POC1 centriolar protein homolog A

Overview
NamePOC1 centriolar protein homolog A
Smed IDSMED30032689
Length (bp)1678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of POC1 centriolar protein homolog A (SMED30032689) t-SNE clustered cells

Violin plots show distribution of expression levels for POC1 centriolar protein homolog A (SMED30032689) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of POC1 centriolar protein homolog A (SMED30032689) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for POC1 centriolar protein homolog A (SMED30032689) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 420.624 bits (1080), Expect = 7.124e-144
Identity = 184/294 (62.59%), Postives = 237/294 (80.61%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VTCVDF+ N+ QLASG +DSCLM+W+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D    VT SDDKT+KVW  HRQKF +SL++H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++EC+H++ EHGGFV  + FHP+G+ IA+ G D+ V +WD+R ++LLQHY  H++ VN +SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 421.009 bits (1081), Expect = 3.260e-143
Identity = 184/294 (62.59%), Postives = 237/294 (80.61%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VTCVDF+ N+ QLASG +DSCLM+W+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D    VT SDDKT+KVW  HRQKF +SL++H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++EC+H++ EHGGFV  + FHP+G+ IA+ G D+ V +WD+R ++LLQHY  H++ VN +SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          

HSP 2 Score: 56.6102 bits (135), Expect = 7.549e-8
Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            ++ STLE+IVGQLD+LTQTVSILEQRLT  E+KL +
Sbjct:  358 TLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQ 393          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Match: POC1B (POC1 centriolar protein B [Source:HGNC Symbol;Acc:HGNC:30836])

HSP 1 Score: 379.022 bits (972), Expect = 8.339e-126
Identity = 168/293 (57.34%), Postives = 222/293 (75.77%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            EDP L+ +FKGHK  +T +D +PN  QLA+   D+ LM+WNFKP  RAYR+VGH+D + SV+FSP G L+ASASRD+TVRLW+P  +G+   F+AHTA VRSVD S D   + T S+DK+IKVW M+RQ+F YSL  H +WVRC +FS DG+LI S S+DKTIK+WD  N++C++ F +  GF   + F+P+G+ IAS G+D  V +WD+R+NKLLQHY  H+  VN +SFHPSGN+LI++S D ++KI DLLEGRL+YT+QGH GP+   +FS  GE+FASGGAD QV LW+
Sbjct:    6 EDPVLERYFKGHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLWR 298          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 372.859 bits (956), Expect = 5.211e-125
Identity = 162/262 (61.83%), Postives = 211/262 (80.53%), Query Frame = 2
Query:  155 IDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            +DSCLM+W+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D    VT SDDKT+KVW  HRQKF +SL++H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++EC+H++ EHGGFV  + FHP+G+ IA+ G D+ V +WD+R ++LLQHY  H++ VN +SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    1 MDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 262          

HSP 2 Score: 152.14 bits (383), Expect = 1.871e-40
Identity = 83/244 (34.02%), Postives = 124/244 (50.82%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIW--NFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIY 808
            F GHKD VTCV+F+P+   LASG  D  + IW  N K ++  +R   H   + SV F   GQ   +AS DKTV++W    +        H   VR    S D   +V+ SDDKT+K+W    ++  +S  EH  +V  V F   G  IA++  D T+K+WD      +  +Q H   V  L+FHP+G+Y+ +  +DS + I D+   +LL     H  P   V+F  +G +  S   D  + ++
Sbjct:   19 FTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFR--AHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVW 260          

HSP 3 Score: 56.225 bits (134), Expect = 6.937e-8
Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            ++ STLE+IVGQLD+LTQTVSILEQRLT  E+KL +
Sbjct:  320 TLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQ 355          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Match: POC1B (POC1 centriolar protein B [Source:HGNC Symbol;Acc:HGNC:30836])

HSP 1 Score: 340.117 bits (871), Expect = 2.581e-111
Identity = 150/256 (58.59%), Postives = 197/256 (76.95%), Query Frame = 2
Query:  170 MIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            M+WNFKP  RAYR+VGH+D + SV+FSP G L+ASASRD+TVRLW+P  +G+   F+AHTA VRSVD S D   + T S+DK+IKVW M+RQ+F YSL  H +WVRC +FS DG+LI S S+DKTIK+WD  N++C++ F +  GF   + F+P+G+ IAS G+D  V +WD+R+NKLLQHY  H+  VN +SFHPSGN+LI++S D ++KI DLLEGRL+YT+QGH GP+   +FS  GE+FASGGAD QV LW+
Sbjct:    1 MLWNFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLWR 256          

HSP 2 Score: 51.2174 bits (121), Expect = 3.605e-6
Identity = 26/79 (32.91%), Postives = 37/79 (46.84%), Query Frame = 2
Query:   68 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW 304
            KL  H++ H   V C+ F+P+ + L +   D  L I +       Y   GH   + +V FS  G+L AS   D  V LW
Sbjct:  177 KLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLW 255          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 143.28 bits (360), Expect = 2.686e-36
Identity = 99/310 (31.94%), Postives = 153/310 (49.35%), Query Frame = 2
Query:   83 FKGHKDKV-TCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDI------RMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGE-MFASGGADHQVFLW--QAGQLSEPSIAVHSG 979
             +GH+D V TC+  + +   L +G  D+ L +W        Y  VGH   + + + S  G+ + S S D+TV++W  ++ G  L   + HT+TVR + ++   L  VTGS D T++VW +   +   +L+ H   VRCV+F  DG  + S   D T+K+W+ H   CI T   H   V SL F    S + SG  D+ + +WD           LLQ +TS TS          GN L+S + DS ++++D+ EG  ++ + GH   I  T+    G  M A+   D  V LW  + G L    + + SG
Sbjct:  251 LRGHEDHVITCMQIHDDV--LVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVW-STVDGSLLHTLQGHTSTVRCMAMAGSIL--VTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTS-----GMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAI--TSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSG 546          

HSP 2 Score: 99.3673 bits (246), Expect = 9.772e-22
Identity = 70/238 (29.41%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  242 KFSPTGQLVASASR----DKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE---MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            KF    +  A  SR    DK  + W  +    S V R H   V    I+C  +    +VTGSDD T+KVW + + +  Y+L  H   V   + S  G+ I S S D+T+K+W   +   +HT Q H   V  +A    GS + +G  D+ + +WD+   + L     H + V  V F   G  ++S   D ++KI++   GR + T+ GH   +    F     +  SG  D  + +W
Sbjct:  216 KFGDIFERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHV----ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAM--AGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW 445          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 142.895 bits (359), Expect = 3.160e-36
Identity = 99/310 (31.94%), Postives = 153/310 (49.35%), Query Frame = 2
Query:   83 FKGHKDKV-TCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDI------RMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGE-MFASGGADHQVFLW--QAGQLSEPSIAVHSG 979
             +GH+D V TC+  + +   L +G  D+ L +W        Y  VGH   + + + S  G+ + S S D+TV++W  ++ G  L   + HT+TVR + ++   L  VTGS D T++VW +   +   +L+ H   VRCV+F  DG  + S   D T+K+W+ H   CI T   H   V SL F    S + SG  D+ + +WD           LLQ +TS TS          GN L+S + DS ++++D+ EG  ++ + GH   I  T+    G  M A+   D  V LW  + G L    + + SG
Sbjct:  249 LRGHEDHVITCMQIHDDV--LVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVW-STVDGSLLHTLQGHTSTVRCMAMAGSIL--VTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTS-----GMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAI--TSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSG 544          

HSP 2 Score: 99.3673 bits (246), Expect = 1.052e-21
Identity = 70/238 (29.41%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  242 KFSPTGQLVASASR----DKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE---MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            KF    +  A  SR    DK  + W  +    S V R H   V    I+C  +    +VTGSDD T+KVW + + +  Y+L  H   V   + S  G+ I S S D+T+K+W   +   +HT Q H   V  +A    GS + +G  D+ + +WD+   + L     H + V  V F   G  ++S   D ++KI++   GR + T+ GH   +    F     +  SG  D  + +W
Sbjct:  214 KFGDIFERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHV----ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAM--AGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW 443          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 142.895 bits (359), Expect = 3.160e-36
Identity = 99/310 (31.94%), Postives = 153/310 (49.35%), Query Frame = 2
Query:   83 FKGHKDKV-TCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDI------RMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGE-MFASGGADHQVFLW--QAGQLSEPSIAVHSG 979
             +GH+D V TC+  + +   L +G  D+ L +W        Y  VGH   + + + S  G+ + S S D+TV++W  ++ G  L   + HT+TVR + ++   L  VTGS D T++VW +   +   +L+ H   VRCV+F  DG  + S   D T+K+W+ H   CI T   H   V SL F    S + SG  D+ + +WD           LLQ +TS TS          GN L+S + DS ++++D+ EG  ++ + GH   I  T+    G  M A+   D  V LW  + G L    + + SG
Sbjct:  249 LRGHEDHVITCMQIHDDV--LVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVW-STVDGSLLHTLQGHTSTVRCMAMAGSIL--VTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTS-----GMQLRGNILVSCNADSHVRVWDIHEGTCVHMLSGHRSAI--TSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSG 544          

HSP 2 Score: 99.3673 bits (246), Expect = 1.052e-21
Identity = 70/238 (29.41%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  242 KFSPTGQLVASASR----DKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE---MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            KF    +  A  SR    DK  + W  +    S V R H   V    I+C  +    +VTGSDD T+KVW + + +  Y+L  H   V   + S  G+ I S S D+T+K+W   +   +HT Q H   V  +A    GS + +G  D+ + +WD+   + L     H + V  V F   G  ++S   D ++KI++   GR + T+ GH   +    F     +  SG  D  + +W
Sbjct:  214 KFGDIFERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHV----ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAM--AGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVW 443          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Match: lis-1 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9NDC9])

HSP 1 Score: 137.887 bits (346), Expect = 1.792e-35
Identity = 82/267 (30.71%), Postives = 129/267 (48.31%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYR-FVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSD-------GQ--------LIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYD 811
            E  +L+   KGH D V  +  +    QL S   D  + +W+F       +   GHE  + SV F PTG  V SASRD T++ W  S       FR H   VR + IS D     + S D+T+ VW    +     L +H++ V CV ++ D       GQ        ++ S S D++IK W+ +  + + T   H  +V  LAFHP G Y+ S   D  + +W++   + ++   +H   V+ V+FH +  F+I+ S D S K+++
Sbjct:  136 ETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWE 402          

HSP 2 Score: 135.576 bits (340), Expect = 1.303e-34
Identity = 80/315 (25.40%), Postives = 144/315 (45.71%), Query Frame = 2
Query:   44 ALTFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSY---------------IASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            A  ++  P       GH+  +T V F+P  + +AS   D+ + +W+++         GH DA+  +     G+ + S S D +++LW      + L   + H  TV SV        +++ S D TIK W +      Y+   H +WVR +R S+DG L AS+S D+T+ +W    +      ++H   V  + + P+ +Y               + SG  D  +  W+I    +L    +H + V  ++FHP G +LIS +DD ++++++L   R +  ++ HE  +   AF        +G  D    +W+ 
Sbjct:   89 AADWIPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWEC 403          

HSP 3 Score: 125.176 bits (313), Expect = 4.901e-31
Identity = 66/218 (30.28%), Postives = 105/218 (48.17%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE---------------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
             KGH+  V+ V F P    + S   D  +  W+       Y F GH D +  ++ S  G L ASAS D+TV +W  + K   LV R H   V  V+ + D                  + +GS D++IK W ++     ++L  H+NWVR + F   G+ + S +DDKT+++W+   Q C+   + H  FV ++AFH    ++ +G  D    +W+ R
Sbjct:  187 LKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR 404          

HSP 4 Score: 55.4546 bits (132), Expect = 5.096e-8
Identity = 26/80 (32.50%), Postives = 41/80 (51.25%), Query Frame = 2
Query:  707 QHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQ 946
            Q  T H  P+  V FHP    + S S+D+++K++D   G+L  T++GH   +   A    G+   S  +D  + LW  GQ
Sbjct:  100 QKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQ 179          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 136.346 bits (342), Expect = 4.184e-35
Identity = 80/297 (26.94%), Postives = 143/297 (48.15%), Query Frame = 2
Query:   68 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTF-QEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS---GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGG--ADHQVFLWQA 940
            KL    +GH   ++   F+P    L +   D  + IWN           GH+  +  + +S   + V SAS DKT++++       +   + H   V   + +  +  +V+GS D+++++W +       +L  H + V  V F+ DG LIAS S D  +++WD  N +CI T   +    V  + F PNG YI +   DS + +WD    K L+ YT H +    +  + S   G ++IS S+D  + I++L    ++  ++GH  P+L +       + ASG    D+++ +W++
Sbjct:   78 KLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIWRS 374          

HSP 2 Score: 65.855 bits (159), Expect = 2.548e-11
Identity = 32/123 (26.02%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  566 NQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            N + + T + H   + S  F P G Y+ +   D  V IW++      +  T H   VN +++      ++S+SDD ++KI++++  R+  T++GH   +    F+    +  SG  D  V +W
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIW 198          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0321318)

HSP 1 Score: 274.633 bits (701), Expect = 1.118e-86
Identity = 125/296 (42.23%), Postives = 190/296 (64.19%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
               DP L+ HF GH   +T + F P+ +Q+A+   DS +++WN     R  RF  H   +  V +SP G LVASA  D+TV++W P ++G S  F AH+  VRSVD       M+T SDDK+ K+W++ R++F  S  +  NWVR  +FS +G+L+A++SDDK+++++D  + EC+ TF E       LA+HP G+ +A     + + I+D+  ++LLQ Y  H++PVN V+FHPSG+FL+S SDD +++I DLLEGR +YT+ GH   +   AFS  G+ FA+GG+D Q+ +WQ+
Sbjct:    4 LFRDPALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNLVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVWQS 299          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0075863)

