II CY+ IF  +++  + ++ + T    +S    Q++K    E K+  +   V L +V+SW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + K IPC
Sbjct:   67 HVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKMKN---EWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYR------MAIAKYIPC 365          
BLAST of Rhodopsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 154.836 bits (390), Expect = 1.417e-41
Identity = 100/312 (32.05%), Postives = 172/312 (55.13%), Query Frame = 2
Query:   83 FVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYT----KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V+ + G  IL +G+ G + N  VI  F RS+ L +P+N+F+ +L  +DFL+     P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIA++R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL    F + L  II CY+ IF  +++  + ++ + T    +S    Q++K    E K+  +   V L +V+SW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + K IPC
Sbjct:   61 HVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKMKN---EWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYR------MAIAKYIPC 359          
BLAST of Rhodopsin vs. Ensembl Xenopus
Match: mcf2l (MCF.2 cell line derived transforming sequence-like [Source:Xenbase;Acc:XB-GENE-6042031])

HSP 1 Score: 154.836 bits (390), Expect = 1.673e-41
Identity = 100/312 (32.05%), Postives = 172/312 (55.13%), Query Frame = 2
Query:   83 FVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYT----KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V+ + G  IL +G+ G + N  VI  F RS+ L +P+N+F+ +L  +DFL+     P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIA++R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL    F + L  II CY+ IF  +++  + ++ + T    +S    Q++K    E K+  +   V L +V+SW PY+ V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + K IPC
Sbjct:   68 HVHYVVGAVILAVGITGMLGNFLVIYAFCRSRSLRSPANMFIINLAITDFLMSVTQAPVFFATSLHKRWIFGEKGCELYAFCGALFGITSMITLMVIALDRYFVITRPLTSIGVMSKKRAVLILSGVWLYSLAWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFCFVFFIPLFIIIYCYIFIFKAIKNTNRAVQKIGTDDNKESHKQYQKMKN---EWKMAKIALIVILLYVVSWSPYSTVALVAFAGYASVLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYR------MAIAKYIPC 366          
BLAST of Rhodopsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 156.377 bits (394), Expect = 1.878e-42
Identity = 103/315 (32.70%), Postives = 167/315 (53.02%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V  P+   Y + G  IL +GL G + N  VI  F R++ L TP+N+F+ +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T+   + +R+   ++  W   +  S+PP  GW+ YV EGL  SCS+D    + Q ++YTMLL    F L L  II CY+ IF  +R+  +             ++ +  + E K+  +   V L FVLSW PY+ V ++A     ++LT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC
Sbjct:   61 TVDVPDHAHYTL-GTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTP----YMSSVPAVIAKASAIHNPIIYAITHPKYR------VAIAQHLPC 364          
BLAST of Rhodopsin vs. Ensembl Mouse
Match: Opn4 (opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:1353425])

HSP 1 Score: 155.992 bits (393), Expect = 5.826e-42
Identity = 103/315 (32.70%), Postives = 167/315 (53.02%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V  P+   Y + G  IL +GL G + N  VI  F R++ L TP+N+F+ +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T+   + +R+   ++  W   +  S+PP  GW+ YV EGL  SCS+D    + Q ++YTMLL    F L L  II CY+ IF  +R+  +             ++ +  + E K+  +   V L FVLSW PY+ V ++A     ++LT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC
Sbjct:   61 TVDVPDHAHYTL-GTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTP----YMSSVPAVIAKASAIHNPIIYAITHPKYR------VAIAQHLPC 364          
BLAST of Rhodopsin vs. Ensembl Mouse
Match: Rho (rhodopsin [Source:MGI Symbol;Acc:MGI:97914])

HSP 1 Score: 127.102 bits (318), Expect = 1.225e-32
Identity = 89/355 (25.07%), Postives = 168/355 (47.32%), Query Frame = 2
Query:   23 YLEMKNLTMFHGSVVTKP-----EAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTM---LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGS---VLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPS 1054
            Y+   N+T    S   +P     E + + +   Y+  + + G   N   + V ++ K L TP N  + +L  +D  +   GF   + +S +  ++F  +GC +  F  ++ G  +++ L V+A+ER+  V  P+   +      +I  V+  W + +  + PPLVGW+RY+ EG+Q SC  D +    +  + +    + +  F + +  I  CY ++ F V++   + +          +     K E+++  M   + +FF++ W PYA V       + T +GS    + + +PA+FAKS +I NPVIYI+   QF+  +   LC  K  P     +  T + +  ++  P+
Sbjct:   10 YVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFR-FGENHAIMGVVFTWIMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQ----------ESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFY----IFTHQGSNFGPIFMTLPAFFAKSSSIYNPVIYIMLNKQFRNCMLTTLCCGKN-PLGDDDASATASKTETSQVAPA 348          
BLAST of Rhodopsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 117.472 bits (293), Expect = 3.993e-29
Identity = 87/340 (25.59%), Postives = 159/340 (46.76%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLI-GTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTP 1069
             GSV ++ E   + +   Y++  G+   + N  V+ +FI+ K L TP+N  + +L  +D  + +IG+P    S  + SW F  +GC +YA      GM SI +L V+A++R+  +  P    + +T    +  ++  W  G+  ++ P++GW  Y  +    +C+ +  +      SYTM++I   F++ LT +  CY  +   +R        +Y  S       ++   +  +  M   + L F+L+W PY++V + A C    +K    +  I   FAKS T  NP IY+  + +F++ +      L    CQ   +      ST+   +P +   P
Sbjct:   16 EGSVFSRTE---HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLR--------LYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWA-CFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFRKAM------LAMFKCQPHLA--VPEPSTLPMDMPQSSLAP 334          
BLAST of Rhodopsin vs. Ensembl Mouse
Match: Rrh (retinal pigment epithelium derived rhodopsin homolog [Source:MGI Symbol;Acc:MGI:1097709])