HSP 1 Score: 273.863 bits (699), Expect = 1.467e-86
Identity = 125/296 (42.23%), Postives = 190/296 (64.19%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
               DP L+ HF GH   +T + F P+ +Q+A+   DS +++WN     R  RF  H   +  V +SP G LVASA  D+TV++W P ++G S  F AH+  VRSVD       M+T SDDK+ K+W++ R++F  S  +  NWVR  +FS +G+L+A++SDDK+++++D  + EC+ TF E       LA+HP G+ +A     + + I+D+  ++LLQ Y  H++PVN V+FHPSG+FL+S SDD +++I DLLEGR +YT+ GH   +   AFS  G+ FA+GG+D Q+ +WQ+
Sbjct:    4 LFRDPALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGNLVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRIYDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLVWQS 299          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 147.902 bits (372), Expect = 2.151e-39
Identity = 79/251 (31.47%), Postives = 132/251 (52.59%), Query Frame = 2
Query:  194 TRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTS-PVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGP---ILGTAFSHCGEMFASGGADHQVFLW 934
            T  +   GH  A+ +VKFSP G+ +AS+S DK +++W             H   +  V  S D+  +V+GSDDKT+KVW++   K   +L  H N+V C  F+    LI S S D+++++WD    +C+ T   H   V ++ F+ +GS I S   D    IWD    + L+      + PV+ V F P+G ++++++ D+++K++D  +G+ L T  GH+     I        G+   SG  D+ V++W
Sbjct:   63 TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW 313          

HSP 2 Score: 134.035 bits (336), Expect = 2.069e-34
Identity = 85/296 (28.72%), Postives = 143/296 (48.31%), Query Frame = 2
Query:   71 LQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTF-QEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS---GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGA--DHQVFLWQA 940
            L+    GH   V+ V F+PN   LAS   D  + IW            GH+  I  V +S   +L+ S S DKT+++W  S        + H+  V   + +  +  +V+GS D+++++W +   K   +L  H + V  V F+ DG LI SSS D   ++WD  + +C+ T   +    V  + F PNG YI +   D+ + +WD    K L+ YT H +    +  + S   G +++S S+D+ + I++L    ++  +QGH   +L TA      + AS     D  + LW++
Sbjct:   64 LKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKS 359          

HSP 3 Score: 105.145 bits (261), Expect = 2.564e-24
Identity = 69/255 (27.06%), Postives = 122/255 (47.84%), Query Frame = 2
Query:   62 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKN-WVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGG--FVPSLAFH-PNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSS--DDSSMKIY 808
            D K +    GHK  ++ V ++ +S  L SG  D  L +W            GH + +    F+P   L+ S S D++VR+W            AH+  V +V  + D   +V+ S D   ++W     +   +L +  N  V  V+FS +G+ I +++ D T+KLWD    +C+ T+  H    +     F    G +I SG  D+ V IW+++  +++Q    HT  V   + HP+ N + S++  +D ++K++
Sbjct:  103 DGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357          

HSP 4 Score: 67.0106 bits (162), Expect = 1.183e-11
Identity = 40/147 (27.21%), Postives = 68/147 (46.26%), Query Frame = 2
Query:  560 RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW--QAGQL-------SEPSIAVH 973
            + N     T   H   V ++ F PNG ++AS   D  + IW     K  +  + H   ++ V++      L+S SDD ++K+++L  G+ L T++GH   +    F+    +  SG  D  V +W  + G+        S+P  AVH
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVH 205          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 147.902 bits (372), Expect = 2.151e-39
Identity = 79/251 (31.47%), Postives = 132/251 (52.59%), Query Frame = 2
Query:  194 TRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTS-PVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGP---ILGTAFSHCGEMFASGGADHQVFLW 934
            T  +   GH  A+ +VKFSP G+ +AS+S DK +++W             H   +  V  S D+  +V+GSDDKT+KVW++   K   +L  H N+V C  F+    LI S S D+++++WD    +C+ T   H   V ++ F+ +GS I S   D    IWD    + L+      + PV+ V F P+G ++++++ D+++K++D  +G+ L T  GH+     I        G+   SG  D+ V++W
Sbjct:   63 TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW 313          

HSP 2 Score: 134.035 bits (336), Expect = 2.069e-34
Identity = 85/296 (28.72%), Postives = 143/296 (48.31%), Query Frame = 2
Query:   71 LQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTF-QEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS---GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGA--DHQVFLWQA 940
            L+    GH   V+ V F+PN   LAS   D  + IW            GH+  I  V +S   +L+ S S DKT+++W  S        + H+  V   + +  +  +V+GS D+++++W +   K   +L  H + V  V F+ DG LI SSS D   ++WD  + +C+ T   +    V  + F PNG YI +   D+ + +WD    K L+ YT H +    +  + S   G +++S S+D+ + I++L    ++  +QGH   +L TA      + AS     D  + LW++
Sbjct:   64 LKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKS 359          

HSP 3 Score: 105.145 bits (261), Expect = 2.564e-24
Identity = 69/255 (27.06%), Postives = 122/255 (47.84%), Query Frame = 2
Query:   62 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKN-WVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGG--FVPSLAFH-PNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSS--DDSSMKIY 808
            D K +    GHK  ++ V ++ +S  L SG  D  L +W            GH + +    F+P   L+ S S D++VR+W            AH+  V +V  + D   +V+ S D   ++W     +   +L +  N  V  V+FS +G+ I +++ D T+KLWD    +C+ T+  H    +     F    G +I SG  D+ V IW+++  +++Q    HT  V   + HP+ N + S++  +D ++K++
Sbjct:  103 DGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357          

HSP 4 Score: 67.0106 bits (162), Expect = 1.183e-11
Identity = 40/147 (27.21%), Postives = 68/147 (46.26%), Query Frame = 2
Query:  560 RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW--QAGQL-------SEPSIAVH 973
            + N     T   H   V ++ F PNG ++AS   D  + IW     K  +  + H   ++ V++      L+S SDD ++K+++L  G+ L T++GH   +    F+    +  SG  D  V +W  + G+        S+P  AVH
Sbjct:   59 KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVH 205          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 145.591 bits (366), Expect = 4.138e-38
Identity = 85/313 (27.16%), Postives = 149/313 (47.60%), Query Frame = 2
Query:   65 PKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAF--------------------HPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            P  +    GH+  +T V F+P  + + S   D+ + IW+F+         GH D++  V F   G+L+AS S D +++LW      E +     H   V SV        +++ S D+TIK+W++       +   H+ WVR VR   +G + A+ S+D+TI++W  ++++C    ++H   V  +A+                    H  G ++ASG  D  + IWD+ +   L   + H + V  ++FHP G +L+S+SDD +++++DL   R + T+  H+       F        SG  D  V +W+ 
Sbjct:   98 PPEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWEC 410          

HSP 2 Score: 138.658 bits (348), Expect = 1.193e-35
Identity = 78/273 (28.57%), Postives = 131/273 (47.99%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFV-GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSS--------------------DGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYD 811
             E  + +   KGH D V  V F+     LAS   D  + +W+F+      + + GH+  + SV F P G  V SASRD+T+++W  +       +  H   VR V +  +     T S+D+TI+VW  + +     L +H++ V C+ ++                      G  +AS S DKTI++WD     C+ T   H  +V  LAFHP G Y+ S   D  + +WD+R  + ++   +H     ++ FH +  ++IS S D ++K+++
Sbjct:  137 FETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409          

HSP 3 Score: 115.546 bits (288), Expect = 1.480e-27
Identity = 65/221 (29.41%), Postives = 102/221 (46.15%), Query Frame = 2
Query:   89 GHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDI-------------SCDNLE-------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            GH   V+ V F P    + S   D  + +W          + GH + +  V+    G + A+ S D+T+R+W+ + K   +  R H  TV  +                 DN +       + +GS DKTI++W +       +L+ H NWVR + F   G+ + S+SDDKTI++WD  N+ C+ T   H  F  S+ FH    Y+ SG  D  V +W+ R
Sbjct:  191 GHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR 411          

HSP 4 Score: 53.9138 bits (128), Expect = 2.173e-7
Identity = 26/86 (30.23%), Postives = 45/86 (52.33%), Query Frame = 2
Query:  716 TSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVH 973
            T H + +  V FHP    ++S+S+D++++I+D   G    +++GH   +   AF   G++ AS  AD  + LW   Q  E    +H
Sbjct:  105 TGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMH 190          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 398.282 bits (1022), Expect = 2.000e-133
Identity = 178/296 (60.14%), Postives = 225/296 (76.01%), Query Frame = 2
Query:   50 TFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            + MEDP L+ HFKGHKD ++C DFNPN+ QLA+G  D  LMIWN  P+ RA+RFVGH D I  V F+P+G LVAS+SRD+TVRLW PSIKGES VF+AHTA+VRSV  S D   +VT SDDK++KVW + R+KF YSLN H NWVRC RFS DG+LIAS  DD+T++LWD  + +CI+ F ++GG    + F+ +G+ IAS G D+ + IWDIR NKL+QHY  H + VN  SFHPSGN+LIS S DS++KI DLLEGRL+YT+ GH+GP+L   FS  G++FASGGAD QV +W+
Sbjct:    3 SVMEDPTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMWK 298          

HSP 2 Score: 108.997 bits (271), Expect = 8.439e-25
Identity = 62/207 (29.95%), Postives = 92/207 (44.44%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            FK H   V  V F+ +  +L +   D  + +W  + +   Y    H + +   +FSP G+L+AS   D+TVRLW  S      +F  +  +   VD +     + +   D TIK+W +   K       H   V C  F   G  + S S D TIK+ D      I+T   H G V ++ F  +G   ASGG DS V +W    + L
Sbjct:   98 FKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMWKTNFDSL 304          

HSP 3 Score: 51.6026 bits (122), Expect = 1.670e-6
Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 2
Query: 1346 SRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            + R  +  S+ STLE IV QLDILTQTV++LE+RLT  E+KL    D++
Sbjct:  420 AERSGIPSSLTSTLENIVQQLDILTQTVAVLEERLTLTEDKLRTCLDNQ 468          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:386932])

HSP 1 Score: 395.586 bits (1015), Expect = 3.023e-132
Identity = 177/293 (60.41%), Postives = 223/293 (76.11%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            EDP L+ HFKGHKD ++C DFNPN+ QLA+G  D  LMIWN  P+ RA+RFVGH D I  V F+P+G LVAS+SRD+TVRLW PSIKGES VF+AHTA+VRSV  S D   +VT SDDK++KVW + R+KF YSLN H NWVRC RFS DG+LIAS  DD+T++LWD  + +CI+ F ++GG    + F+ +G+ IAS G D+ + IWDIR NKL+QHY  H + VN  SFHPSGN+LIS S DS++KI DLLEGRL+YT+ GH+GP+L   FS  G++FASGGAD QV +W+
Sbjct:    6 EDPTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAPSGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMWK 298          

HSP 2 Score: 108.612 bits (270), Expect = 8.917e-25
Identity = 62/207 (29.95%), Postives = 92/207 (44.44%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            FK H   V  V F+ +  +L +   D  + +W  + +   Y    H + +   +FSP G+L+AS   D+TVRLW  S      +F  +  +   VD +     + +   D TIK+W +   K       H   V C  F   G  + S S D TIK+ D      I+T   H G V ++ F  +G   ASGG DS V +W    + L
Sbjct:   98 FKAHTASVRSVHFSRDGQRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMWKTNFDSL 304          

HSP 3 Score: 79.7221 bits (195), Expect = 2.254e-15
Identity = 47/169 (27.81%), Postives = 78/169 (46.15%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLW 556
            +E  K       H + V C  F+P+   +AS G D  + +W+         F  +  +   V F+ +G  +AS+  D T+++W   I+   L+  ++ H A V           +++GS D TIK+  +   +  Y+L+ HK  V  V FS DG L AS   D  + +W
Sbjct:  131 VERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIW--DIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMW 297          

HSP 4 Score: 51.6026 bits (122), Expect = 1.684e-6
Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 2
Query: 1346 SRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            + R  +  S+ STLE IV QLDILTQTV++LE+RLT  E+KL    D++
Sbjct:  420 AERSGIPSSLTSTLENIVQQLDILTQTVAVLEERLTLTEDKLRTCLDNQ 468          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 212.231 bits (539), Expect = 1.486e-65
Identity = 95/182 (52.20%), Postives = 129/182 (70.88%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGG 604
            +DP L+ +FKGH+D +T +DF+P+  Q+ASG +D+C+M+WN KPQ+RAYRF GH+DA+  V+FSP+              L     KGES++FRAHT +VRSV  S D   ++T SDD++IK+W +HRQK   +L EH NWVRC RFS DGQL+ S SDD+T+KLWD  +++ IHTF E GG
Sbjct:    1 DDPTLERNFKGHRDAITSLDFSPSGKQIASGSVDACVMVWNMKPQSRAYRFTGHKDAVTCVQFSPSAHXXXXXXXXXXXLLLSFFRKGESVLFRAHTGSVRSVCFSADGQSLLTASDDQSIKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRTVKLWDASSRQLIHTFCEPGG 182          

HSP 2 Score: 96.6709 bits (239), Expect = 9.637e-23
Identity = 56/169 (33.14%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  209 FVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHY 715
            F GH DAI S+ FSP+G+ +AS S D  V +W    +  +  F  H   V  V  S                +    R+  S     H   VR V FS+DGQ + ++SDD++IKLW  H Q+ I T +EH  +V    F P+G  + S   D  V +WD    +L+  +
Sbjct:    9 FKGHRDAITSLDFSPSGKQIASGSVDACVMVWNMKPQSRAYRFTGHKDAVTCVQFSPSAHXXXXXXXXXXXLLLSFFRKGESVLFRAHTGSVRSVCFSADGQSLLTASDDQSIKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRTVKLWDASSRQLIHTF 177          

HSP 3 Score: 82.0333 bits (201), Expect = 1.232e-17
Identity = 44/168 (26.19%), Postives = 75/168 (44.64%), Query Frame = 2
Query:  335 FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYT 838
            F+ H   + S+D S    ++ +GS D  + VW M  Q  +Y    HK+ V CV+FS                L     +     F+ H G V S+ F  +G  + +   D  + +W +   K++     H + V    F P G  ++S SDD ++K++D    +L++T
Sbjct:    9 FKGHRDAITSLDFSPSGKQIASGSVDACVMVWNMKPQSRAYRFTGHKDAVTCVQFSPSAHXXXXXXXXXXXLLLSFFRKGESVLFRAHTGSVRSVCFSADGQSLLTASDDQSIKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRTVKLWDASSRQLIHT 176          

HSP 4 Score: 61.6178 bits (148), Expect = 1.308e-10
Identity = 39/157 (24.84%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  470 HKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            H++ +  + FS  G+ IAS S D  + +W+   Q   + F  H   V  + F P+              +           + +HT  V +V F   G  L+++SDD S+K++ +   +++ T++ H   +    FS  G++  S   D  V LW A
Sbjct:   12 HRDAITSLDFSPSGKQIASGSVDACVMVWNMKPQSRAYRFTGHKDAVTCVQFSPSAHXXXXXXXXXXXLLLSFFRKGESVLFRAHTGSVRSVCFSADGQSLLTASDDQSIKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRTVKLWDA 168          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 159.458 bits (402), Expect = 5.218e-43
Identity = 90/314 (28.66%), Postives = 148/314 (47.13%), Query Frame = 2
Query:   65 PKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPN--------------------GSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            P  +    GH+  VT V F+P  S + S   D+ + +W+++         GH D++  + F  TG+L+AS S D T++LW    +G   +     H   V SV I  +   +V+ S DKT+K+W++       +   H+ WVR VR + DG L+AS S+D+T+++W    +EC    +EH   V  +++ P                     G ++ SG  D  + +WDI     L     H + V  V FHP G F++S +DD +++I+D    R + T+  HE  +    F        +G  D  V +W+ 
Sbjct:   98 PPEKYALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLW--DFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWEC 409          

HSP 2 Score: 124.405 bits (311), Expect = 1.777e-30
Identity = 68/221 (30.77%), Postives = 102/221 (46.15%), Query Frame = 2
Query:   89 GHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE--------------------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            GH   V+ V   PN   + S   D  + +W          F GH + +  V+ +  G L+AS S D+TVR+WV + K      R H   V  +  + ++                      +++GS DKTIK+W +       +L  H NWVR V F   G+ + S +DDKT+++WD  N+ C+ T   H  FV SL FH    Y+ +G  D  V +W+ R
Sbjct:  190 GHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWECR 410          

HSP 3 Score: 107.071 bits (266), Expect = 1.553e-24
Identity = 70/273 (25.64%), Postives = 117/273 (42.86%), Query Frame = 2
Query:  176 WNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS--------------------GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            W  +P  + Y   GH   +  V F P   L+ SAS D T+++W           + HT +V+ +        + + S D TIK+W     +   +++ H + V  V    +G  I S+S DKT+K+W+     C+ TF  H  +V  +  + +G+ +AS   D  V +W +   +       H   V  +S+ P                     G FL+S S D ++K++D+  G  L T+ GH+  + G  F   G    S   D  + +W
Sbjct:   94 WIPRPPEK-YALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIW 365          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 159.458 bits (402), Expect = 5.218e-43
Identity = 90/314 (28.66%), Postives = 148/314 (47.13%), Query Frame = 2
Query:   65 PKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPN--------------------GSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            P  +    GH+  VT V F+P  S + S   D+ + +W+++         GH D++  + F  TG+L+AS S D T++LW    +G   +     H   V SV I  +   +V+ S DKT+K+W++       +   H+ WVR VR + DG L+AS S+D+T+++W    +EC    +EH   V  +++ P                     G ++ SG  D  + +WDI     L     H + V  V FHP G F++S +DD +++I+D    R + T+  HE  +    F        +G  D  V +W+ 
Sbjct:   98 PPEKYALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLW--DFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWEC 409          

HSP 2 Score: 124.405 bits (311), Expect = 1.777e-30
Identity = 68/221 (30.77%), Postives = 102/221 (46.15%), Query Frame = 2
Query:   89 GHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE--------------------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            GH   V+ V   PN   + S   D  + +W          F GH + +  V+ +  G L+AS S D+TVR+WV + K      R H   V  +  + ++                      +++GS DKTIK+W +       +L  H NWVR V F   G+ + S +DDKT+++WD  N+ C+ T   H  FV SL FH    Y+ +G  D  V +W+ R
Sbjct:  190 GHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWECR 410          

HSP 3 Score: 107.071 bits (266), Expect = 1.553e-24
Identity = 70/273 (25.64%), Postives = 117/273 (42.86%), Query Frame = 2
Query:  176 WNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS--------------------GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            W  +P  + Y   GH   +  V F P   L+ SAS D T+++W           + HT +V+ +        + + S D TIK+W     +   +++ H + V  V    +G  I S+S DKT+K+W+     C+ TF  H  +V  +  + +G+ +AS   D  V +W +   +       H   V  +S+ P                     G FL+S S D ++K++D+  G  L T+ GH+  + G  F   G    S   D  + +W
Sbjct:   94 WIPRPPEK-YALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIW 365          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Match: mgc69520 (Novel 7 transmembrane receptor (rhodopsin family) protein [Source:Xenbase;Acc:XB-GENE-5853033])

HSP 1 Score: 457.218 bits (1175), Expect = 5.483e-157
Identity = 244/484 (50.41%), Postives = 308/484 (63.64%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHD--LNGDRSVNQDQSVPA--NHNTANHNKTDGTDCVPPG--KSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            EDP L+ HFKGH+D VT VDFNPN+ QLASG +DSCLMIWN KPQ RAYRFVGH+DAILSV FSP+G L+ASASRDKTVRLWVPS+K    VF+AHT TVRSV  S D   +VT SDDKTIKVW +HRQKF +SLN+H NWVRC +FS D +LI S+SDDKTIKLWD+ ++ECIH+F EHGGFV  + FHP+G+ IA+  TD+ V +WDIRMNKL+QHY  H+  VN++SFHPSGN+LI++S+DS++K+ DLLEGRLLYT+ GH+GP+    FS  GE FASGG+D QV +W+       S A                               + R+HD  LNG    +    VPA   H    + +TD  D + P   +    DR   ++  S  + +H  +  +D  + TV +                               TLE+IVGQLDILT+TV ILEQRL+  E+KL E  D++
Sbjct:    6 EDPSLERHFKGHRDTVTTVDFNPNTKQLASGSMDSCLMIWNMKPQMRAYRFVGHKDAILSVDFSPSGHLIASASRDKTVRLWVPSVKRRIPVFKAHTGTVRSVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDRRLIVSASDDKTIKLWDKTSRECIHSFCEHGGFVNFVDFHPSGTCIAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSFHPSGNYLITASNDSTLKVLDLLEGRLLYTLHGHQGPVTSVKFSREGEFFASGGSDEQVMVWKTN-FDSASYA----------------------------DLLKYRQHDQFLNGG---DYTSGVPAADRHRPERNAQTDQADDLEPRHIEMSAKDRSSPLSYTSRSIDQHHPQA-EDGNLRTVAS-------------------------------TLEHIVGQLDILTRTVGILEQRLSLTEDKLKECIDNQ 425          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Match: mgc69520 (Novel 7 transmembrane receptor (rhodopsin family) protein [Source:Xenbase;Acc:XB-GENE-5853033])

HSP 1 Score: 421.394 bits (1082), Expect = 3.737e-143
Identity = 236/490 (48.16%), Postives = 300/490 (61.22%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTV----RLW-VPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHD--LNGDRSVNQDQSVPA--NHNTANHNKTDGTDCVPPG--KSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            +EDP L+ HFKGH+D VT VDFNPN+ QLASG +DSCLMIWN KPQ RAYRFVGH+DAILSV FSP+G L+ASASRDKT      LW +P       VF+AHT TVRSV  S D   +VT SDDKTIKVW +HRQKF +SLN+H NWVRC +      LI S+SDDKTIKLWD+ ++ECIH+F EHGGFV  + FHP+G+ IA+  TD+ V +WDIRMNKL+QHY  H+  VN++SFHPSGN+LI++S+DS++K+ DLLEGRLLYT+ GH+GP+    FS  GE FASGG+D QV +W+       S A                               + R+HD  LNG    +    VPA   H    + +TD  D + P   +    DR   ++  S  + +H  +  +D  + TV +                               TLE+IVGQLDILT+TV ILEQRL+  E+KL E  D++
Sbjct:    1 IEDPSLERHFKGHRDTVTTVDFNPNTKQLASGSMDSCLMIWNMKPQMRAYRFVGHKDAILSVDFSPSGHLIASASRDKTSLCFRALWRIP-------VFKAHTGTVRSVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAK------LIVSASDDKTIKLWDKTSRECIHSFCEHGGFVNFVDFHPSGTCIAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSFHPSGNYLITASNDSTLKVLDLLEGRLLYTLHGHQGPVTSVKFSREGEFFASGGSDEQVMVWKT-NFDSASYA----------------------------DLLKYRQHDQFLNGG---DYTSGVPAADRHRPERNAQTDQADDLEPRHIEMSAKDRSSPLSYTSRSIDQHHPQA-EDGNLRTVAS-------------------------------TLEHIVGQLDILTRTVGILEQRLSLTEDKLKECIDNQ 413          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 395.201 bits (1014), Expect = 5.201e-133
Identity = 176/295 (59.66%), Postives = 228/295 (77.29%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            F EDP LQ HFKGHKD VT VDF+P+  QLAS   D+C+MIWNFKPQ+RAY++ GH++A+  V+FSP+G LVAS+S+D+TVRLW P+IKGES V +AHTA VR V+ S D    +T SDDK+IK W +HRQ+F YSL EH NWVRC RFS DG+LIAS SDDKT+++WD  N+ CI+TF ++ G    + F+P G+ +AS G DS V +WDIR NKLLQHY  H + VN++SFHPSGN+L+++S+D ++KI DLLEGRL+YT+ GH+GP+L  AFS  G+ FASG  D QV +W+
Sbjct:    1 FAEDPALQRHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWK 295          

HSP 2 Score: 50.0618 bits (118), Expect = 7.425e-6
Identity = 24/43 (55.81%), Postives = 34/43 (79.07%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            S+++TLE IV QL++LTQTVSILE RLT  E+KL E  +++ +
Sbjct:  366 SLSNTLEQIVDQLNVLTQTVSILEHRLTLTEDKLKECLENQQK 408          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 395.201 bits (1014), Expect = 1.079e-132
Identity = 175/294 (59.52%), Postives = 228/294 (77.55%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            +EDP LQ HFKGHKD VT VDF+P+  QLAS   D+C+MIWNFKPQ+RAY++ GH++A+  V+FSP+G LVAS+S+D+TVRLW P+IKGES V +AHTA VR V+ S D    +T SDDK+IK W +HRQ+F YSL EH NWVRC RFS DG+LIAS SDDKT+++WD  N+ CI+TF ++ G    + F+P G+ +AS G DS V +WDIR NKLLQHY  H + VN++SFHPSGN+L+++S+D ++KI DLLEGRL+YT+ GH+GP+L  AFS  G+ FASG  D QV +W+
Sbjct:    5 LEDPALQRHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWK 298          

HSP 2 Score: 50.0618 bits (118), Expect = 8.455e-6
Identity = 24/43 (55.81%), Postives = 34/43 (79.07%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            S+++TLE IV QL++LTQTVSILE RLT  E+KL E  +++ +
Sbjct:  390 SLSNTLEQIVDQLNVLTQTVSILEHRLTLTEDKLKECLENQQK 432          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Match: ngfr (nerve growth factor receptor [Source:Xenbase;Acc:XB-GENE-977685])

HSP 1 Score: 392.889 bits (1008), Expect = 1.175e-132
Identity = 175/294 (59.52%), Postives = 228/294 (77.55%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            +EDP LQ HFKGHKD VT VDF+P+  QLAS   D+C+MIWNFKPQ+RAY++ GH++A+  V+FSP+G LVAS+S+D+TVRLW P+IKGES V +AHTA VR V+ S D    +T SDDK+IK W +HRQ+F YSL EH NWVRC RFS DG+LIAS SDDKT+++WD  N+ CI+TF ++ G    + F+P G+ +AS G DS V +WDIR NKLLQHY  H + VN++SFHPSGN+L+++S+D ++KI DLLEGRL+YT+ GH+GP+L  AFS  G+ FASG  D QV +W+
Sbjct:    5 LEDPALQRHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLVWK 298          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 416.001 bits (1068), Expect = 1.593e-141
Identity = 184/294 (62.59%), Postives = 235/294 (79.93%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          

HSP 2 Score: 56.9954 bits (136), Expect = 3.177e-8
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 2
Query: 1361 MSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            M  ++ STLE+IVGQLDILTQTVSILEQRLT  E++L +
Sbjct:  353 MPQTLTSTLEHIVGQLDILTQTVSILEQRLTLTEDRLKQ 391          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 414.075 bits (1063), Expect = 1.648e-141
Identity = 183/294 (62.24%), Postives = 235/294 (79.93%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            +DP L+ HFKGH+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    6 QDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 299          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 395.586 bits (1015), Expect = 1.173e-134
Identity = 176/283 (62.19%), Postives = 226/283 (79.86%), Query Frame = 2
Query:   92 HKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            H+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    2 HRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 284          

HSP 2 Score: 150.599 bits (379), Expect = 2.160e-40
Identity = 83/244 (34.02%), Postives = 126/244 (51.64%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIW--NFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIY 808
            F GHKD VTCV+F+P+   LASG  D  + IW  N K ++  +R   H   + SV F   GQ + +AS DKTV++W    +        H   VR    S D   +V+ SDDKT+K+W    ++  +S  EH  +V  V F   G  IA++  D T+K+WD      +  +Q H   V +L+FHP+G+Y+ +  +DS + I D+   +LL     H  P   V+F  +G +  S   D  + ++
Sbjct:   41 FTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFR--AHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVW 282          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 397.897 bits (1021), Expect = 1.694e-134
Identity = 176/283 (62.19%), Postives = 226/283 (79.86%), Query Frame = 2
Query:   92 HKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            H+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    2 HRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 284          

HSP 2 Score: 152.14 bits (383), Expect = 2.280e-40
Identity = 83/244 (34.02%), Postives = 126/244 (51.64%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIW--NFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIY 808
            F GHKD VTCV+F+P+   LASG  D  + IW  N K ++  +R   H   + SV F   GQ + +AS DKTV++W    +        H   VR    S D   +V+ SDDKT+K+W    ++  +S  EH  +V  V F   G  IA++  D T+K+WD      +  +Q H   V +L+FHP+G+Y+ +  +DS + I D+   +LL     H  P   V+F  +G +  S   D  + ++
Sbjct:   41 FTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFR--AHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVW 282          