HSP 1 Score: 117.472 bits (293), Expect = 3.993e-29
Identity = 87/340 (25.59%), Postives = 159/340 (46.76%), Query Frame = 2
Query:   53 HGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLI-GTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTP 1069
             GSV ++ E   + +   Y++  G+   + N  V+ +FI+ K L TP+N  + +L  +D  + +IG+P    S  + SW F  +GC +YA      GM SI +L V+A++R+  +  P    + +T    +  ++  W  G+  ++ P++GW  Y  +    +C+ +  +      SYTM++I   F++ LT +  CY  +   +R        +Y  S       ++   +  +  M   + L F+L+W PY++V + A C    +K    +  I   FAKS T  NP IY+  + +F++ +      L    CQ   +      ST+   +P +   P
Sbjct:   16 EGSVFSRTE---HSVIAAYLIVAGITSILSNVVVLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDLHGSWKFGHAGCQIYAGLNIFFGMVSIGLLTVVAMDRYLTISCP-DVGRRMTTNTYLSMILGAWINGLFWALMPIIGWASYAPDPTGATCTINWRNNDTSFVSYTMMVIVVNFIVPLTVMFYCYYHVSRSLR--------LYAASDCTAHLHRDWADQADVTKMSVIMILMFLLAWSPYSIVCLWA-CFGNPKKIPPSMAIIAPLFAKSSTFYNPCIYVAAHKKFRKAM------LAMFKCQPHLA--VPEPSTLPMDMPQSSLAP 334          
BLAST of Rhodopsin vs. UniProt/SwissProt
Match: sp|O15973|OPSD1_MIZYE (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis OX=6573 GN=SCOP1 PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.157e-53
Identity = 108/319 (33.86%), Postives = 181/319 (56.74%), Query Frame = 2
Query:   95 IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYT--KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK----LLCVLKQIPCQKKQSQTT 1018
            I GVYI  +GL G + N  V+ +F  +K L +PSN+FV +L  SD +   + GFP L +SSF+Q WIF    C +Y F   + G+ SI  L  I+++R+  +  PLQ  +T+T ++    ++  W L +++SIPP  GW  Y+ EG Q SC+FD    + ++++Y ++L +  FL+ L  I +CYV I   VR   ++M  +    K+ +     K ++ E ++  +   VT  F++SW PYA++ ++A     + +T     L+  +P   AKS ++ NPV+Y L++P+F++ LY+    L C  K  P +K   +T+
Sbjct:   53 IIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRARSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITP----LVSELPMMLAKSSSMHNPVVYALSHPKFRKALYQRVPWLFCCCK--PKEKADFRTS 365          
BLAST of Rhodopsin vs. UniProt/SwissProt
Match: sp|Q5XXP2|OPN4_PHOSU (Melanopsin OS=Phodopus sungorus OX=10044 GN=OPN4 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 7.796e-48
Identity = 101/304 (33.22%), Postives = 164/304 (53.95%), Query Frame = 2
Query:   95 IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
            I G  IL +GL G + N  VI  F RS+ L TP+N+ + +L  SDFL+     P    SS Y+ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  +  PL T+   + +R+   ++  W   +  S+PP  GW+ YV EGL  SCS+D    + Q ++YTMLL    F L L  II CY+ IF  +R+  +     +++S    ++    + E K+  +   V L FVLSW PY+ V ++A     ++LT      + ++PA  AK+  I NP++Y + +P+++        + + +PC
Sbjct:   71 ILGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMLIINLAVSDFLMSFTQAPVFFASSLYKKWLFGETGCEFYAFCGAVLGITSMITLTAIALDRYLVITRPLATIGMGSKRRTALVLLGIWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPQVRAYTMLLFCFVFFLPLLVIIFCYISIFRAIRETGRACE-GWSESPQRRRQWHRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTP----YMSSVPAVIAKASAIHNPIVYAITHPKYR------AAIAQHLPC 363          
BLAST of Rhodopsin vs. UniProt/SwissProt
Match: sp|Q2KNE5|OPN4A_DANRE (Melanopsin-A OS=Danio rerio OX=7955 GN=opn4a PE=2 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 7.968e-48
Identity = 105/315 (33.33%), Postives = 174/315 (55.24%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQK 1000
             V  P+   Y I G  IL +G+ G + N  VI  F RS+ L TP+N+F+ +L  +DFL+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  ++  W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  II CY  IF  +R   + + +I      ++++R +  K E K+  +   V L +V+SW PY+ V + A     ++  +  + ++PA  AK+  I NP+IY + +P+++      L + K IPC +
Sbjct:   67 TVDVPDHAHYTI-GAVILTVGITGMLGNFLVIYAFSRSRTLRTPANLFIINLAITDFLMCATQAPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLASIGVLSQKRALLILLVAWVYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRSIRTTNEAVGKINGDNKRDSMKRFQRLKNEWKMAKIALIVILMYVISWSPYSTVALTAFAG-YSDFLTPYMNSVPAVIAKASAIHNPIIYAITHPKYR------LAIAKYIPCLR 373          
BLAST of Rhodopsin vs. UniProt/SwissProt
Match: sp|Q5YKK9|OPN4_FELCA (Melanopsin OS=Felis catus OX=9685 GN=OPN4 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.064e-47
Identity = 105/320 (32.81%), Postives = 172/320 (53.75%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYT-----KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
             V  P+   Y + G  IL +GL G + N  VI  F RS+ L TP+N+F+ +L  SDF +     P    SS ++ W+F  +GC  YAF  ++ G+ S+  L  IA++R+  + +PL T+  V+ +R+   ++  W   +  S+PP  GW+ YV EGL  SCS+D    +   ++YTMLL    F L L  I+ CY+ IF  +R+  + ++         +S    QR++    E K+  +   V L FVLSW PY++V ++A     +VLT      + ++PA  AK+  I NP+IY + +P+++      + + + +PC
Sbjct:   57 TVDVPDHAHYTL-GTVILLVGLTGILGNLMVIYTFCRSRGLRTPANMFIINLAVSDFFMSFTQAPVFFASSLHKRWLFGEAGCEFYAFCGALFGITSMITLMAIALDRYLVITHPLATIGVVSKRRAALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPSVRAYTMLLFCFVFFLPLLVIVYCYIFIFRAIRETGQALQTFRACEGGGRSPRQRQRLQR---EWKMAKIELLVILLFVLSWAPYSIVALMAFAGYAHVLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYR------MAIAQHLPC 362          
BLAST of Rhodopsin vs. UniProt/SwissProt
Match: sp|O57422|OPN4B_XENLA (Melanopsin-B OS=Xenopus laevis OX=8355 GN=opn4b PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.498e-47
Identity = 116/373 (31.10%), Postives = 197/373 (52.82%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKES-KVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLI---VAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQS-------QTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENLRGNRNSISETL 1156
            P+  +Y I G +IL IG  G I N  V+  F R+K L T  N F+ +L  SDFL+     P   LSS ++ WI    GC VYAF  ++ G+ S+  L  I++ R+  +  PLQ+++  + KR+   ++  W   ++ S+ PL+GW+ YV EGL+ISC++D   ++  ++SYTM+L    F + L  I  CY+ +F  +R   + ++ +   S+     + +S K E K+  + F + + FVLSW PYA VT++A        G  L      +PA  AK+  I NP+IY + +P+++  ++K +  L+ +  + K+         +     + +R   S + T     T  + I + N+ N   +R S+S+T+
Sbjct:   23 PDQVLYTI-GSFILIIGSVGIIGNMLVLYAFYRNKKLRTAPNYFIINLAISDFLMSATQAPVCFLSSLHREWILGDIGCNVYAFCGALFGITSMMTLLAISINRYIVITKPLQSIQWSSKKRTSQIIVLVWMYSLMWSLAPLLGWSSYVPEGLRISCTWDYVTSTMSNRSYTMMLCCCVFFIPLIVISHCYLFMFLAIRSTGRNVQKL--GSYGRQSFLSQSMKNEWKMAKIAFVIIIVFVLSWSPYACVTLIAWAG----HGKSLTPYSKTVPAVIAKASAIYNPIIYGIIHPKYRETIHKTVPCLRFLIREPKKDIFESSVRGSIYGRQSASRKKNSFISTVSTAETVSSHIWD-NTPNGHWDRKSLSQTM 387          
BLAST of Rhodopsin vs. TrEMBL
Match: A0A5N5PR44 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00176680 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.219e-51
Identity = 114/367 (31.06%), Postives = 191/367 (52.04%), Query Frame = 2
Query:   65 VTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYT-KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENLRGNRN 1138
            V  P+   Y I G  I  IG+ G + N  VI  F RS+ L TP+N+F+ +L  +DF +C    P   ++S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  + C W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  II CYV IF  + +  +++R +    + + ++R  + K E K+  +   V L +V+SW PY++V + A      +  +  + ++PA  AK+  I NP+IY + +P+++  + K       LLCV ++       S  +  LST+T              T  + I  ++     GN +
Sbjct:   54 VDVPDHAHYTI-GAVIFAIGITGIVGNFLVIYAFTRSRTLRTPANMFIINLAITDFFMCATQTPIFFITSMHKKWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLSSIGMLSEKRALLVLTCAWVYSLGWSLPPFFGWSAYVPEGLMTSCTWDYMTFTPSVRAYTMLLFIFVFFIPLIVIIYCYVFIFHAIHNSNQDVRKMNRYNTRDKVKRFNKMKKEWKMAKVALIVILLYVISWSPYSIVALTAFAG-YADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRVAIAKYIPCLRVLLCVPQRELHSLHSSFISTRLSTVTNRASDVSGNLSQNSTGKSYISSASDSESEGNDS 418          
BLAST of Rhodopsin vs. TrEMBL
Match: A0A2D0QJ35 (melanopsin OS=Ictalurus punctatus OX=7998 GN=opn4 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 9.020e-51
Identity = 116/373 (31.10%), Postives = 198/373 (53.08%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENLRGNRNSISETLIKM 1165
            P+   Y I GV I  IG+ G + N  VI  F RS+ L TP+N+F+ +L  +DF +C    P   ++S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  + C W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  I+ CYV IF  +R+  +++ ++    + + ++R  + K E K+  +   V + +V+SW PY++V + A      +  +  + ++PA  AK+  I NP+IY + +P+++  + K       LLCV ++       S  +  LST+T     A        T  + I  S S+N     +S+    I++
Sbjct:   72 PDHAHYTIGGV-IFAIGITGIMGNFLVIYAFTRSRTLRTPANMFIINLAITDFFMCATQTPIFFITSMHKRWIFGEKGCELYAFCGALFGICSMITLMVIAVDRYFVITRPLSSIGMLSEKRALLVLTCAWLYSLGWSLPPFFGWSAYVPEGLMTSCTWDYMTFTPSVRAYTMLLFISVFFIPLIIIVYCYVFIFRAIRNSNQDVTKMNRHNNRHTVKRFNKMKKEWKMAKVALIVIMLYVISWSPYSVVALTAFAG-YADMLTPYMKSVPAVIAKASAIHNPIIYAITHPKYRVAIVKYIPCLRVLLCVPQRELHSLHSSFISTRLSTVTTRASDASGNLSQSSTGKSYI-SSVSDNESEGSDSMDSATIQI 441          
BLAST of Rhodopsin vs. TrEMBL
Match: A0A210QIB3 (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05889 PE=3 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.928e-50
Identity = 108/319 (33.86%), Postives = 181/319 (56.74%), Query Frame = 2
Query:   95 IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTI-GFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYT--KSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK----LLCVLKQIPCQKKQSQTT 1018
            I GVYI  +GL G + N  V+ +F  +K L +PSN+FV +L  SD +   + GFP L +SSF+Q WIF    C +Y F   + G+ SI  L  I+++R+  +  PLQ  +T+T ++    ++  W L +++SIPP  GW  Y+ EG Q SC+FD    + ++++Y ++L +  FL+ L  I +CYV I   VR   ++M  +    K+ +     K ++ E ++  +   VT  F++SW PYA++ ++A     + +T     L+  +P   AKS ++ NPV+Y L++P+F++ LY+    L C  K  P +K   +T+
Sbjct:   97 IIGVYITIVGLLGIMGNTTVVYIFSNTKSLRSPSNLFVVNLAVSDLIFSAVNGFPLLTVSSFHQKWIFGSLFCQLYGFVGGVFGLMSINTLTAISIDRYIVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIGVCYVLIIRGVRRHDQKMLTITRSMKTEDARANNKRARSELRISKIAMTVTCLFIISWSPYAIIALIAQFGPAHWITP----LVSELPMMLAKSSSMHNPVVYALSHPKFRKALYQRVPWLFCCCK--PKEKADFRTS 409          
BLAST of Rhodopsin vs. TrEMBL
Match: A0A0F8CMZ7 (Melanopsin-A OS=Larimichthys crocea OX=215358 GN=EH28_03736 PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 8.387e-50
Identity = 122/357 (34.17%), Postives = 191/357 (53.50%), Query Frame = 2
Query:   20 RYLEMKNLTMFHGSVVT----KPEAFVYD----IYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTIT 1039
            R +E+  +T   GS+VT     P A V D      GV IL +G+ G + N  VI  F RS+ L TPSNIF+ +L  +DFL+C    P   ++S ++ WIF   GC VYAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ K+++  V   W   +  S+PP  GW+ YV EGL  SCS+D    +   +SYTMLL    F + L  II  Y  IF  +R  ++ + +I    S ++ +R  + K E K+  +   V L +V+SW PY+ V + A      +  +  + ++PA  AK+  I NP++Y + +P+++ EL K       LLCV  +         +T+  ST+T
Sbjct:   31 RLMELSPVTTA-GSMVTGHPFPPVADVPDHAHYTIGVVILAVGITGMLGNFLVIYAFCRSRSLRTPSNIFIINLAVTDFLMCLTQTPTFFINSMHKRWIFGKKGCEVYAFCGALFGICSMMTLMVIAVDRYVVITRPLASLGAMSRKKALGIVAAAWVYSMGWSLPPFFGWSAYVPEGLMTSCSWDYMTFTPSVRSYTMLLFTFVFFIPLAIIIFSYCCIFRAIRHTVRAITKISCEGSRDSAKRFHKMKKEWKMAKIALIVILLYVISWAPYSCVALTAFAG-YADMVTPYMHSVPAVIAKASAIYNPIVYAITHPRYRSELSKYIPYLGVLLCVAGRDRLSSSSFHSTRR-STLT 384          
BLAST of Rhodopsin vs. TrEMBL
Match: A0A3Q3AEH9 (Opsin 4b OS=Kryptolebias marmoratus OX=37003 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 9.710e-50
Identity = 114/340 (33.53%), Postives = 188/340 (55.29%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTITRH 1045
             V  P+   Y I GV IL +G+ G + N  VI  F RS+ L TPSNIF+ +L  +DFL+C    P   ++S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ ++++ FV   W   +  S+PP  GW+ YV EGL  SCS+D    S   +SYTMLL    F + L+ II CY  IF  +R   + + +I    + +++++ ++ + E K+  +   V L FV+SW PY+   + A     ++LT      + ++PA  AK+  I NP+IY + +P+++  + +       LLC+  +    +   Q+T+  ST+T H
Sbjct:   52 TVNVPDHAHY-IIGVVILAVGITGMLGNFLVIYAFCRSRGLRTPSNIFIINLAVTDFLMCLTQTPIFFITSMHKQWIFGKKGCELYAFCGALFGICSMMTLMVIAVDRYVVITRPLASLGAMSHRKALSFVAVAWLYSIGWSLPPFFGWSAYVPEGLMTSCSWDYMTFSPSVRSYTMLLFTFVFFIPLSVIIFCYCCIFRAIRHTTRAIAKINCGGTKDSVKKFRKMRSEWKMAKIALIVILLFVISWAPYSCTALTAFAGYADLLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYRSAISRYVPYLGMLLCITGRDRYSRSSLQSTRR-STLTSH 385          
BLAST of Rhodopsin vs. Ensembl Cavefish
Match: opn4b (opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3])

HSP 1 Score: 179.104 bits (453), Expect = 1.353e-51
Identity = 110/354 (31.07%), Postives = 190/354 (53.67%), Query Frame = 2
Query:   65 VTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENL 1123
            V  P+   Y I G  IL IG+ G   N  V+  F +S+ L TPSN+F+ +L  +DF++C    P   ++S  + WIF   GC +YAF  ++ GM S+  L VIAV+R+  +  PL ++  ++ KR+++ ++  W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL +  F + L  II CY  IF  +R+  +  +     + N++++    K E K+  +   V L +V+SW PY+ V + A      +  +  + ++PA  AK+  I NP+IY + +P+++  L K +  L  + C  ++ + T +    TR   S V +  ++ +  N +R ++   L
Sbjct:   20 VDVPDHAHYTI-GFVILVIGITGIAGNFLVMYAFCKSRSLRTPSNMFIINLAITDFMMCITQTPIFFITSMNKRWIFGEKGCELYAFCGALFGMCSMITLMVIAVDRYFVITRPLASIGKMSHKRALFILVIAWLYTMCWSLPPFFGWSAYVPEGLMTSCTWDYMTFTPSVRAYTMLLFVFVFFIPLFVIIYCYFCIFRAIRNTTRSWQCFGCLT-NSIKKFHRMKSEWKMAKVALIVILLYVISWSPYSCVALTAFAG-YADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRSALVKYIPCLGVLLCVPRRDRFTSSSFMSTRR--STVTSQSSETS--NNLRHTSKSRL 366          
BLAST of Rhodopsin vs. Ensembl Cavefish
Match: opn4a (opsin 4 [Source:NCBI gene;Acc:103023553])

HSP 1 Score: 177.948 bits (450), Expect = 9.997e-50
Identity = 111/337 (32.94%), Postives = 186/337 (55.19%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC-QKKQSQTTQNLSTITRHVPSAVQT 1066
            P+   Y I G  IL IG+ G + N  VI  F RS+ L TP+N+F+ +L  +DFL+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIAV+R+  +  PL ++  ++ KR++  + C W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F + L  II CY  IF  +R   +++ +I    + + +++ +  + E K+  +   V L +V+SW PY+ V + A     ++LT      + ++PA  AK+  I NP+IY + +P+++  + K +  L+ + C  K++ Q+ Q+    TR      QT
Sbjct:   59 PDHAHYTI-GAVILAIGITGMVGNFLVIYAFSRSRTLRTPANMFIINLAITDFLMCATQSPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLTVIAVDRYFVITRPLASIGVLSQKRALLILTCAWAYSLGWSLPPFFGWSAYVPEGLLTSCTWDYVTFTPSVRAYTMLLFIFVFFIPLIVIIYCYFFIFRAIRITNQDVEKINGNNTRDTIKKFQRLRNEWKMAKVALIVILLYVISWSPYSSVALTAFAGYADMLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYRLAIAKYIPFLRVLLCVPKRELQSLQSSFMSTRRSTVTSQT 390          
BLAST of Rhodopsin vs. Ensembl Cavefish
Match: opn4.1 (melanopsin-like [Source:NCBI gene;Acc:103036973])