HSP 3 Score: 57.3806 bits (137), Expect = 2.866e-8
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 2
Query: 1361 MSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            M  ++ STLE+IVGQLDILTQTVSILEQRLT  E++L +
Sbjct:  342 MPQTLTSTLEHIVGQLDILTQTVSILEQRLTLTEDRLKQ 380          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Match: Poc1a (POC1 centriolar protein A [Source:MGI Symbol;Acc:MGI:1917485])

HSP 1 Score: 396.741 bits (1018), Expect = 1.418e-133
Identity = 176/283 (62.19%), Postives = 226/283 (79.86%), Query Frame = 2
Query:   92 HKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            H+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    2 HRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 284          

HSP 2 Score: 151.754 bits (382), Expect = 5.226e-40
Identity = 85/263 (32.32%), Postives = 131/263 (49.81%), Query Frame = 2
Query:   26 SLKVLFALTFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIW--NFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIY 808
            S+     +  M+       F GHKD VTCV+F+P+   LASG  D  + IW  N K ++  +R   H   + SV F   GQ + +AS DKTV++W    +        H   VR    S D   +V+ SDDKT+K+W    ++  +S  EH  +V  V F   G  IA++  D T+K+WD      +  +Q H   V +L+FHP+G+Y+ +  +DS + I D+   +LL     H  P   V+F  +G +  S   D  + ++
Sbjct:   22 SMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFR--AHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVW 282          
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Match: sp|Q28I85|POC1A_XENTR (POC1 centriolar protein homolog A OS=Xenopus tropicalis OX=8364 GN=poc1a PE=2 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 9.347e-161
Identity = 248/484 (51.24%), Postives = 312/484 (64.46%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHD--LNGDRSVNQDQSVPA--NHNTANHNKTDGTDCVPPG--KSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            EDP L+ HFKGH+D VT VDFNPN+ QLASG +DSCLMIWN KPQ RAYRFVGH+DAILSV FSP+G L+ASASRDKTVRLWVPS+KGES VF+AHT TVRSV  S D   +VT SDDKTIKVW +HRQKF +SLN+H NWVRC +FS DG+LI S+SDDKTIKLWD+ ++ECIH+F EHGGFV  + FHP+G+ IA+  TD+ V +WDIRMNKL+QHY  H+  VN++SFHPSGN+LI++S+DS++K+ DLLEGRLLYT+ GH+GP+    FS  GE FASGG+D QV +W+       S A                               + R+HD  LNG    +    VPA   H    + +TD  D + P   +    DR   ++  S  + +H  +  +D  + TV +                               TLE+IVGQLDILT+TV ILEQRL+  E+KL E  D++
Sbjct:    6 EDPSLERHFKGHRDTVTTVDFNPNTKQLASGSMDSCLMIWNMKPQMRAYRFVGHKDAILSVDFSPSGHLIASASRDKTVRLWVPSVKGESTVFKAHTGTVRSVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDGRLIVSASDDKTIKLWDKTSRECIHSFCEHGGFVNFVDFHPSGTCIAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSFHPSGNYLITASNDSTLKVLDLLEGRLLYTLHGHQGPVTSVKFSREGEFFASGGSDEQVMVWKT-NFDSASYA----------------------------DLLKYRQHDQFLNGG---DYTSGVPAADRHRPERNAQTDQADDLEPRHIQMSAKDRSSPLSYTSRSIDQHHPQA-EDGNLRTVAS-------------------------------TLEHIVGQLDILTRTVGILEQRLSLTEDKLKECIDNQ 425          
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Match: sp|Q7T0P4|POC1A_XENLA (POC1 centriolar protein homolog A OS=Xenopus laevis OX=8355 GN=poc1a PE=1 SV=2)

HSP 1 Score: 432.565 bits (1111), Expect = 1.406e-146
Identity = 194/293 (66.21%), Postives = 239/293 (81.57%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            EDP L+ HFKGH+D VT VDFN N+ QLASG +DSCLM+WN K Q RAYRFVGH+DAILSV FSP+G L+ASASRDKTVRLWVPS+KGES  F+AHT TVRSV  S D   +VT SDDKTIKVW +HRQKF +SLN+H NWVRC +FS DG+LI S+SDDKTIKLWD+ ++ECI +F EHGGFV  + FHP+G+ IA+  TD+ V +WDIRMNKL+QHY  H+  VN++SFHPSGN+LI++S+DS++K+ DLLEGRLLYT+ GH+GP+    FS  G+ FASGG+D QV +W+
Sbjct:    6 EDPSLERHFKGHRDTVTAVDFNANTKQLASGSMDSCLMVWNMKTQMRAYRFVGHKDAILSVDFSPSGHLIASASRDKTVRLWVPSVKGESTAFKAHTGTVRSVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDGRLIVSASDDKTIKLWDKTSRECIQSFCEHGGFVNFVDFHPSGTCIAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSFHPSGNYLITASNDSTLKVLDLLEGRLLYTLHGHQGPVTCVKFSREGDFFASGGSDEQVMVWK 298          

HSP 2 Score: 58.9214 bits (141), Expect = 5.927e-8
Identity = 28/49 (57.14%), Postives = 38/49 (77.55%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNN 1516
            ++ASTLE+IVGQLDILT+TV ILEQRL+  E+KL E  + +    PP++
Sbjct:  385 TVASTLEHIVGQLDILTRTVGILEQRLSLTEDKLKECIEQQQATVPPSH 433          
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Match: sp|Q8NBT0|POC1A_HUMAN (POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2)

HSP 1 Score: 421.009 bits (1081), Expect = 1.565e-142
Identity = 184/294 (62.59%), Postives = 237/294 (80.61%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VTCVDF+ N+ QLASG +DSCLM+W+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D    VT SDDKT+KVW  HRQKF +SL++H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++EC+H++ EHGGFV  + FHP+G+ IA+ G D+ V +WD+R ++LLQHY  H++ VN +SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          

HSP 2 Score: 56.6102 bits (135), Expect = 3.625e-7
Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            ++ STLE+IVGQLD+LTQTVSILEQRLT  E+KL +
Sbjct:  358 TLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQ 393          
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Match: sp|Q2TBP4|POC1A_BOVIN (POC1 centriolar protein homolog A OS=Bos taurus OX=9913 GN=POC1A PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.276e-142
Identity = 184/294 (62.59%), Postives = 237/294 (80.61%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VT VDF+ N+ QLASG +DSCLM+W+ KPQTRAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D    VT SDDKT+KVW  HRQKF +SL++H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++EC+H++ EHGGFV  + FHP+G+ IA+ G D+ V +WD+R ++LLQHY  H++ VNA+SFHPSGN+L+++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTSVDFSLNTKQLASGSMDSCLMVWHMKPQTRAYRFAGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWSTHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNALSFHPSGNYLVTASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          

HSP 2 Score: 57.3806 bits (137), Expect = 1.941e-7
Identity = 27/36 (75.00%), Postives = 32/36 (88.89%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            S+ STLE+IVGQLD+LTQTVSILEQRLT  E+KL +
Sbjct:  358 SLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQ 393          
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Match: sp|Q8JZX3|POC1A_MOUSE (POC1 centriolar protein homolog A OS=Mus musculus OX=10090 GN=Poc1a PE=2 SV=2)

HSP 1 Score: 416.001 bits (1068), Expect = 1.114e-140
Identity = 184/294 (62.59%), Postives = 235/294 (79.93%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            EDP L+ HFKGH+D VTCVDF+ N+  LASG +DS LMIW+ KPQ+RAYRF GH+DA+  V FSP+G L+AS SRDKTVR+WVP++KGES VFRAHTATVRSV    D   +VT SDDKT+KVW  HRQ+F +SL +H NWVRC +FS DG+LI S+SDDKT+KLWD+ ++ECIH++ EHGGFV  + FHP+G+ IA+ G D+ V +WD R ++LLQHY  H++ VNA+SFHPSGN+LI++S DS++KI DL+EGRLLYT+ GH+GP    AFS  GE FASGG+D QV +W++
Sbjct:    7 EDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS 300          