HSP 1 Score: 165.236 bits (417), Expect = 1.680e-45
Identity = 101/318 (31.76%), Postives = 168/318 (52.83%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNL-QRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQS 1009
             V  P+   Y I G  IL +G+ G I N  VI VF RS+ L TP NI V +L  +D  +     P   ++S ++ W+F    C +YAF   + G+ S+  L  IA +R  A+  PL  +  V+ +R+   ++  W   +  S+PP  GW+ YV EGLQ SCS+D    +   ++YT+LL I  F + L  I  CY+ IF  +R   +E++ + +   + + QR+K    E K+  +   V   FV+SW PY++V + A         +  + ++PA  AK+  I NP+IY + +P+++  + + + +L+ I C  ++ 
Sbjct:   60 TVDVPDHAHY-IIGSVILLVGVTGVIGNALVIYVFCRSRSLRTPGNILVVNLAVADLFMSLTQSPVFFVASLHRRWVFGEKACELYAFCGGLFGICSMMTLTAIAADRCLAITRPLALLGRVSRRRAGAVLVLVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMSFTPSVRAYTILLFIFVFFIPLGIIGGCYLAIFQAIRSARREVKELDSGETHKMFQRMKS---EWKMAKVALLVISLFVISWSPYSIVALTATAG-YAHHLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRAAIARYVPILRAILCVGEKD 372          
BLAST of Rhodopsin vs. Ensembl Cavefish
Match: opn4xa (melanopsin-B-like [Source:NCBI gene;Acc:103043301])

HSP 1 Score: 157.918 bits (398), Expect = 1.052e-42
Identity = 100/328 (30.49%), Postives = 175/328 (53.35%), Query Frame = 2
Query:   32 MKNLTMFHG--SVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK-SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
            M+ + M  G    V  P+   Y I   +++ IG  G + N  V+  F  +K L TP N F+ +L  SDFL+     P   ++  Y+ W+F  +GC +YAF  ++ G+ S+  L  I+++R+  +  PLQ ++  + +R++  ++  W   +  S+ PL+GW+ Y+ EGL  SC++D   ++  +KSYT++L    F + L  I  CY  +F  +R+  +++  + T      L + +  + E KL  + F V + +VLSW PYA VT++A     ++LT        A+PA  AK+  I NP+IY + + +++  L       ++IPC
Sbjct:    1 MEGVDMDRGFFRKVDVPDHAHY-IVAFFVVVIGAVGVMGNALVMYAFFCNKKLRTPPNYFIMNLAVSDFLMAITQSPIFFVNCMYKEWVFGETGCKMYAFCGALFGITSMINLLAISIDRYIVITKPLQAIRWTSKRRTLLSILLVWMYSLAWSLAPLLGWSSYIPEGLMTSCTWDYVTSTPANKSYTLMLCCFVFFIPLGIISYCYFFMFLAIRNTSRDVERLGTHVRKTTLIQQQSIRTEWKLAKVAFVVIIVYVLSWSPYAFVTLIAWAGYSSILTPYSK----AVPAVIAKASAIYNPIIYAIIHSKYRNTL------AEKIPC 317          
BLAST of Rhodopsin vs. Ensembl Cavefish
Match: tmtops3a (opsin-3-like [Source:NCBI gene;Acc:103022827])

HSP 1 Score: 135.961 bits (341), Expect = 8.408e-36
Identity = 102/349 (29.23%), Postives = 167/349 (47.85%), Query Frame = 2
Query:   89 YDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTM-LLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVA--IPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQS-QTTQNLSTITRHVPSAVQTPPNQVTA*NAIRESNSENL 1123
            + +  V + FI  FGC  N  V+LVF R + LWTP N+ + ++  SD L+C  G PF   SS Y  W+   SGC  Y F+ S+ G+ S+  L V++ ER+ AV    +   T   +++   V   W   ++ ++PP +GW+ Y  EG   +CS      S  S SY + L I   +L L  ++ CY KI F ++   K            +  +   + E  ++ M   +   ++L W PY +V+++A      ++G +  VA  +P+  AKS T+ NPVIY+L    F  + Y+  C +  + C  + S QT           P++    P   +  +  RE  + +L
Sbjct:   41 HSVVAVCLGFILFFGCFNNLLVLLVFARFRSLWTPINVVLLNISASDMLVCLFGTPFSFASSLYGRWLLGQSGCEWYGFANSLFGIVSLVSLSVLSYERYMAVLRATKP-DTSDFRKAWRCVAGAWLYSLVWTLPPFLGWSSYGPEGPGTTCSVQWHQRSPSSVSYVVCLFIFCLVLPLLLMVYCYGKILFIIKGVTK------------INLLSAQRRENHILLMVLTMVSCYLLCWMPYGVVSLMA---TFGKQGLITPVASVVPSVLAKSSTVINPVIYVL----FNNQFYR--CFIAFVKCGAEPSIQTLNPPHNSKEEAPASSFCRPWSHSKLSPARECRTLSL 367          
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Match: opn4a (opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624])

HSP 1 Score: 172.94 bits (437), Expect = 6.662e-50
Identity = 106/330 (32.12%), Postives = 177/330 (53.64%), Query Frame = 2
Query:   86 VYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESK-------VERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQI-PCQKKQSQTTQNLS-TITRH 1045
            V+   G  ++ IG  G I N  VI VF RSK L +P+NIF+ +L  +DF +     P   ++S ++ WIF   GC +YAF  ++ G+ S+  L VIA +R+  +  PL ++  ++ +R++Y     W   +  S+PP  GW+ YV EGL  SC++D    +   +SYTMLL    F + L  II CYV+IF  +++  + +     K+  +    KES+        E KL  +   V L +V+SW PY+ V ++A      +  +  + ++PA  AK+  I NP++Y + +P++++ + K +  L+ +    +K S+T    S   TRH
Sbjct:   13 VHHTIGSVVIAIGFTGIIGNFLVIYVFCRSKSLRSPANIFIINLAFADFFMSITQTPIFFVTSLHKRWIFGEKGCELYAFCGALFGIASMVTLMVIATDRYLVLTRPLASIGAMSKRRAMYITAAVWFYSLAWSLPPFFGWSAYVPEGLMTSCTWDYVTFTPAVRSYTMLLFCFVFFIPLIVIIFCYVRIFAAIKNTNRAV-----KTLGDAHDSKESQKQQQRMNAEWKLAKIALIVILLYVVSWSPYSCVALVAWAG-YADMLTPYMNSVPAIIAKASAIHNPIVYAITHPKYRQAIGKYVPCLRSLFGVVRKGSRTLSGSSFQSTRH 336          
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 100.523 bits (249), Expect = 7.832e-24
Identity = 79/324 (24.38%), Postives = 143/324 (44.14%), Query Frame = 2
Query:   71 KPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY-----TMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVER---KLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSV--------LIVAIPAYFAKSFTICNPVIYILNYPQFKRELY-KLLCVLKQIP 991
            +P    + + G  +  + L G   N  VI V  R K L T +N+FV  L  SD +I     P  ++ +F+ +WI  ++ C +  F        S+  +  IAVERF  + +PL++    T  R+   +   W +G+ ++ P        V   +    S       W    +     T LL+ TF+L L  +   Y ++  ++  + +    V+   FN LQR + +K+ R   + + M   V + F + W P+ +V      N L  KG++        + +A+   F  S ++ NP++Y      +K++L   L C++ + P
Sbjct:   42 QPLRLAFAVVGALVFTLALSG---NALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQWSHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHELWVKTR----VHDAVFNALQRSEINKITRSKKRAVKMMVIVVILFAVCWAPFHVV------NSLVPKGNLEMSFDMEAITLAMVQLFGFSNSLWNPIVYAALNQNYKKQLAIALSCLMCRRP 352          
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Match: parapinopsina (parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1])

HSP 1 Score: 97.4413 bits (241), Expect = 9.036e-24
Identity = 73/231 (31.60%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  341 GMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY-TMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQ-KKQSQTTQNL 1027
            GM ++  + V+AVER+  V  PL  V   T +  +  V   WT  +  S PPL GW RY  EG+  SC+ D  D+S   +SY T   I  F L +  I+ CY K+   +               + L        ERK+  M   +   F L W PYA + I A+      K S +  +IP Y AKS    NP+IYI  + QF+  + ++ C  +    + K +  T Q L
Sbjct:    1 GMTALITVCVLAVERYVVVCKPLGGVHFGT-QHGLCGVAISWTWALAWSAPPLFGWGRYHYEGVGTSCAPDWADSSPSGRSYMTTYFIFCFALPMIIILFCYTKLMIAIHK------------VSKLGLSANDTAERKVGIMVVVMVFAFFLCWLPYAALAI-AVVIKPDLKVSPVTASIPVYLAKSSGAYNPIIYIFMHRQFREHISRIFCDHRNQSSRIKPEENTMQRL 217          
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Match: opn3 (opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16])