HSP 2 Score: 56.9954 bits (136), Expect = 2.222e-7
Identity = 27/39 (69.23%), Postives = 33/39 (84.62%), Query Frame = 2
Query: 1361 MSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            M  ++ STLE+IVGQLDILTQTVSILEQRLT  E++L +
Sbjct:  353 MPQTLTSTLEHIVGQLDILTQTVSILEQRLTLTEDRLKQ 391          
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Match: A0A1S3HS03 (POC1 centriolar protein homolog A-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156934 PE=4 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 3.299e-170
Identity = 258/490 (52.65%), Postives = 329/490 (67.14%), Query Frame = 2
Query:   50 TFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQ-------DIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            T +EDP L+ HFKGH+D VT VDFNPN  QLASG +DSCLM+WNFKPQ RAYRFVGH+DA+L V FSP+G LV+SASRDKTVRLW+PS+KGES VF+AHTATVRSVD S D   + T SDDKT+KVW +HRQKF +SLN+H NWVRC RFS DG+LI S SDDKT+KLWDR ++EC+HTF EHGGFV  +AFHP+G+ IA+ GTDS V +WDIRMNKLLQHYT+HT+PVN++SFH SGN+LI++SDDS++KI DLLEGRL YT+ GH+GP     FS  GE FASGG+D QV +W+            +   Q  ++    +    +   P          HD+   RS ++  + PA               +PPG          +T +   +   P            D+E+T+    M  RG D+++  S  + L   + + P ++STLE+IVGQLDI+TQTVSILEQRLT  ENKL E+ D++ +
Sbjct:    3 TVLEDPTLERHFKGHRDTVTSVDFNPNMKQLASGSMDSCLMVWNFKPQMRAYRFVGHKDAVLDVCFSPSGHLVSSASRDKTVRLWIPSVKGESTVFKAHTATVRSVDFSSDGQSLCTASDDKTVKVWTVHRQKFLFSLNQHMNWVRCARFSPDGRLIVSGSDDKTVKLWDRTSKECVHTFFEHGGFVNHVAFHPSGTCIAAAGTDSTVKVWDIRMNKLLQHYTAHTAPVNSLSFHASGNYLITASDDSTLKILDLLEGRLFYTLHGHQGPATAVKFSRSGEYFASGGSDEQVLVWK------------TNFDQVDYNEVLQSHRRREFVDP------PPHVHDI-PPRSPHRSPARPAAPKLDARAGLRNMSDIPPG----------VTDVGPALFSQPRNTSHDATVGLGDLEMTSTDRAM--RG-DTSSYPSGTQPL-EAQSLPPQLSSTLEHIVGQLDIITQTVSILEQRLTMTENKLREVIDNQQK 459          
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Match: A0A193GSD9 (Poc1 OS=Patiria miniata OX=46514 PE=2 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.191e-167
Identity = 259/505 (51.29%), Postives = 329/505 (65.15%), Query Frame = 2
Query:   50 TFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAG--QLS-EPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQD---QSVPANHNTANHNKT----------------DGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            + +EDP L+ HFKGH+D VT VDFNPN  QLASG +DSCLM+WNFKPQ RAYRFVGH+DA+LSV FSP+G LVASASRDKTVRLW+PS+KGES VF+AHTATVRSV+ S D   ++T SDDKT+KVW +HRQ+F +SL++H NWVRC ++S DG+LI S SDDKT+K+WDR +++CIHTF EHGGFV ++AFHP+G+ IA+ GTDS V +WDIRMNKLLQHY +HT+ VN++SFHPSGN+LI++S+DS++KI DLLEGRL YT+ GH+GP    +FS  GE FASGGAD QV +W+    Q+     +  H   SQ            +    P +        H  +  RS   D    S P N      N T                +GT   P G SGL+         S+D+ R   E  Q +                NA  S    L  + EM P+++ TLE  VGQLD+LTQTV+ILEQRLT  ENKL E+ D++ +
Sbjct:    3 SVLEDPTLERHFKGHRDTVTSVDFNPNMKQLASGSMDSCLMVWNFKPQMRAYRFVGHKDAVLSVNFSPSGHLVASASRDKTVRLWIPSVKGESTVFKAHTATVRSVEFSSDGQYLLTSSDDKTVKVWAVHRQRFQFSLSQHMNWVRCAKWSPDGRLIVSGSDDKTVKIWDRTSKDCIHTFFEHGGFVHNVAFHPSGTCIAAAGTDSTVKVWDIRMNKLLQHYQAHTAAVNSLSFHPSGNYLITASNDSTLKILDLLEGRLFYTLHGHQGPATAVSFSRTGEHFASGGADEQVMVWKTNFDQIDYNEVLQSHRARSQ------------TTTAPPHIHDIHPRSPHHRHSVRSTGADINAHSEPKNMGAPTPNVTNLGPALFSQPRQKGMVNGTSGSPKGFSGLD-------MTSADIERRGLEEGQGL----------------NAYQSSTAPLEVK-EMPPALSKTLENFVGQLDVLTQTVNILEQRLTMTENKLREVLDNQQK 471          
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Match: A0A1I8FY64 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 3.971e-161
Identity = 242/494 (48.99%), Postives = 318/494 (64.37%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQ-----DIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNNR 1519
              EDP L++HFKGHKD +T VDF+PN  QL SG +DS L IWNF+PQ+RA+RF+GH++A++ V+FSPTGQLVASASRDKTVRLW PS+KGES  FR HTA VR+VD + DN  ++TGSDDKT+KVW + RQKF +SL+ H NWV+C RFSS+G+LI S SDDKT++LWD  +Q+C+ TFQEHGG V  + FHP G+ +A+  +D  V IWDIRMNKL+QHY  H  P N ++FHPSGNFL+S+ DDS++++YDLLEGRL+YT++GH+G +   +FS CG  FASGGAD QVFLW+              ++  Q         T ++ +P   R Q+             QD S P+  +        G        S         + L +DV RH    P       +   ++ AP+ + G  + A SS  +Q  +   + P IA+TLE++V QLDILTQTVSILEQRLT  ENKL    D  D Q PP+ +
Sbjct:    2 LQEDPALEIHFKGHKDAITSVDFSPNGKQLVSGSLDSNLTIWNFRPQSRAFRFMGHKEAVMGVRFSPTGQLVASASRDKTVRLWTPSVKGESTAFRGHTAGVRAVDFTADNERLLTGSDDKTVKVWTVQRQKFLFSLSRHVNWVKCARFSSEGRLIVSGSDDKTVRLWDCQSQDCVSTFQEHGGLVNDVQFHPAGNCVAAAASDGSVKIWDIRMNKLVQHYPVHEGPANGIAFHPSGNFLLSAGDDSTLRLYDLLEGRLIYTLRGHDGAVTACSFSVCGANFASGGADQQVFLWR--------------TNFDQGAGGAPQAETMEVGEPAQPRKQQ-------------QDGSRPSRQSGHQQQPLAGQRSAELASS---------SRLVTDVGRHGGRGPSSAFDDSLPRPSLAAPV-NGGGVAAAGSSTEQQQQQPGSVPPVIANTLEHVVRQLDILTQTVSILEQRLTLTENKL---KDVLDSQRPPSAK 455          
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Match: W5N8R1 (POC1 centriolar protein A OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 4.740e-160
Identity = 241/481 (50.10%), Postives = 314/481 (65.28%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            +EDP L+ HFKGH+D +T VDFN N  Q+A+G +DSCLMIWN KPQ RAYRFVGH+DA++SV+FSP+G LVASASRDKTVRLWVPS+KGES VF+AHT TVRSV  S D   +VT SDDKT+KVW +HRQKF +SLN+H NWVRC +FS DG+LI S+SDDKTIK+WD+ ++ECIH+F EHGG+V    FHP+G+ IA+  TD+ V +WDIR +KLLQHY  H++ VN +SFHPSGN+LI++S+DS++KI DLLEGRLLYT+ GH+GP    AFS  G  FASGG+D QV +W+                             +     V+R  Q  R   +NG       QS  +    A  ++ +     PP               + DV+  P    +    +   A    R P   ++SS  +Q +    +S ++ASTLE+IVGQLD+LTQTV+ILEQRLT  E+KL E  D++ +
Sbjct:    5 LEDPTLERHFKGHRDTITSVDFNCNMKQIATGSMDSCLMIWNMKPQMRAYRFVGHKDAVMSVQFSPSGHLVASASRDKTVRLWVPSVKGESTVFKAHTGTVRSVSFSSDGQSLVTASDDKTVKVWTVHRQKFLFSLNQHINWVRCAKFSPDGRLIVSASDDKTIKIWDKTSRECIHSFYEHGGYVNYTDFHPSGTCIAAASTDNTVKVWDIRTSKLLQHYQVHSAVVNGLSFHPSGNYLITASNDSTLKILDLLEGRLLYTLHGHQGPATCVAFSRAGNYFASGGSDEQVMVWKTN-------------------------FDTADYGEVLRLQQ--RSTSVNGATQTEDRQSRTSRRVPAQSHREE-----PPE--------------AVDVLEIPVSHQEKRSQSVSRASQIERDPGVKSSSS--QQQTAETGISAALASTLEHIVGQLDVLTQTVAILEQRLTLTEDKLRECIDNQHK 437          
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Match: A0A1W2WB28 (POC1 centriolar protein homolog A OS=Ciona intestinalis OX=7719 GN=LOC100184030 PE=4 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 3.275e-159
Identity = 237/487 (48.67%), Postives = 313/487 (64.27%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAG----QLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHP----AEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            M DP L+  FKGH+D +T  DFNPN  QLA+G +DSCLM+WNFKP  R+YRFVGH+DAILSV+FSP+G LVASASRDKTVRLW+PS+KGES VF+AHTATVRSV+ S D L ++T +DDKTIKVW +HRQKF +SL +H NWVRC RFS D +LI S SDDKT+KLWDR+++EC+HT+ +HGGFV  + FHP+G+ IA+ GTDS V +WDIR NKLLQHY  H+ PVN +SFHPSGNFLI+SS+D ++KI DLLEGRL +T+ GH+ P+  T FS  GE FASGGAD QV +W+       L+E  +   +  ++P                P  +     RR            Q   +     N   T G+D +  G             LS   + HP        + +   ++  P  +   D +   + +      + + P +A+TLE IVGQLD+LTQT++ILEQR++  E+K+ E  D++
Sbjct:    5 MNDPTLERQFKGHRDTITSCDFNPNMKQLATGSMDSCLMVWNFKPNMRSYRFVGHKDAILSVQFSPSGHLVASASRDKTVRLWIPSVKGESTVFKAHTATVRSVNFSSDGLHLLTAADDKTIKVWSVHRQKFQFSLTQHMNWVRCARFSPDNRLIVSGSDDKTVKLWDRNSKECVHTYFQHGGFVNHVEFHPSGTCIAAAGTDSTVKVWDIRTNKLLQHYQVHSGPVNQLSFHPSGNFLITSSNDCTLKIMDLLEGRLFFTLHGHQEPVTATTFSRNGEYFASGGADEQVIVWKTNFDKSDLTERPLTQTTHEAKPT--GLREPTFKQGNNNPPTQPLTPPRR------------QPFHSTGEPKNMMATKGSDIMDIGP-----------MLSHSTMEHPESEAGRARKQLADRSMKTPTKTNVEDVSRFGTSITAPLEEKSIPPKLAATLEQIVGQLDMLTQTMTILEQRMSMTEDKVKECLDNQ 466          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 426.402 bits (1095), Expect = 2.583e-146
Identity = 188/294 (63.95%), Postives = 242/294 (82.31%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            M+DP LQ +FKGH+D VT +DFN N  Q+ +G +DSC+MIWN KPQ RAYRFVGH+DA++SV+FSP+G+LVASASRDKTVRLWVP +KGES VFRAHT TVRS++ S D   +VT SDDKT+KVW +HRQKF +SL +H NWVRC +FS DG+LI S+SDD+T+K+WD++++ECIH+F EH GFV    FHP+G+ IA+GGTD+ V +WDIR NKLLQHY  H++ VN++SFH SGN+LI++S+DS++KI DL+EGRLLYT+ GH+GP    AFS  G+ FASGG+D QV LW+
Sbjct:    1 MDDPSLQRNFKGHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSPSGRLVASASRDKTVRLWVPGVKGESTVFRAHTGTVRSINFSSDGQSLVTASDDKTVKVWTVHRQKFLFSLCQHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCEHSGFVNCADFHPSGTCIAAGGTDNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSSGNYLITASNDSTLKILDLVEGRLLYTLHGHQGPATCVAFSRTGDHFASGGSDEQVMLWR 294          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Match: poc1a (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 413.69 bits (1062), Expect = 2.025e-141
Identity = 183/287 (63.76%), Postives = 237/287 (82.58%), Query Frame = 2
Query:   77 VHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            ++FKGH+D VT +DFN N  Q+ +G +DSC+MIWN KPQ RAYRFVGH+DA++SV+FSP+G+LVASASRDKTVRLWVP +KGES VFRAHT TVRS++ S D   +VT SDDKT+KVW +HRQKF +SL +H NWVRC +FS DG+LI S+SDD+T+K+WD++++ECIH+F EH GFV    FHP+G+ IA+GGTD+ V +WDIR NKLLQHY  H++ VN++SFH SGN+LI++S+DS++KI DL+EGRLLYT+ GH+GP    AFS  G+ FASGG+D QV LW+
Sbjct:    7 LNFKGHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSPSGRLVASASRDKTVRLWVPGVKGESTVFRAHTGTVRSINFSSDGQSLVTASDDKTVKVWTVHRQKFLFSLCQHINWVRCAKFSPDGRLIVSASDDRTVKIWDKNSRECIHSFCEHSGFVNCADFHPSGTCIAAGGTDNTVKVWDIRTNKLLQHYQVHSAVVNSLSFHSSGNYLITASNDSTLKILDLVEGRLLYTLHGHQGPATCVAFSRTGDHFASGGSDEQVMLWR 293          

HSP 2 Score: 53.9138 bits (128), Expect = 2.320e-7
Identity = 32/120 (26.67%), Postives = 53/120 (44.17%), Query Frame = 2
Query:  575 CIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            C   F+ H   V S+ F+ N   I +G  DS V IW+++       +  H   V +V F PSG  + S+S D +++++           + H G +    FS  G+   +   D  V +W
Sbjct:    5 CWLNFKGHRDTVTSIDFNCNMKQIVTGAMDSCVMIWNLKPQMRAYRFVGHKDAVMSVQFSPSGRLVASASRDKTVRLWVPGVKGESTVFRAHTGTVRSINFSSDGQSLVTASDDKTVKVW 124          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 387.111 bits (993), Expect = 9.914e-131
Identity = 171/294 (58.16%), Postives = 227/294 (77.21%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            +EDP L+  FKGH+D V C DF+P+  QLA+G  D  +M+WN  P+ RA+RF GH+D + +V FSP+G L+ASASRDKTVRLW P+IKG+S VF AHTATVRSV+ S D   ++T SDDK++K+W +HRQKF YSLN+H NWVRC RFS DG+L+AS  DD+T++LWD  +++CI+TF ++GG    + F+ +G+ IAS G D+ + IWDIR NKL+QHY  H++ VN  SFHPSGN+LIS S DS++KI DLLEGRL+YT+ GH+GP+L   FS  G++FASGGAD QV +W+
Sbjct:    5 IEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWK 298          

HSP 2 Score: 104.375 bits (259), Expect = 7.699e-24
Identity = 62/207 (29.95%), Postives = 89/207 (43.00%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            F  H   V  V+F+ +  +L +   D  L IW+   Q   Y    H + +   +FSP G+LVAS   D+TVRLW  S +     F  +      VD +     + +   D T+K+W +   K       H   V C  F   G  + S S D T+K+ D      I+T   H G V ++ F   G   ASGG D  V +W    + L
Sbjct:   98 FTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWKTNFDAL 304          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 390.193 bits (1001), Expect = 3.291e-130
Identity = 171/296 (57.77%), Postives = 228/296 (77.03%), Query Frame = 2
Query:   50 TFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            + +EDP L+  FKGH+D V C DF+P+  QLA+G  D  +M+WN  P+ RA+RF GH+D + +V FSP+G L+ASASRDKTVRLW P+IKG+S VF AHTATVRSV+ S D   ++T SDDK++K+W +HRQKF YSLN+H NWVRC RFS DG+L+AS  DD+T++LWD  +++CI+TF ++GG    + F+ +G+ IAS G D+ + IWDIR NKL+QHY  H++ VN  SFHPSGN+LIS S DS++KI DLLEGRL+YT+ GH+GP+L   FS  G++FASGGAD QV +W+
Sbjct:    3 SVLEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWK 298          

HSP 2 Score: 105.531 bits (262), Expect = 8.008e-24
Identity = 62/207 (29.95%), Postives = 89/207 (43.00%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            F  H   V  V+F+ +  +L +   D  L IW+   Q   Y    H + +   +FSP G+LVAS   D+TVRLW  S +     F  +      VD +     + +   D T+K+W +   K       H   V C  F   G  + S S D T+K+ D      I+T   H G V ++ F   G   ASGG D  V +W    + L
Sbjct:   98 FTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWKTNFDAL 304          

HSP 3 Score: 54.299 bits (129), Expect = 2.449e-7
Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 1334 VEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            ++ L  R  +  +  STLE+IV QLDILTQTV++LE+RLT  E+KL E  D++
Sbjct:  416 MDLLDERCGLPTAFRSTLEHIVQQLDILTQTVAVLEERLTLTEDKLKECLDNQ 468          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 390.193 bits (1001), Expect = 4.134e-130
Identity = 171/294 (58.16%), Postives = 227/294 (77.21%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            +EDP L+  FKGH+D V C DF+P+  QLA+G  D  +M+WN  P+ RA+RF GH+D + +V FSP+G L+ASASRDKTVRLW P+IKG+S VF AHTATVRSV+ S D   ++T SDDK++K+W +HRQKF YSLN+H NWVRC RFS DG+L+AS  DD+T++LWD  +++CI+TF ++GG    + F+ +G+ IAS G D+ + IWDIR NKL+QHY  H++ VN  SFHPSGN+LIS S DS++KI DLLEGRL+YT+ GH+GP+L   FS  G++FASGGAD QV +W+
Sbjct:   18 LEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWK 311          

HSP 2 Score: 105.916 bits (263), Expect = 7.550e-24
Identity = 62/207 (29.95%), Postives = 89/207 (43.00%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            F  H   V  V+F+ +  +L +   D  L IW+   Q   Y    H + +   +FSP G+LVAS   D+TVRLW  S +     F  +      VD +     + +   D T+K+W +   K       H   V C  F   G  + S S D T+K+ D      I+T   H G V ++ F   G   ASGG D  V +W    + L
Sbjct:  111 FTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMWKTNFDAL 317          

HSP 3 Score: 94.7449 bits (234), Expect = 3.097e-20
Identity = 50/177 (28.25%), Postives = 88/177 (49.72%), Query Frame = 2
Query:  404 SDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            S +  + ++ +           H++ V C  FS   + +A+ S DKT+ +W+ + +     F+ H   V ++ F P+G  +AS   D  V +W   +      +T+HT+ V +V+F   G  LI++SDD S+KI+ +   + +Y++  H   +    FS  G + AS G D  V LW
Sbjct:    8 SKEPDVNLYDLEDPTLERCFKGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLW 184          

HSP 4 Score: 54.299 bits (129), Expect = 2.409e-7
Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 1334 VEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            ++ L  R  +  +  STLE+IV QLDILTQTV++LE+RLT  E+KL E  D++
Sbjct:  429 MDLLDERCGLPTAFRSTLEHIVQQLDILTQTVAVLEERLTLTEDKLKECLDNQ 481          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 441.039 bits (1133), Expect = 3.390e-151
Identity = 193/297 (64.98%), Postives = 245/297 (82.49%), Query Frame = 2
Query:   47 LTFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            L + EDP L+ HFKGH+D +T VDFNPN  QLASG +D+CLM+WNFKPQTRAYRFVGH+DA++SV+FSP+G LV SASRDKTVRLWVPS+KGES VF+AHTATVRSV  S D   +VT SDDK+IKVW +HRQKF YSLN+H NWVR  +FS DG+LI S SDD+T+++WD +++EC+HTF EHGGFV  + FHP+G+ IA+ GTD+ V +WDIRMNKLLQHY  H + VN++SFHP+GN+LI++S+DS++K+ DL+EGRL YT+ GH+GP    AFS  G+ FASGG+D QV +W+
Sbjct:    2 LPWQEDPSLERHFKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVWK 298          