HSP 1 Score: 98.9821 bits (245), Expect = 3.613e-23
Identity = 81/322 (25.16%), Postives = 145/322 (45.03%), Query Frame = 2
Query:  119 IGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKES-KVERKLIYMGFNVTLFFVLSWGPYAMVTILALC---NVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPP 1072
            IG+ G + N  ++ +F+  K L TP+N+ + ++  SD L+   G    ++S   + W++   GC    FS S+ G+ SI  L  ++ ER+ A     Q +      R++ +    W      +  PL+GW+RYVLE   + CS D   ++    ++ +     FL  L A ++     F ++   I + R ++    +   R+ ++ + E +   +   V   F+L W PYA++ +L      +++    SV    IP++FAKS    NP++Y+    + +  L    C   QI C              T HV     +PP
Sbjct:   16 IGVAGFLNNLLLVALFVGFKRLQTPTNLLLVNISLSDLLVSVFGNTLTLVSCVRRRWVWGNGGCVWDGFSNSLFGIVSISTLTALSYERY-ARLIKAQVLDFSWAWRAVTYT---WLYSAAWTGAPLLGWSRYVLEKHGLGCSIDWASSNPPDAAFVLFF---FLGCLAAPLLVMGFCFGRIALAITQFRYLHVAQVHTAGRMAQTLRGESRAARLALLVVATFLLCWMPYAVLALLTAAGNGDLINPATSV----IPSFFAKSSIAYNPILYVFLNKRVRPALAVTWCS-AQIDC--------------TTHVEPYPPSPP 311          
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Match: sstr1a (somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-090429-1])

HSP 1 Score: 81.2629 bits (199), Expect = 3.095e-17
Identity = 76/291 (26.12%), Postives = 128/291 (43.99%), Query Frame = 2
Query:  110 ILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTV--KTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCV 976
            +  +GLFG   N  VI V +R   + T +NI++ +L  +D L   +  PFL  S+    W F  S C +      I    S+F L V+  +R+ AV +P++    +  +V ++I   +  W L ++I +P +V  +  V     + C+       W +          FLL + AI +CY  I       + +MR V  ++    Q+ K S  ERK+  M   V   FV  W P+ +V    L NV   +    +  +      + +  NP++Y      F+    ++LCV
Sbjct:   23 VCLVGLFG---NSMVIYVILRYAKMKTATNIYILNLAVADELF-MMSVPFLATSTALHHWPFGSSLCRLVLSVDGINMFTSVFCLTVLTFDRYVAVVHPIKAARYRRPSVAKTINAAV--WALSMVIILPIVVYADTRVNADGTVVCNLLWPRPEWSAAFVVYTFTVGFLLPVAAICLCYALI-------VAKMRAVALRA--GWQQRKRS--ERKVTLMVTMVVAVFVACWMPFYVVQ---LVNVFEGQQGATVNQLAVILGYANSCANPILYGFLSDSFRHSFQRVLCV 293          
BLAST of Rhodopsin vs. Ensembl Nematostella
Match: NVOP5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI24])

HSP 1 Score: 103.605 bits (257), Expect = 1.632e-24
Identity = 87/340 (25.59%), Postives = 162/340 (47.65%), Query Frame = 2
Query:   77 EAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYF-VICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSW--QSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLF---FVLSWGPYAMVTILALCNV-LTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQS-----QTTQNLSTITRHVPSAV 1060
            + F  D   +Y+  + + G + N  V++V +R         IF+  +  SDFL C +G P  + +S   +W + + GC  +AF +   G+ S+  L ++A E++  +F  +        KR     V+  W   +  ++PPL GW  Y LE   ++CS   FD+        Y ++ IG F + L  I+  Y  I     +++K    V   + N++ R+  + + R + Y    + L    ++LSW PY+++T L +  V L+++     V +P+ FAK+  + NP +Y++ +  F+++L+  L   +    ++++          N ST T H   AV
Sbjct:   33 DIFAMDGVTLYLSLVSVCGGLANLLVLVVLLRHLRSLRVPEIFILSITLSDFLSCAVGIPLAIHASIAGTWPYCLEGCKAHAFFIYTFGLVSLVHLAIMAFEKYLTIFKHMSKWGNFLSKRGASLIVVGLWVYCLFFTVPPLFGWAAYGLENGNLTCSIK-FDSRHPVDISYYVVMYIGGFFIPLGLILYSYYHI-----NKVKHRVAVRKYASNDVNRV--AHIRRNVKY-AVKLALLIGGYLLSWAPYSVITFLIVLQVELSDQA----VYVPSLFAKTSFMYNPFLYLVFFRSFRKKLFVTLTTREYRARRRRKMLLEYFPHLTNESTSTSHTAGAV 359          
BLAST of Rhodopsin vs. Ensembl Nematostella
Match: NVOP42 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWR8])

HSP 1 Score: 100.138 bits (248), Expect = 6.071e-24
Identity = 81/279 (29.03%), Postives = 136/279 (48.75%), Query Frame = 2
Query:  110 ILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY-TMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQ 943
            ILF+  FG + N  V+LVF  SK L   +++ +  L  SD+L   +G P ++  +    W  D + C  Y  S +  G  S+  L  +A +R+ A+  P+      T KR    V   W  G++ ++ P++GW+ Y LE  +  C+    D S  +KSY  ++    FLL +T +I CY  +    R+      I    S   L+  KE+     ++++G      F+++W PYA+V++ +   +  E+ S     IP   AKS +  NP+IY+  Y +
Sbjct:   19 ILFV--FGLVANSTVLLVFAFSKSLQNTTDVLLISLSISDWLQAVLGKPVVIYGNVVGWWNADRALCVFYGLSTAALGFVSLLHLAALAFQRWLAITKPM------TYKRIYPLVGTLWAWGMLWAVFPVLGWSGYELEPGETGCAITWNDQSTTNKSYIFIIFGIFFLLPITLVIGCYAWVAKLARN------IDAAASQATLRSEKENAWTSFVMFLG------FLIAWLPYAIVSLYS--AITGERVSPEAATIPGMLAKSASCYNPLIYVFLYSR 275          
BLAST of Rhodopsin vs. Ensembl Nematostella
Match: NVOP465 (Opsin; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI5])

HSP 1 Score: 99.3673 bits (246), Expect = 1.497e-23
Identity = 75/283 (26.50%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  107 YILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPF-LMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLI-LTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFK 949
            Y + I + G + N  V+++FI S+ L T  N+ +F +   D+L+ T+     +  ++ Y   +  ++ C  YAF+ S  G  SI  L  +AVE+  AV  P+    +   +R +  +   W   ++ ++ PL+GW+ Y  E   +SCS   + T   + SY + +   F LI +  +  C+  I+  +R+   E    +       Q    +K   K   M F + + F+ +W PYA+V++       T +   L+  +P+ FAK  +  NP+IY   Y +F+
Sbjct:   17 YYIAIFVIGFVTNTIVVIIFISSQRLHTTPNLILFSMSVCDWLMATMAKSVGIYGNARYWPTVGKVT-CDYYAFATSAIGYASILHLAALAVEKRMAVVSPM--TNSFNGRRMLVIIATLWGFAILWAVFPLIGWSSYGPEPGYVSCSITWYTTDHNNVSYIICVSVLFFLIPIVTMTFCFASIYHTIRNLSHEATARWGSDARATQETIRAKA--KTAKMAFLMVMCFLFAWTPYAVVSLWTTFGD-THRIPALLGVLPSLFAKLSSCYNPIIYFFMYTKFR 293          
BLAST of Rhodopsin vs. Ensembl Nematostella
Match: NVOP377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB7])