HSP 2 Score: 80.1073 bits (196), Expect = 3.127e-16
Identity = 44/157 (28.03%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  470 HKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            H++ +  V F+ + + +AS S D  + +W+   Q   + F  H   V S+ F P+G  + S   D  V +W   +      + +HT+ V +VSF   G  L+++SDD S+K++ +   + LY++  H   +    FS  G +  SG  D  V +W +
Sbjct:   17 HRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDS 173          

HSP 3 Score: 55.4546 bits (132), Expect = 2.150e-8
Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 2
Query: 1343 LSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQH 1504
            L  R  +  ++ +T E+IV QLDILTQTVSILEQRLT  E+KL E  + +   H
Sbjct:  408 LEDRAGIPAALVNTFEHIVTQLDILTQTVSILEQRLTMTEDKLRECLEAQQHSH 461          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 151.369 bits (381), Expect = 2.316e-41
Identity = 86/316 (27.22%), Postives = 146/316 (46.20%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPN--------------------GSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            ++  P  +    GH+  VT V F+P  S + S   D+ + +W+++         GH D++  + F  +G+++AS S D TV+LW             H   V SV    +   +V+ S DKT+K+W++       +   H+ WVR VR + DG LIAS S+D+T+++W    +EC    +EH   V  +++ P+                    G Y+ SG  D  + +WDI     +     H + V  V FHP G F++S +DD +++++D    R   ++  HE  +    F        +G  D  V +W+ 
Sbjct:   33 WIPRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWEC 348          

HSP 2 Score: 127.487 bits (319), Expect = 7.598e-33
Identity = 74/221 (33.48%), Postives = 104/221 (47.06%), Query Frame = 2
Query:   89 GHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDN-----LE---------------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            GH   V+ V F PN   L S   D  + +W  +       F GH + +  V+ +  G L+AS S D+TVR+WV + K      R H   V  V  + D      LE               +++GS DKTIK+W +       +L  H NWVR V F   G+ I S +DDKT+++WD  N+ C  +   H  FV SL FH    Y+ +G  D  V +W+ R
Sbjct:  129 GHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          

HSP 3 Score: 108.227 bits (269), Expect = 4.081e-26
Identity = 72/287 (25.09%), Postives = 124/287 (43.21%), Query Frame = 2
Query:  176 WNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPS--------------------GNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ-AGQLSEPSIAVH 973
            W  +P  + Y   GH   +  V F P   ++ SAS D T+++W           + HT +V+ +        + + S D T+K+W     +   +++ H + V  V F  +G  + S+S DKT+K+W+     C+ TF  H  +V  +  + +GS IAS   D  V +W     +       H   V  VS+ P                     G +L+S S D ++K++D+  G  + T+ GH+  + G  F   G+   S   D  + +W    +  + S+A H
Sbjct:   33 WIPRPPEK-YALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAH 318          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.585e-34
Identity = 93/307 (30.29%), Postives = 152/307 (49.51%), Query Frame = 2
Query:   83 FKGHKDKV-TCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQG---HEGPILGTAFSHCGEMFASGGADHQVFLW--QAGQLSEPSIAVHSGSS 985
             KGH D V TC+ F  N  ++ SG  D+ L +W+          VGH   + S +    G ++ S S D+T+++W             HT+TVR + +  +   +V+GS D T++VW +   +  + L  H   VRCV++  DG+ + S + D T+K+WD  ++ C+HT Q H   V SL F  +G +I SG  D+ + +WD      L     H S  + +      N L+S + DS++KI+D+  G+ L T+QG   H+  +    FS   ++  +   D  V LW  + G      +++ SG S
Sbjct:  229 LKGHDDHVITCLQFCGN--RIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMR--GNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHGN--RVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQF--DGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRD--NILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSR--KLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGS 521          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 131.724 bits (330), Expect = 3.021e-34
Identity = 93/296 (31.42%), Postives = 147/296 (49.66%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFV-GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV-FRAHTATVRSVDISCDNLEMV-TGSDDKTIKVWKMHRQKFSYSLNEHKNWVRC--VRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR----MNKLLQHYTS--HTSPVNAV--SFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFL 931
              GH+ +V C  F+PN + LAS G D  +++WN       Y  + GH  AIL + +S  G  + ++S DKTV LW  S  GE +   + HT+ V +   +    +MV T SDD T+K+W   ++    S++  +N  +C  V F+     I S   D  IK+WD    + I+T + H   V  L+  P+GSY+ S   D+ V IWDIR    M + ++ +    H    N +  S+   G+ + + S D  + I+D    R+LY + GH G +   AF     +  S   D +++L
Sbjct:   53 LTGHEGEVYCCKFHPNGNTLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLW-DSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKG---SVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYL 344          

HSP 2 Score: 130.954 bits (328), Expect = 4.707e-34
Identity = 78/255 (30.59%), Postives = 133/255 (52.16%), Query Frame = 2
Query:  209 FVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVF---RAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVR-CVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDL-----LEGRLLYTVQGH----EGPILGTAFSHCGEMFASGGADHQVFLW 934
              GHE  +   KF P G  +ASA  D+T+ +W  ++ G+   +   + HT  +  +  S D   + T S DKT+ +W     +    L  H ++V  C       Q++ ++SDD T+KLWD   +  +H+FQ     + S+ F+     I SGG D+ + +WD+R NKL+     H   V  +S  P G++L+S++ D+S++I+D+     +E R +   QG+    E  +L  ++SH G   ++G AD  V++W
Sbjct:   53 LTGHEGEVYCCKFHPNGNTLASAGFDRTILMW--NVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTSSTDKTVGLWDSETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTYQCL-SVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIWDIRPFAPME-RCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIW 303          

HSP 3 Score: 77.0258 bits (188), Expect = 1.194e-15
Identity = 49/193 (25.39%), Postives = 82/193 (42.49%), Query Frame = 2
Query:  113 VDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            V FN  S Q+ SGGID+ + +W+ +     Y   GH D++  +  SP G  + S + D +VR+W           R      R V I   N+                         N  KN ++C  +S DG  +++ S D+ + +WD  ++  ++    H G V  +AFHP    + S   D  + + +I+
Sbjct:  190 VTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDNSVRIW---------DIRPFAPMERCVKIFQGNVH------------------------NFEKNLLKC-SWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYLGEIQ 348          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 133.65 bits (335), Expect = 1.380e-33
Identity = 79/275 (28.73%), Postives = 120/275 (43.64%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKP-QTRAYR------------------------------FVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDL 814
            FK         +  P    LA+G  DS +M+W+  P + R  R                                 H   + +V+F P G  + S S D +VR W P     + V++ H   V  VD+S   L   +GS D+T ++W   R         H + V  VRF  +G  +A+ S D+T++LW          F  H G V +LAF P G  +ASGG D  V +WDI    +++    H+  +  +SF P G+ L S S D S++++D+
Sbjct:  266 FKSVPAPPCAAEVAPGMGMLAAGYEDSRVMLWSLGPRKLRTARHNVDVARINLACDILDDKVVEDSKGSDVKTLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDDITCLSFSPDGSALASGSSDGSVRVWDV 540          

HSP 2 Score: 115.546 bits (288), Expect = 1.408e-27
Identity = 60/203 (29.56%), Postives = 97/203 (47.78%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
             + H   V  V F P  + L S   D+ +  W+ +  T    + GH   +  V  S  G    S S D+T RLWVP       V+  H + V  V    +   + TGS D+T+++W   +   +     H+  V  + FS  G+L+AS  +D+ ++LWD  +   +   + H   +  L+F P+GS +ASG +D  V +WD+R
Sbjct:  339 LRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDDITCLSFSPDGSALASGSSDGSVRVWDVR 541          

HSP 3 Score: 109.768 bits (273), Expect = 1.311e-25
Identity = 70/236 (29.66%), Postives = 107/236 (45.34%), Query Frame = 2
Query:  236 SVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAG 943
            + + +P   ++A+   D  V LW  S+    L    H   V  ++++CD L      DDK ++  K    K   +L  H   V  VRF   G  + S S+D +++ WD         +Q H   V  +     G Y  SG  D    +W       L+ Y  H S VN V FHP+G+++ + S D +++++   +G       GH G +L  AFS  G + ASGG D +V LW  G
Sbjct:  275 AAEVAPGMGMLAAGYEDSRVMLW--SLGPRKLRTARHNVDVARINLACDIL------DDKVVEDSKGSDVK---TLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIG 499          

HSP 4 Score: 56.9954 bits (136), Expect = 6.539e-9
Identity = 46/185 (24.86%), Postives = 70/185 (37.84%), Query Frame = 2
Query:  392 MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQ 946
            +  G +D  + +W +  +K            R  R + D   I  + D    K+ +      + T + H G V ++ F P G+ + S   D+ V  WD R       Y  H  PV  V     G +  S S D + +++       L    GH   +    F   G   A+G AD  V LW A Q
Sbjct:  285 LAAGYEDSRVMLWSLGPRKL-----------RTARHNVDVARINLACDILDDKVVEDSKGSDVKTLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSALGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQ 458          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 131.724 bits (330), Expect = 8.270e-33
Identity = 82/281 (29.18%), Postives = 138/281 (49.11%), Query Frame = 2
Query:  188 PQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-------------------VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKM--HRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGH-EGPILGTAFSHCGEMFASGGADHQVFLWQAGQ-LSEPS 961
            P    Y F      +  + FS   ++ A+  +D  +++W  S+ G SL                       H+ TV S   S DN  +++GS+DKT+++W M  H    SY  + H  W   V FS  G   A++S D+T +LW   +   +  F  H   V  ++FHPNG Y+ +G +D    +WD+     ++ +  HT+PV +++  P G +L + S+D  + ++D+  G+ L  ++GH +  I   ++S  G +  SGGADH V +W   +  +EPS
Sbjct:  455 PSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIW--SLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVW--DVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPS 731          

HSP 2 Score: 117.472 bits (293), Expect = 3.726e-28
Identity = 80/296 (27.03%), Postives = 132/296 (44.59%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQT-----------------RAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSH-TSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGAD 916
            F+     ++C+DF+ +    A+G  DS + IW+    +                      VGH   + S  FSP  + + S S DKTVRLW        + ++ H   V  V  S       T S D+T ++W             H N V CV F  +G  + + S DKT ++WD    + +  F  H   V S+A  P+G ++++G  D  +N+WDI   K L+    H  + + ++S+   GN LIS   D +++++DL +     + +  E P +G    + G++ AS   D
Sbjct:  462 FQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDE-PFIG----YLGDVTASINQD 752          

HSP 3 Score: 99.3673 bits (246), Expect = 2.669e-22
Identity = 61/212 (28.77%), Postives = 96/212 (45.28%), Query Frame = 2
Query:   59 EDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHG-GFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            EDP  +    GH   V    F+P++  L SG  D  + +W+    T    + GH   +  V FSP G   A+AS D+T RLW         +F  H   V  V    +   + TGS DKT ++W +           H   V  +    DG+ +++ S+D  I +WD    + +   + HG   + SL++   G+ + SGG D  V +WD++
Sbjct:  514 EDPTCKT-LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 129.028 bits (323), Expect = 1.709e-32
Identity = 89/333 (26.73%), Postives = 154/333 (46.25%), Query Frame = 2
Query:   89 GHKDKVTCVDFNP-NSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL--VFRAHTATVRSVDISCDNL-------EMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQ-ECIHTFQEHGGFVPSL-----------AFHPNGS----------------------------YIASGGTDSHVNIWD-IRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            GH   + C  F P  SS++ +G  D+   IW+   QT  +   GH + +L V +SP G+++A+ S D T+RLW P   G+ L    R H+  + S+     +L        + + S D TIK+W    +   Y+++ H N V CV++   G L+ S S D+T+++WD ++Q  CI+  + H  +V  L           AF   G                              + +   D  + +W+ ++  K +   T H   VN V+F P G +++S+S D+S+K++D  +G+ + T +GH   +   A+S    +  S   D  + +W
Sbjct:  141 GHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPK-SGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471          

HSP 2 Score: 120.168 bits (300), Expect = 1.736e-29
Identity = 84/333 (25.23%), Postives = 149/333 (44.74%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKP-QTRAYRFVGHEDAILSVKFSP-------TGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYS-LNEHKNWVRCVRFSSD---------------------------------------GQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
             KGH + V CV ++P+   +A+G +D+ + +W+ K  Q       GH   I S+ + P       +   +AS+S+D T+++W    +        HT +V  V      L + +GS D+T++VW ++ Q    + L  H +WV  +  S+D                                        +++ ++SDD T+ LW+   + + I     H   V  +AF P+G YI S   D+ + +WD R  K +  +  H + V  V++      L+S S D+++K++D+   +L   + GH+  +    +S  G+   SGG D  V LW
Sbjct:  182 LKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          

HSP 3 Score: 62.003 bits (149), Expect = 1.160e-10
Identity = 33/131 (25.19%), Postives = 62/131 (47.33%), Query Frame = 2
Query:   38 LFALTFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVW 430
            +F    ++  K      GH+  V  V F+P+   + S   D+ + +W+ +       F GH  ++  V +S   +L+ S S+D T+++W    +  S+    H   V +VD S D   + +G  DK +++W
Sbjct:  383 MFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Match: COP1 (Alpha subunit of COPI vesicle coatomer complex; complex surrounds transport vesicles in the early secretory pathway [Source:SGD;Acc:S000002304])

HSP 1 Score: 117.472 bits (293), Expect = 6.030e-28
Identity = 74/281 (26.33%), Postives = 126/281 (44.84%), Query Frame = 2
Query:   68 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD------RHNQECIHTFQE------------------------HGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYT--SHTSPVNAVSFHPSGNFLISSSDDSSMKIYDL 814
            K+   F+    +   + F+P+   +      S + +W+++  T  +RF  HE  +  + F PT  +  SA  D T+++W             H   VR+V    +   +++ SDD+TI++W    +K    L  H ++V C +F     LI S+S D+TI++WD      RH+     +F+E                        H   V   +FHP    I SG  D  V +W +   K  +  T   HT+ V++V FHP  N +IS  +D +++++DL
Sbjct:    2 KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDL 282          