HSP 1 Score: 96.2857 bits (238), Expect = 1.405e-22
Identity = 78/256 (30.47%), Postives = 129/256 (50.39%), Query Frame = 2
Query:  197 NIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKT-VTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGT-FLLILTAIIICYVKIFFKVR---DQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFK 949
            +IF+  +   DFL  ++  P  + ++   SW F +SGC V+AF +   G+ SI  L  +A+E+F  +   L + +   T  ++I  V   W   ++I+IPPL GW RY LE    +CS    D      +Y  ++ G  F+L L  ++  Y +I FKV     Q K+ ++ + K    L++  +S V   L+  G      ++++W PY   TI  L  V   K S   + IP+ FAK+  + NP++Y L   +F+
Sbjct:   37 DIFLVSISTGDFLASSVAIPIALKAALSSSWPFGLSGCQVHAFLIYTLGLVSITNLAALALEKFLTIVKCLYSDEHFFTRLQAICVVAGLWVYCLLITIPPLFGWARYGLEPGNKTCSLRWDDDGPADDAYYGVMFGGYFILPLALMVFSYFRI-FKVECHDRQCKKWQLSHNKR-ALLRKHIQSAVFFLLLIAG------YLMAWTPY---TIATLSMVSGAKVSDNGLMIPSLFAKTSFVLNPILYTLVSKRFR 281          
BLAST of Rhodopsin vs. Ensembl Nematostella
Match: NVOP11 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL78])

HSP 1 Score: 92.8189 bits (229), Expect = 2.623e-21
Identity = 74/271 (27.31%), Postives = 133/271 (49.08%), Query Frame = 2
Query:  143 NGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISG-CYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIII-CYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFK 949
            NG V+++F+ ++ L T  N+ +  +  +D+L+  +       ++   +W   + G C  Y F  +  G+ S+  L  ++VERF  V  P+   + +T  + +  V   W    + +I PLVGW+ Y  E    +CS   +     + SY + L   F  +   I+I C+  I+F VR   ++    +  S ++ Q+   +  ERK  +M F + L F+ +W PYA+V++ A    +T     L+  +PA  AK+    NP+IY   Y +F+
Sbjct:   25 NGIVLIIFLATRSLRTIPNMILLSMAWADWLMACLADAVGAYAN-ANNWPSMVGGLCVYYGFITTALGLTSMIHLTALSVERFVTVTIPM--TRPITETQMLLVVTFLWAFSFLWAIFPLVGWSSYGPEPGYAACSIAWYRQDLNNMSYILCLFMFFFFLPIVIMIACFSSIYFTVRKLTRDSMRRWGASSDSTQQTLAA--ERKTAWMSFIMVLAFLFAWVPYAVVSLYASFGGVTTIPK-LMSTLPAMLAKTSACYNPIIYFFMYSKFR 289          
BLAST of Rhodopsin vs. Ensembl Medaka
Match: opn4b (melanopsin-A-like [Source:NCBI gene;Acc:101157094])

HSP 1 Score: 177.178 bits (448), Expect = 1.093e-49
Identity = 122/377 (32.36%), Postives = 197/377 (52.25%), Query Frame = 2
Query:   74 PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEM-RIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTITRHV----PSAVQTPPNQVTA*NAIRESNSENLRGNRNSISETL 1156
            P+   Y I GV IL +G+ G + N  VI  F RS+ L TPSNIF+ +L  +DFL+C    P   ++S Y+ WIF   GC +YAF  ++ G+ S+  L VIAV+R   +  PL ++  ++ K+++ FV   W   +  S+PP  GW+ YV EGL  SCS+D    +   +SYTMLL    F + L  II CY +IF  +R   + + +I    + ++ ++  + + E K+  +   V L FV+SW PY+   + A     ++LT      + ++PA  AK+  I NP+IY + +P+++  + +       LLCV  +         +T+  ST+T       PS  QT     +  ++   S++E+   +R   S  L
Sbjct:   56 PDHAHYTI-GVVILAVGITGMVGNFLVIYAFSRSRSLRTPSNIFIINLAVTDFLMCLTQTPIFFITSMYKHWIFGKKGCELYAFCGALFGICSMMTLMVIAVDRCVVITRPLASLGAMSNKKALSFVAAAWVYSMGWSLPPFFGWSAYVPEGLMTSCSWDYMTFTPSVRSYTMLLFTFVFFIPLFIIIFCYCRIFRAIRHTTRAIAKINCEGTRDSAKKFHKMRSEWKMAKIALIVILLFVISWAPYSCAALTAFAGYADLLTP----YMNSVPAVIAKASAIHNPIIYAITHPKYRSAISRYVPYLGALLCVTGRERYSSSSIHSTRR-STLTSQSECRGPSRPQTSSQSES--DSAHFSDTEDDCSSRTPASRQL 424          
BLAST of Rhodopsin vs. Ensembl Medaka
Match: opn4a (melanopsin-A [Source:NCBI gene;Acc:101165418])

HSP 1 Score: 172.555 bits (436), Expect = 2.499e-48
Identity = 117/343 (34.11%), Postives = 178/343 (51.90%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLL-IGTFLLILTAIIICYVKIFFKVRDQIKEMRIV------YTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILAL---CNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYK-------LLCVLKQIPCQKKQSQTTQNLSTIT 1039
             V  P+   Y I G  IL IG+ G I N  VI  F RS+ L TP+N+F+ +L  +D L+C    P    +S ++ WIF   GC +YAF  ++ G+ S+  L VIA++R+  +  PL ++  ++ KR++  +   W   +  S+PP  GW+ YV EGL  SC++D    +   ++YTMLL I  F L L  II CYV IF  +R   + +  +        KSFN LQ       E K+  +   V L +V+SW PY+ V + A     ++LT      + +IPA  AK+  I NP+IY + +P+++  L K       LLC+  +       S  +   ST+T
Sbjct:   11 TVDVPDHAHYTI-GSVILAIGITGIIGNFLVIYAFSRSRSLRTPANMFIINLAITDLLMCVTQSPIFFTTSMHKRWIFGEKGCELYAFCGALFGICSMITLTVIAIDRYFVITRPLTSIGVLSRKRALLILSAAWAYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFTPSVRAYTMLLFIFVFFLPLFIIIYCYVFIFRAIRSTNRAVGKINGNTRDAVKSFNRLQN------EWKMAKIALIVILLYVISWSPYSTVALTAFAGYADMLTP----YMNSIPAVIAKASAIHNPIIYAITHPKYRMALAKYIPGLGVLLCIHPKDLRSASSSFVSTRRSTVT 342          
BLAST of Rhodopsin vs. Ensembl Medaka
Match: opn4.1 (opsin 4.1 [Source:NCBI gene;Acc:352918])

HSP 1 Score: 163.696 bits (413), Expect = 1.734e-45
Identity = 100/311 (32.15%), Postives = 165/311 (53.05%), Query Frame = 2
Query:   62 VVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYT-MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNL-QRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQI 988
             V  P+   Y I G  IL +G+ G + N  VI VF RSK L +PSN+ V +L  +DFL+     P   ++S ++ W+F    C +YAF  ++ G+ S+  L  IAV+R   +  P+  +  ++ KR    ++  W   +  S+PP  GW+ YV EGLQ SCS+D    +   ++YT ML +  F L LT I  CY  IF  V+   +E+  +     N   +R++    E K+  +   V + FV+SW PY++V + A      +  +  + ++PA  AK+  I NP+IY L +P+++  + +   +L+ +
Sbjct:   21 TVDVPDHAHY-IIGCVILLVGMTGMLGNALVIYVFCRSKALRSPSNLLVVNLAAADFLMSVTQSPAFFVASLHRGWVFGEFACELYAFCGALFGITSMMTLTAIAVDRCLVITRPVALLGGMSRKRVYVAMVAVWLYSLGWSLPPFFGWSAYVPEGLQTSCSWDYMTFTTSVRTYTIMLFVFVFFLPLTLIAACYWAIFRAVQQAGREVARLNCGEINKAYERLRS---EWKMAKVALGVIMLFVVSWAPYSVVALTATAG-YAQLLTPYMNSVPAVIAKASAIHNPIIYALTHPKYRIAIGRQFPLLRGV 326          
BLAST of Rhodopsin vs. Ensembl Medaka
Match: opn4xa (melanopsin-B [Source:NCBI gene;Acc:101158465])