HSP 2 Score: 101.679 bits (252), Expect = 5.817e-23
Identity = 74/264 (28.03%), Postives = 108/264 (40.91%), Query Frame = 2
Query:  239 VKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR--------------------MNKLLQH----------YTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRL--LYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            + F P+   V  A    T++LW   +      F  H   VR +D        V+  DD TIKVW +   K  Y+L  H ++VR V F  +   I S+SDD+TI++W+  N++ I     H  FV    FHP    I S   D  + IWDI                        LL               HT  VN  SFHP+   ++S SDD  +K++ +   +   + T +GH   +    F     +  S G D  + +W
Sbjct:   17 IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVW 280          

HSP 3 Score: 81.2629 bits (199), Expect = 1.741e-16
Identity = 45/157 (28.66%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  479 WVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQL 949
            WV    FSS            TI+LWD      +H F++H G V  L FHP      S G D  + +W +  NK L   T H   V  V FH    ++IS+SDD +++I++    + +  + GH   ++   F    ++  S   D  + +W    L
Sbjct:   25 WVLVALFSS------------TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGL 169          

HSP 4 Score: 70.4774 bits (171), Expect = 4.142e-13
Identity = 32/121 (26.45%), Postives = 55/121 (45.45%), Query Frame = 2
Query:  572 ECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
            + +  F+        +AFHP+  ++      S + +WD RM  LL  +  H  PV  + FHP+    +S+ DD ++K++ L   + LYT+ GH   +    F        S   D  + +W
Sbjct:    2 KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIW 122          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 112.464 bits (280), Expect = 1.207e-26
Identity = 86/304 (28.29%), Postives = 135/304 (44.41%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFV----------------------------PSLAFH-------------------PNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNF-LISSSDDSSMKIYDLLEGRLLYTVQG 847
            FKGH D V  + FN     L +G  DS + IW+        R  GH D + ++ F    + + + S DKT+R+W   I GE +  +R H+ +V SVD       +V+GS DKT+KVW +   +  Y+L  H  WV CV+         S SDD TI++WD     C+  F+ H G V                            P++                      P  +++ S G D+ + +WD++  K ++    H   V  ++   + NF +IS S D S+K++DL  G+ ++T  G
Sbjct:  298 FKGHMDGVLTLQFN--YRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVW-NYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590          

HSP 2 Score: 79.7221 bits (195), Expect = 3.778e-16
Identity = 48/157 (30.57%), Postives = 77/157 (49.04%), Query Frame = 2
Query:  392 MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPI 862
            + TGS D TI +W +   K    L+ H + V+ + F  D + + + S DKTI++W+    ECI T++ H   V  L+       I SG  D  V +W +  ++       HT  VN V  HP      S SDD++++++D+     L   +GH G +
Sbjct:  315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQV 466          

HSP 3 Score: 78.9518 bits (193), Expect = 5.954e-16
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 2
Query:  185 KPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFR--AHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAV 745
            K   R   F GH D +L+++F+   +L+ + S D T+ +W   +    L+ R   H+  V+++    D+ +++TGS DKTI+VW     +   +   H + V  V   S  ++I S S DKT+K+W   ++ C +T + H  +V  +  HP      S   D+ + +WDIR N  L+ +  H   V  +
Sbjct:  290 KGHCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGIW--DLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 102.834 bits (255), Expect = 6.394e-24
Identity = 59/185 (31.89%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  326 SLVFRAHTATVRSVDIS-CDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAF 877
            S V   H   VR V I   DN   +TGS+D T+KVW +   K   +L  H   VR V  S     + S S+DKT+K WD    + I  +  H   V +++ HP    IA+ G DS + +WD+R    +     H  P+N V   P    ++SSS D++++++D++ G+ +  +  H+  +  TA 
Sbjct:  132 SRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATAL 316          

HSP 2 Score: 93.5893 bits (231), Expect = 6.503e-21
Identity = 80/317 (25.24%), Postives = 136/317 (42.90%), Query Frame = 2
Query:   68 KLQVHFKGHKDKVTCVDFNP-NSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSH-TSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEG---------RLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ----AGQLSEPSIA 967
            KL     GH   V CV  +P ++    +G  D+ + +W+           GH   +  V  S     + S S DKTV+ W   ++   ++  +  H + VR+V I      + T   D  IK+W M  +    +L  HK  +  V+ +     + SSS D T++LWD    + +     H   V + A HP    +AS  TD  +  W +    LL ++ S  T  +N +S +   + L +  D+  +  YD   G          ++ +++G E  +L + F   G    +G AD  + +W+    A + SEP +A
Sbjct:  130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCW--DLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDD-IRSWGLAEGSLLTNFESEKTGIINTLSIN-QDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEG-ERSVLCSTFDKTGLRLITGEADKSIKIWKQDETATKESEPGLA 441          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 442.965 bits (1138), Expect = 3.325e-152
Identity = 199/294 (67.69%), Postives = 241/294 (81.97%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            +EDP L+ HFKGH+D VT VDFNPN  QL +G +DS LMIW+FKP  RAYRFVGH+DAILSVKFSP+G L+ASASRDKTVRLWVPS+KGES VF+AHTATVRSVD S D   ++T SDDK++KVW +HRQKF YSLN H NWVRC +FS DG+LI S SDDKTIKLWDR +++C+HTF + GGFV S+ FHP+G+ IA+GGTDS V +WDIRMNKLLQHY +HT  VN+VSFHPSGN+L+S+S D+++KI DL+EGRL YT+ GH+GP     FS  GE FASG +D QV +W+
Sbjct:    5 LEDPTLERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWK 298          

HSP 2 Score: 114.39 bits (285), Expect = 1.949e-27
Identity = 65/207 (31.40%), Postives = 90/207 (43.48%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKL 703
            FK H   V  VDF+ +   L +   D  L +W    Q   Y    H + +   KFSP G+L+ S S DKT++LW  + K     F      V SV+       +  G  D T+KVW +   K       H   V  V F   G  + S+S D T+K+ D       +T   H G   S+ F  NG Y ASG +D  V +W    +K+
Sbjct:   98 FKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTNFDKV 304          

HSP 3 Score: 64.6994 bits (156), Expect = 3.738e-11
Identity = 30/49 (61.22%), Postives = 40/49 (81.63%), Query Frame = 2
Query: 1352 REEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDR 1498
            R ++ P +A+TLE+IVGQLD+LTQTVSILEQRLT  E+KL E  D++ +
Sbjct:  373 RRDIPPQLANTLEHIVGQLDVLTQTVSILEQRLTMTEDKLRECLDNQQK 421          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 150.984 bits (380), Expect = 2.168e-40
Identity = 89/319 (27.90%), Postives = 148/319 (46.39%), Query Frame = 2
Query:   53 FMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPN---------------------GSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            ++  P  +    GH+  +T V F+P  S + +   D+ + +W+++         GH DA+  + F  TG+ +AS+S D T++LW    +G   +     H   V S+        +V+ S DKTIK+W++       +   H  WVR VR ++DG LIAS S+D+TI++W   ++EC    ++H   +  L + P                      G ++ S   D  + IWD+     L     H + V AV FHP G F++S SDD +++I+D    R   T+  HE  +    F       A+G  D  + +W+ 
Sbjct:   92 WIPRPPERYTLTGHRSPITKVLFHPVYSVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLW--DFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDYKNKRCAKTLVAHEHFVTTLDFHKSAPFVATGSVDLTLKVWEC 408          

HSP 2 Score: 117.472 bits (293), Expect = 1.437e-28
Identity = 64/222 (28.83%), Postives = 104/222 (46.85%), Query Frame = 2
Query:   89 GHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE---------------------MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            GH   V+ + F P+   L S   D  + +W          F GH + +  V+ +  G L+AS S D+T+R+WV + +      R H   +  ++ + ++                       +V+ S DK+IK+W +       +L  H NWVR V F   G+ I S SDDKT+++WD  N+ C  T   H  FV +L FH +  ++A+G  D  + +W+ R
Sbjct:  188 GHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDYKNKRCAKTLVAHEHFVTTLDFHKSAPFVATGSVDLTLKVWECR 409          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 146.747 bits (369), Expect = 8.777e-39
Identity = 77/286 (26.92%), Postives = 140/286 (48.95%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFN-PNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
             +GHK+ V  + FN P   ++A+G  D    +WN +     + + GH   I+ + F+P   ++A+ S D T +LW      E      H+A + S   +    +++TGS D T+ VW     +  ++L  H+  +   +F+ D   I + S DKT K+WD    +CI T + H   V  +AF   G  IA+   D    +++   +  L     H   ++ ++F+  G  L+++S D + +++D   G+ L  ++GH   I   AF++ G++  +G  D+   LW+
Sbjct:  130 LEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLWR 415          

HSP 2 Score: 124.405 bits (311), Expect = 5.175e-31
Identity = 73/285 (25.61%), Postives = 129/285 (45.26%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKF-SPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
             + H   +T V FN + +   +G  D    +W+           GH++ + ++ F +P G  +A+ S DKT +LW          +R H+A +  +  +  +  + TGS D T K+W +       +L+ H   +    F+S G  + + S D T+ +WD  +   +HT   H G + +  F+ + S+I +G  D    IWD    K +     H   V  V+F  +G  + ++S D + ++Y+ L    L  ++GHEG I    F+  G    +  +D    LW
Sbjct:   88 LRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLW 372          

HSP 3 Score: 121.324 bits (303), Expect = 6.150e-30
Identity = 62/205 (30.24%), Postives = 108/205 (52.68%), Query Frame = 2
Query:  332 VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSD-GQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAG 943
            + RAH   + +V  +      +TGS D+T KVW     + + +L  HKN V  + F++  G  IA+ S DKT KLW+    +C HT++ H   +  LAF+P  + IA+G  D+   +WD++    +   + H++ + + +F+ +G  L++ S D ++ ++D   GR ++T+ GH G I    F+       +G  D    +W AG
Sbjct:   87 ILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAG 291          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 140.969 bits (354), Expect = 6.761e-38
Identity = 77/286 (26.92%), Postives = 141/286 (49.30%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLV--FRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 934
              G    +  +   P++ ++ +GG D  + +W+++      + + H   + ++  SP    + S + D TV++W   +   SLV   + H   V  V ++ D+  +++ S DKT+K+W +    F  SL+ H   VR +  +SDG+ + S+S D+T+++W+      + T + H   V  +   P+  +  SG  D+ V IWD+   K ++    HTS + AV+  P G+ +ISS DD+ +K++ L  G  L ++ GH   +     S  G    SG  D    +W
Sbjct:    9 IDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIW--DMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPDDKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKIW 292          

HSP 2 Score: 61.6178 bits (148), Expect = 1.950e-10
Identity = 30/111 (27.03%), Postives = 54/111 (48.65%), Query Frame = 2
Query:  608 VPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            +  +A  P+   I +GG D  + +WD    K L     HT  V  ++  P  +FL+S + D ++KI+D+    L++T++GH+  + G   +   +   S   D  V +W  
Sbjct:   16 ILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDV 126          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Match: EDO46331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB4])

HSP 1 Score: 136.732 bits (343), Expect = 7.209e-36
Identity = 86/255 (33.73%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  209 FVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGES---LVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVR-CVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDL-----LEGRLLYTVQG----HEGPILGTAFSHCGEMFASGGADHQVFLW 934
              GHE  I S +F P+G+ +AS   D+ + LW  ++ GE     V + HT  +  V  S D   M T S DKT+ +W          L  H ++V  C       Q + S SDD TIKLWD   + C  TFQ     V ++AF      I SGG D+ + +WD+R N +L   + HT  V  V   P G+FL+S+S D++++++D+     +E R L    G     E  ++  ++S  G M A+G AD  V++W
Sbjct:   54 LTGHEGEIYSSRFHPSGETLASVGFDRLIYLW--NVYGECENFAVLKGHTGAIMDVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTFQNVFQ-VTAVAFSDASDQIFSGGIDNEIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFAPME-RCLKVFLGAQHNFEKNLIKCSWSPDGLMIAAGSADRFVYVW 304          

HSP 2 Score: 126.716 bits (317), Expect = 2.661e-32
Identity = 87/302 (28.81%), Postives = 144/302 (47.68%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFV-GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLE-MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR----MNKLLQHY--TSHTSPVNAV--SFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFL 931
            +E P + +   GH+ ++    F+P+   LAS G D  + +WN   +   +  + GH  AI+ V FS  G  + +AS DKTV LW           + HT+ V S   S   ++ +V+GSDD TIK+W   ++  + +  ++   V  V FS     I S   D  IK+WD    + ++    H   V  +   P+GS++ S   D+ V +WD+R    M + L+ +    H    N +  S+ P G  + + S D  + ++D    R+LY + GH G +    F     +  S G+D ++FL
Sbjct:   47 LESPIMLL--TGHEGEIYSSRFHPSGETLASVGFDRLIYLWNVYGECENFAVLKGHTGAIMDVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTF-QNVFQVTAVAFSDASDQIFSGGIDNEIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFAPMERCLKVFLGAQHNFEKNLIKCSWSPDGLMIAAGSADRFVYVWDTNSRRILYKLPGHAGSVNDAHFHPTEPILLSCGSDKKLFL 345          