HSP 1 Score: 158.688 bits (400), Expect = 8.160e-44
Identity = 96/308 (31.17%), Postives = 165/308 (53.57%), Query Frame = 2
Query:   86 VYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK-SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVL---IVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPC 994
            V+ I   ++L IG  G   N  V+  F  +K L TP N F+ +L  SDFL+     P   ++  Y+ WIF  +GC +YAF  ++ G+ S+  L  I+++R+  +  PLQ++   + +R+ + +   W   +  S+ PL+GW+ Y+ EGL  SC++D    +  +KSYT++L    F + L  I  CY+ +F  +R   +++  + ++   + L + +  + E KL  + F V + FVLSW PYA VT++A         S+L     A+PA  AK+  I NP IY + + +++  L       +++PC
Sbjct:   17 VHYIIAFFVLVIGTVGVTGNALVMYAFSCNKKLRTPPNFFIMNLAVSDFLMAITQSPIFFINCLYKGWIFGETGCKMYAFCGALFGISSMINLLAISIDRYIVITKPLQSIAWTSARRTCFIIALVWLYSLFWSLAPLLGWSSYIPEGLMTSCTWDYVTATPSNKSYTLMLCCFVFFIPLGIISYCYLCMFLAIRHTSRDVTQLGSQVRKSTLIQQQSIRTEWKLAKIAFVVIIVFVLSWSPYACVTLIAWAGY----ASILNPYSKAVPAVIAKASAIYNPFIYAITHSKYRETL------AEKVPC 314          
BLAST of Rhodopsin vs. Ensembl Medaka
Match: opn4xb (melanopsin-A [Source:NCBI gene;Acc:101173945])

HSP 1 Score: 154.836 bits (390), Expect = 1.122e-41
Identity = 98/318 (30.82%), Postives = 172/318 (54.09%), Query Frame = 2
Query:   53 HGSVVTK---PEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIG-TFLLILTAIIICYVKIFFKVRDQIKEMRIVYTK-SFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILA---LCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLK 982
             GS+++K   P+   Y I  +++  IG  G   N  V+  F  +K L    N F+ +L  SDFL+     P   ++  Y+ W+F  +GC VYAF  ++ G+ S+  L  I+VER+  +  PLQT+   + +++   +   W   +  S+ PLVGW+ Y+ EGL  SC++D    +  ++SYTM+L    F + L  I+ CY+++F  +R   + +  + T+   + + + K  + E KL  + F V + +VLSW PYA VT+++     ++L+        A+PA  AK+ TI NP+IY + + +++  L + +  L+
Sbjct:    7 QGSLLSKVNVPDHAHY-IVAMFVFVIGALGITGNALVMFAFYSNKKLRNLPNYFIMNLAISDFLMAFTQSPIFFINCLYREWMFGETGCKVYAFCGALFGISSMINLLAISVERYLVITKPLQTIHWSSKRKTTLAIFLVWFYSLAWSLAPLVGWSSYIPEGLMTSCTWDYVTYTPANRSYTMMLCCFVFFIPLGIILYCYLRMFLSIRKTTRAVERLGTQVRKSTVIQQKTIRSEWKLAKIAFVVIVVYVLSWSPYACVTLISWAGHADILSPYSK----AVPAVIAKASTIYNPIIYAIIHNKYRMTLAEKVSCLR 319          
BLAST of Rhodopsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 349/352 (99.15%), Postives = 351/352 (99.72%), Query Frame = 2
Query:   32 MKNLTMFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 1087
            MKNLTMFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLC+LKQIPC+KKQSQTTQNLSTITRHVPSAVQTPPNQVTA
Sbjct:    1 MKNLTMFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 352          
BLAST of Rhodopsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 344/347 (99.14%), Postives = 346/347 (99.71%), Query Frame = 2
Query:   47 MFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 1087
            MFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLC+LKQIPC+KKQSQTTQNLSTITRHVPSAVQTPPNQVTA
Sbjct:    1 MFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKLLWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 347          
BLAST of Rhodopsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 507.679 bits (1306), Expect = 0.000e+0
Identity = 250/253 (98.81%), Postives = 252/253 (99.60%), Query Frame = 2
Query:  329 MSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 1087
            MSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLC+LKQIPC+KKQSQTTQNLSTITRHVPSAVQTPPNQVTA
Sbjct:    1 MSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 253          
BLAST of Rhodopsin vs. Planmine SMEST
Match: SMESG000025307.1 (SMESG000025307.1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.033e-178
Identity = 245/248 (98.79%), Postives = 247/248 (99.60%), Query Frame = 2
Query:  344 MHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 1087
            MHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSY MLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLC+LKQIPC+KKQSQTTQNLSTITRHVPSAVQTPPNQVTA
Sbjct:    1 MHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYIMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYPQFKRELYKLLCILKQIPCKKKQSQTTQNLSTITRHVPSAVQTPPNQVTA 248          
BLAST of Rhodopsin vs. Planmine SMEST
Match: SMESG000025308.1 (SMESG000025308.1)

HSP 1 Score: 309.686 bits (792), Expect = 5.963e-104
Identity = 148/253 (58.50%), Postives = 189/253 (74.70%), Query Frame = 2
Query:  182 LWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSMSITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVIISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAIIICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTLFFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYILNYP 940
            +WTPSN+F+FDL  SD LIC +GFPFL +S F + WIF  +GC  YAFSMS+TGMHSIFIL ++AVER   +  PL+ VK V+ KRS   V+  WT  + +SIPPL+GWNRYVLEGL ISCS+DMFD SW+SKSY + LIG FL++L  II CY+ +F KV+ Q   MR++   S  +L   +E + E KLI+MG N+TL FVLSWGPYA+VTIL++  VL EK S++IV  P++FAKSFTI NP+IYI +YP
Sbjct:    1 MWTPSNVFIFDLALSDLLICILGFPFLTISGFCKEWIFSEAGCSAYAFSMSVTGMHSIFILTILAVERLKVISRPLKMVKIVSKKRSFLLVLISWTFAIFVSIPPLLGWNRYVLEGLHISCSYDMFDGSWRSKSYIVFLIGIFLVVLLIIIFCYLALFLKVQRQATSMRVMIKDS-RDLLAERERQRENKLIWMGCNITLAFVLSWGPYALVTILSIFKVLNEKNSLIIVTFPSFFAKSFTIYNPIIYIFSYP 252          
The following BLAST results are available for this feature:
BLAST of Rhodopsin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OPN41.297e-4231.99opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN41.310e-3931.01opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
OPN41.733e-3931.07opsin 4 [Source:HGNC Symbol;Acc:HGNC:14449][more]
RRH8.876e-3127.95retinal pigment epithelium-derived rhodopsin homol... [more]
RHO9.050e-2725.75rhodopsin [Source:HGNC Symbol;Acc:HGNC:10012][more]
back to top
BLAST of Rhodopsin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-21.886e-1722.65NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-22.696e-1722.65NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-23.541e-1722.65NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-54.466e-1521.66NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-51.364e-1422.55NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of Rhodopsin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rh63.490e-3528.88gene:FBgn0019940 transcript:FBtr0347603[more]
Rh21.969e-3225.43gene:FBgn0003248 transcript:FBtr0083697[more]
ninaE7.415e-3125.55gene:FBgn0002940 transcript:FBtr0083857[more]
Rh76.551e-2926.58gene:FBgn0036260 transcript:FBtr0076020[more]
Rh51.192e-2525.78gene:FBgn0014019 transcript:FBtr0342591[more]
back to top
BLAST of Rhodopsin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4a1.055e-4833.33opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4a1.209e-4833.33opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
opn4b3.005e-4732.49opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
opn4.14.219e-4331.61opsin 4.1 [Source:NCBI gene;Acc:352918][more]
opn4xb1.923e-4232.54opsin 4xb [Source:NCBI gene;Acc:563080][more]
back to top
BLAST of Rhodopsin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000039733.17.705e-4533.44melanopsin-B-like [Source:NCBI gene;Acc:100485437][more]
mcf2l9.225e-4232.05MCF.2 cell line derived transforming sequence-like... [more]
mcf2l1.387e-4132.05MCF.2 cell line derived transforming sequence-like... [more]
mcf2l1.417e-4132.05MCF.2 cell line derived transforming sequence-like... [more]
mcf2l1.673e-4132.05MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Rhodopsin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Opn41.878e-4232.70opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Opn45.826e-4232.70opsin 4 (melanopsin) [Source:MGI Symbol;Acc:MGI:13... [more]
Rho1.225e-3225.07rhodopsin [Source:MGI Symbol;Acc:MGI:97914][more]
Rrh3.993e-2925.59retinal pigment epithelium derived rhodopsin homol... [more]
Rrh3.993e-2925.59retinal pigment epithelium derived rhodopsin homol... [more]
back to top
BLAST of Rhodopsin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15973|OPSD1_MIZYE3.157e-5333.86Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis O... [more]
sp|Q5XXP2|OPN4_PHOSU7.796e-4833.22Melanopsin OS=Phodopus sungorus OX=10044 GN=OPN4 P... [more]
sp|Q2KNE5|OPN4A_DANRE7.968e-4833.33Melanopsin-A OS=Danio rerio OX=7955 GN=opn4a PE=2 ... [more]
sp|Q5YKK9|OPN4_FELCA1.064e-4732.81Melanopsin OS=Felis catus OX=9685 GN=OPN4 PE=2 SV=... [more]
sp|O57422|OPN4B_XENLA3.498e-4731.10Melanopsin-B OS=Xenopus laevis OX=8355 GN=opn4b PE... [more]
back to top
BLAST of Rhodopsin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N5PR443.219e-5131.06Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A2D0QJ359.020e-5131.10melanopsin OS=Ictalurus punctatus OX=7998 GN=opn4 ... [more]
A0A210QIB33.928e-5033.86Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis O... [more]
A0A0F8CMZ78.387e-5034.17Melanopsin-A OS=Larimichthys crocea OX=215358 GN=E... [more]
A0A3Q3AEH99.710e-5033.53Opsin 4b OS=Kryptolebias marmoratus OX=37003 PE=3 ... [more]
back to top
BLAST of Rhodopsin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4b1.353e-5131.07opsin 4b [Source:ZFIN;Acc:ZDB-GENE-080415-3][more]
opn4a9.997e-5032.94opsin 4 [Source:NCBI gene;Acc:103023553][more]
opn4.11.680e-4531.76melanopsin-like [Source:NCBI gene;Acc:103036973][more]
opn4xa1.052e-4230.49melanopsin-B-like [Source:NCBI gene;Acc:103043301][more]
tmtops3a8.408e-3629.23opsin-3-like [Source:NCBI gene;Acc:103022827][more]
back to top
BLAST of Rhodopsin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4a6.662e-5032.12opsin 4a (melanopsin) [Source:NCBI gene;Acc:571624... [more]
qrfpr47.832e-2424.38pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
parapinopsina9.036e-2431.60parapinopsin a [Source:ZFIN;Acc:ZDB-GENE-101129-1][more]
opn33.613e-2325.16opsin 3 [Source:ZFIN;Acc:ZDB-GENE-080227-16][more]
sstr1a3.095e-1726.12somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Rhodopsin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rhodopsin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NVOP51.632e-2425.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP426.071e-2429.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP4651.497e-2326.50Opsin; Predicted protein [Source:UniProtKB/TrEMBL... [more]
NVOP3771.405e-2230.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP112.623e-2127.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rhodopsin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opn4b1.093e-4932.36melanopsin-A-like [Source:NCBI gene;Acc:101157094][more]
opn4a2.499e-4834.11melanopsin-A [Source:NCBI gene;Acc:101165418][more]
opn4.11.734e-4532.15opsin 4.1 [Source:NCBI gene;Acc:352918][more]
opn4xa8.160e-4431.17melanopsin-B [Source:NCBI gene;Acc:101158465][more]
opn4xb1.122e-4130.82melanopsin-A [Source:NCBI gene;Acc:101173945][more]
back to top
BLAST of Rhodopsin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025307.10.000e+099.15SMESG000025307.1[more]
SMESG000025307.10.000e+099.14SMESG000025307.1[more]
SMESG000025307.10.000e+098.81SMESG000025307.1[more]
SMESG000025307.11.033e-17898.79SMESG000025307.1[more]
SMESG000025308.15.963e-10458.50SMESG000025308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032702 ID=SMED30032702|Name=Rhodopsin|organism=Schmidtea mediterranea sexual|type=transcript|length=1271bp
CTCATTTATTGTGTAATTAAGATATTTGGAAATGAAGAACCTAACAATGT
TTCACGGATCTGTTGTTACCAAACCAGAGGCATTTGTGTATGACATTTAC
GGAGTCTACATTCTTTTTATTGGATTATTCGGATGCATTGAGAACGGATG
CGTTATTCTTGTTTTTATCAGATCAAAACTTTTGTGGACTCCATCAAATA
TATTTGTTTTCGATTTGGTTTGTTCAGATTTTTTAATATGTACAATTGGA
TTCCCGTTTCTTATGCTGAGTTCATTTTATCAGAGCTGGATTTTTGATAT
TTCGGGTTGTTACGTTTATGCTTTTTCCATGTCTATTACTGGAATGCACT
CCATATTCATCCTTTTTGTAATTGCCGTTGAGCGGTTCAATGCTGTATTC
TATCCCTTACAAACTGTCAAAACTGTCACAGTTAAAAGATCTATTTATTT
TGTCATTTGCTGTTGGACGCTTGGAGTGATTATCTCCATTCCTCCTCTAG
TTGGTTGGAATCGATATGTTTTGGAAGGTCTACAGATATCTTGCAGTTTT
GATATGTTTGACACTTCATGGCAAAGCAAAAGCTACACCATGTTGCTTAT
CGGAACGTTTCTCCTGATTTTGACAGCAATTATCATCTGCTACGTAAAAA
TATTTTTCAAAGTCCGGGATCAGATAAAGGAAATGAGAATTGTCTATACA
AAATCATTCAATAATTTGCAAAGAATTAAAGAGAGCAAAGTAGAAAGAAA
ATTAATATACATGGGATTCAATGTGACATTATTCTTTGTTTTATCATGGG
GACCATATGCAATGGTCACAATTTTGGCTCTTTGTAATGTGCTGACCGAG
AAAGGCTCTGTGCTAATTGTAGCCATCCCGGCTTATTTCGCAAAATCATT
CACCATTTGTAATCCCGTCATTTACATTTTAAACTATCCGCAATTCAAAA
GAGAACTTTATAAGTTATTATGTGTTTTGAAGCAGATACCCTGTCAAAAG
AAACAAAGTCAAACAACTCAAAACCTGTCCACAATCACAAGGCATGTCCC
AAGTGCTGTACAAACACCACCAAATCAAGTAACAGCTTAGAACGCAATTC
GAGAAAGCAATTCAGAAAATCTACGAGGTAACAGAAATTCTATATCAGAA
ACTTTGATAAAAATGGATTGTGAATAAATTATTTATGTTTTCTAGTGTAA
TTTAGTTGCGATTTCACATTTTCCATTTAAATTTGTATTTTTTTGCTTTT
AAATAATAAATTCTAGTTCGA
back to top

protein sequence of SMED30032702-orf-1

>SMED30032702-orf-1 ID=SMED30032702-orf-1|Name=SMED30032702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=353bp
MKNLTMFHGSVVTKPEAFVYDIYGVYILFIGLFGCIENGCVILVFIRSKL
LWTPSNIFVFDLVCSDFLICTIGFPFLMLSSFYQSWIFDISGCYVYAFSM
SITGMHSIFILFVIAVERFNAVFYPLQTVKTVTVKRSIYFVICCWTLGVI
ISIPPLVGWNRYVLEGLQISCSFDMFDTSWQSKSYTMLLIGTFLLILTAI
IICYVKIFFKVRDQIKEMRIVYTKSFNNLQRIKESKVERKLIYMGFNVTL
FFVLSWGPYAMVTILALCNVLTEKGSVLIVAIPAYFAKSFTICNPVIYIL
NYPQFKRELYKLLCVLKQIPCQKKQSQTTQNLSTITRHVPSAVQTPPNQV
TA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001750photoreceptor outer segment
GO:0042995cell projection
GO:0097381photoreceptor disc membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:000550211-cis retinal binding
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0008020G-protein coupled photoreceptor activity
GO:0009881photoreceptor activity
Vocabulary: biological process
TermDefinition
GO:0016038absorption of visible light
GO:0016056rhodopsin mediated signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007601visual perception
GO:0007165signal transduction
GO:0007602phototransduction
GO:0009584detection of visible light
GO:0018298protein-chromophore linkage
GO:0050896response to stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR001760Opsin
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 185..208
score: 25.69
coord: 241..265
score: 24.2
coord: 55..76
score: 24.11
coord: 280..306
score: 25.2
coord: 22..46
score: 22.57
coord: 136..157
score: 21.69
coord: 100..122
score: 28.37
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 37..298
e-value: 9.7E-36
score: 123.4
IPR001760OpsinPRINTSPR00238OPSINcoord: 43..55
score: 37.46
coord: 277..289
score: 46.53
coord: 158..170
score: 58.79
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 4..337
e-value: 1.0E-71
score: 243.4
NoneNo IPR availablePANTHERPTHR24240OPSINcoord: 23..315
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..35
score: 5.0
NoneNo IPR availableCDDcd149697tmA_Opsins_type2_animalscoord: 22..309
e-value: 8.49683E-71
score: 220.541
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 18..330
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 22..44
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 37..298
score: 36.079