HSP 3 Score: 109.383 bits (272), Expect = 3.290e-26
Identity = 71/254 (27.95%), Postives = 121/254 (47.64%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTG-QLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHN----QECIHTF--QEHGGFVPSL---AFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDL 814
             KGH   +  V F+ + + + +   D  + +W+++   R  R  GH   + S   S  G Q V S S D T++LW    +G +  F+ +   V +V  S  + ++ +G  D  IKVW + +    Y ++ H + V  V+ S DG  + S+S D T+++WD       + C+  F   +H  F  +L   ++ P+G  IA+G  D  V +WD    ++L     H   VN   FHP+   L+S   D  + + +L
Sbjct:   97 LKGHTGAIMDVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKLWDTRKRGCAQTFQ-NVFQVTAVAFSDASDQIFSGGIDNEIKVWDLRKNDVLYKMSGHTDTVTGVQLSPDGSFLLSNSMDNTVRMWDVRAFAPMERCLKVFLGAQHN-FEKNLIKCSWSPDGLMIAAGSADRFVYVWDTNSRRILYKLPGHAGSVNDAHFHPTEPILLSCGSDKKLFLGEL 348          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 433.335 bits (1113), Expect = 1.645e-147
Identity = 237/477 (49.69%), Postives = 302/477 (63.31%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQ-SVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVT-TVGAPMFSRGPDSNANSSYVEQLSRREEMSPS-IASTLEYIVGQLDILTQTVSILEQRLTYNENKLSE 1477
            + DP L+ HFKGH+  VT VDF+ N  Q+A+G +DSC+MIWN KPQ RAYRF GH+DA+ SV+FSP+G +VASASRDKTVRLWVPSIK +S  FRAHTA VR V+ S D   +VT S+DKTIKVW +HRQKF +S N+H NWVRC +FS D +LI S SDDKTIKLWD++++ECI +F EH G+   + FHP+G+ IA+  TDS V +WDIR NK+LQHY  H+  VN++SFHP+GNFLI++S DS++KI DLLEG+LLYT+ GH+  +   AFS  G+ F+SGGAD QV +W+    S      H    + Q       K  +   +P    +  + R  LN D SV   Q S PA H   N  ++           G + R        S V R P+        T T   P      DS+ +   V          PS IA+ LE+I+GQLDILTQTVSILEQRLT  E+KL E
Sbjct:    5 LSDPTLERHFKGHRGAVTSVDFSCNMKQIATGSVDSCVMIWNMKPQMRAYRFEGHKDAVTSVQFSPSGHMVASASRDKTVRLWVPSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLYTLHGHQSSVTCVAFSRTGDYFSSGGADEQVMVWK----SNFDCIKHGNGVKVQ-------KKGTSTVRPPT--SSSMARFPLNSDPSVLHCQTSEPAEH--VNRQESQTASHAQSFSHGSHSR-----AAHSQVYRDPSISSSSTRQTQTTQLPSRHHQSDSHTSDGKV----------PSGIANALEHIIGQLDILTQTVSILEQRLTLTEDKLKE 451          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 407.912 bits (1047), Expect = 1.025e-137
Identity = 224/460 (48.70%), Postives = 288/460 (62.61%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQ-SVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVT-TVGAPMFSRGPDSNANSSYVEQLSRREEMSPS-IASTLEYIVGQLDILTQT 1426
            + DP L+ HFKGH+  VT VDF+ N  Q+A+G +DSC+MIWN KPQ RAYRF GH+DA+ SV+FSP+G +VASASRDKTVRLWVPSIK +S  FRAHTA VR V+ S D   +VT S+DKTIKVW +HRQKF +S N+H NWVRC +FS D +LI S SDDKTIKLWD++++ECI +F EH G+   + FHP+G+ IA+  TDS V +WDIR NK+LQHY  H+  VN++SFHP+GNFLI++S DS++KI DLLEG+LLYT+ GH+  +   AFS  G+ F+SGGAD QV +W+    S      H    + Q       K  +   +P    +  + R  LN D SV   Q S PA H   N  ++           G + R        S V R P+        T T   P      DS+ +   V          PS IA+ LE+I+GQLDILTQT
Sbjct:    5 LSDPTLERHFKGHRGAVTSVDFSCNMKQIATGSVDSCVMIWNMKPQMRAYRFEGHKDAVTSVQFSPSGHMVASASRDKTVRLWVPSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLYTLHGHQSSVTCVAFSRTGDYFSSGGADEQVMVWK----SNFDCIKHGNGVKVQ-------KKGTSTVRPPT--SSSMARFPLNSDPSVLHCQTSEPAEH--VNRQESQTASHAQSFSHGSHSR-----AAHSQVYRDPSISSSSTRQTQTTQLPSRHHQSDSHTSDGKV----------PSGIANALEHIIGQLDILTQT 434          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 407.142 bits (1045), Expect = 2.421e-137
Identity = 223/459 (48.58%), Postives = 287/459 (62.53%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQ-SVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVT-TVGAPMFSRGPDSNANSSYVEQLSRREEMSPS-IASTLEYIVGQLDILTQ 1423
            + DP L+ HFKGH+  VT VDF+ N  Q+A+G +DSC+MIWN KPQ RAYRF GH+DA+ SV+FSP+G +VASASRDKTVRLWVPSIK +S  FRAHTA VR V+ S D   +VT S+DKTIKVW +HRQKF +S N+H NWVRC +FS D +LI S SDDKTIKLWD++++ECI +F EH G+   + FHP+G+ IA+  TDS V +WDIR NK+LQHY  H+  VN++SFHP+GNFLI++S DS++KI DLLEG+LLYT+ GH+  +   AFS  G+ F+SGGAD QV +W+    S      H    + Q       K  +   +P    +  + R  LN D SV   Q S PA H   N  ++           G + R        S V R P+        T T   P      DS+ +   V          PS IA+ LE+I+GQLDILTQ
Sbjct:    5 LSDPTLERHFKGHRGAVTSVDFSCNMKQIATGSVDSCVMIWNMKPQMRAYRFEGHKDAVTSVQFSPSGHMVASASRDKTVRLWVPSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRECIQSFFEHAGYANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLYTLHGHQSSVTCVAFSRTGDYFSSGGADEQVMVWK----SNFDCIKHGNGVKVQ-------KKGTSTVRPPT--SSSMARFPLNSDPSVLHCQTSEPAEH--VNRQESQTASHAQSFSHGSHSR-----AAHSQVYRDPSISSSSTRQTQTTQLPSRHHQSDSHTSDGKV----------PSGIANALEHIIGQLDILTQ 433          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Match: POC1A (POC1 centriolar protein A [Source:NCBI gene;Acc:101161307])

HSP 1 Score: 377.867 bits (969), Expect = 5.998e-127
Identity = 173/293 (59.04%), Postives = 222/293 (75.77%), Query Frame = 2
Query:   62 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
            DP L+ HFKGH+  VT VDF+ N  Q+A+G +DSC+MIWN KPQ RAYRF GH+DA+ SV+FSP+G +VASASRDKTVRLWVPSIK +S  FRAHTA VR V+ S D   +VT S+DKTIKVW +HRQKF +S N+H NWVRC +FS D +LI S SDDKTIKLWD++++E          +   + FHP+G+ IA+  TDS V +WDIR NK+LQHY  H+  VN++SFHP+GNFLI++S DS++KI DLLEG+LLYT+ GH+  +   AFS  G+ F+SGGAD QV +W++
Sbjct:    3 DPTLERHFKGHRGAVTSVDFSCNMKQIATGSVDSCVMIWNMKPQMRAYRFEGHKDAVTSVQFSPSGHMVASASRDKTVRLWVPSIKADSTEFRAHTAAVRCVNFSDDGQTLVTASNDKTIKVWTVHRQKFLFSFNQHVNWVRCAKFSPDDRLIVSCSDDKTIKLWDKNSRELFRRL-----YANHVDFHPSGTCIAAASTDSSVKLWDIRTNKMLQHYQVHSGAVNSLSFHPAGNFLITTSSDSTVKILDLLEGKLLYTLHGHQSSVTCVAFSRTGDYFSSGGADEQVMVWKS 290          
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Match: poc1b (POC1 centriolar protein B [Source:NCBI gene;Acc:101164214])

HSP 1 Score: 381.333 bits (978), Expect = 1.907e-126
Identity = 169/296 (57.09%), Postives = 218/296 (73.65%), Query Frame = 2
Query:   50 TFMEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
            + +EDP L+ HFKGHK+ VTCV FNPN+ QLASG  D  +MIWN  P+ RA RF GH+DA+  V+FSP+G+ VAS+S+D+TVRLW PS+KGE  VFRAHTA VRSV  S D L +VT SDDK++KVW + RQ F YSLN+H NWVRC RFS DG+LI S  DD+T++LWD   + C++ F +  G    + F+ NG+ I S G DS +NIWDIR NKL+QHY  H+  +N+ SFHPS NFLI+ S D ++K+ DLLEGRL+YT+ GH+G +   AFS  G++FASGG D Q+ LW+
Sbjct:    3 SVLEDPALERHFKGHKNAVTCVHFNPNNKQLASGSADKTVMIWNLAPKGRALRFFGHQDAVTGVQFSPSGKRVASSSKDRTVRLWTPSMKGECAVFRAHTAAVRSVAFSADGLRLVTASDDKSVKVWSVDRQSFIYSLNQHTNWVRCARFSPDGRLIVSCGDDRTVRLWDTSTKHCLNCFSDCCGSSTFVDFNSNGTCIGSSGADSSLNIWDIRTNKLIQHYKVHSEGINSFSFHPSNNFLITGSSDHTVKVLDLLEGRLIYTLHGHKGAVTSVAFSQAGDLFASGGGDRQILLWR 298          

HSP 2 Score: 50.8322 bits (120), Expect = 3.265e-6
Identity = 24/41 (58.54%), Postives = 33/41 (80.49%), Query Frame = 2
Query: 1370 SIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHR 1492
            S+ STL++IV QLDILTQTVS+LE+RLT  E+++ E   H+
Sbjct:  453 SLDSTLQHIVRQLDILTQTVSVLEERLTLTEDRMKECLLHQ 493          
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 463/490 (94.49%), Postives = 464/490 (94.69%), Query Frame = 2
Query:   56 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSIAVHSGSSQPQHHXXXXXXXXXXXXQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNNRYQ 1525
            MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEP IAVHSGSSQPQHH TTGTKSTSKLTQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNK  G                 I     +VIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNNRYQ
Sbjct:    1 MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPGIAVHSGSSQPQHHATTGTKSTSKLTQPVVRRTQELRRHDLNGDRSVNQDQSVPANHNTANHNKLMG----------------AIAFHRENVIRHPAEVPQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQLDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNNRYQ 474          
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 137.117 bits (344), Expect = 4.006e-36
Identity = 86/291 (29.55%), Postives = 149/291 (51.20%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFN-PNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW-VPSIKGESLVFRAHTATVRSVDI--SCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR-MNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQ 937
             +GHK+ V  + +N P S ++ +G  D    +W+    +  + F GH   ++ V+F+P+  LV +   D    LW V S K  S + + HTA V S+    + +   ++TGS D T+ +W +H  +    L  H   +    F+ DG  +A++S DK+IK+WD R     + T   H   V  + F   G  +AS G D+ V +WD++  +K    +  H + V+ V+F+P G  L+S+S D S + ++   G+++  ++GH   I   AF++ G    +G  D+   +WQ
Sbjct:    8 LEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNL-QGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIWQ 297          

HSP 2 Score: 117.857 bits (294), Expect = 2.750e-29
Identity = 71/253 (28.06%), Postives = 126/253 (49.80%), Query Frame = 2
Query:   62 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPT--GQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHR-QKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD-RHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIY 808
            D  L   FKGH  +V CV FNP+S+ + +GG+D+  M+W+ +         GH   ++S++F     G+ + + S D TV LW             H A + +   + D   + T S DK+IK+W +    +  ++L  H + V  V F + G+ +AS+  D T++LWD +   +    F+ H   V  + F+P G+ + S   D     W+    K++Q    HT  + + +F+  G+ +I+ S D++ +I+
Sbjct:   44 DGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 296          

HSP 3 Score: 116.316 bits (290), Expect = 1.109e-28
Identity = 64/195 (32.82%), Postives = 101/195 (51.79%), Query Frame = 2
Query:  389 EMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHP--NGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEG-RLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSI 964
            ++VTGS DKT K+W  +     ++   H   V CV+F+    L+ +   D    LWD  + +C+   Q H   V SL F    NG ++ +G  D  V +WD+   + +     H + ++A  F+  G ++ ++S D S+KI+DL  G R L+T+ GH   +L   F + G+  AS GAD+ V LW     S+PS 
Sbjct:   27 KIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF 221          
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.885e-32
Identity = 77/252 (30.56%), Postives = 123/252 (48.81%), Query Frame = 2
Query:  230 ILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNL----EMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHP--NGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEG-RLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSEPSI 964
            + +V F+  G    + S D+T ++W  S+         H   V S+     NL    ++VTGS DKT K+W  +     ++   H   V CV+F+    L+ +   D    LWD  + +C+   Q H   V SL F    NG ++ +G  D  V +WD+   + +     H + ++A  F+  G ++ ++S D S+KI+DL  G R L+T+ GH   +L   F + G+  AS GAD+ V LW     S+PS 
Sbjct:   95 LTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSI---AYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSF 343          

HSP 2 Score: 105.916 bits (263), Expect = 1.102e-24
Identity = 67/265 (25.28%), Postives = 126/265 (47.55%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFS-PTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRF--SSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMN-KLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLE-GRLLYTVQGHEGPI 862
             + H   +T V FN N  +  +G  D    +W+    T  +   GH++ + S+ ++ P    + + S DKT ++W  +       F+ HTA V  V  +  +  + TG  D    +W +   K   +L  H   V  ++F  + +G+ + + S D T+ LWD HN   +     H   + +  F+ +G+Y+A+   D  + IWD+RM  + L     HT  V  V+F   G  + S+  D++++++D+ +  +  +  +GHE  +
Sbjct:   88 LRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEV 352          

HSP 3 Score: 87.4261 bits (215), Expect = 2.209e-18
Identity = 52/169 (30.77%), Postives = 86/169 (50.89%), Query Frame = 2
Query:   62 DPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPT--GQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHR-QKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 559
            D  L   FKGH  +V CV FNP+S+ + +GG+D+  M+W+ +         GH   ++S++F     G+ + + S D TV LW             H A + +   + D   + T S DK+IK+W +    +  ++L  H + V  V F + G+ +AS+  D T++LWD
Sbjct:  166 DGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWD 334          
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Match: SMESG000045329.1 (SMESG000045329.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.498e-30
Identity = 81/258 (31.40%), Postives = 128/258 (49.61%), Query Frame = 2
Query:  215 GHEDAILSVKFSPTGQLVASASRDKTVRLW--VPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVR-FSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYD---LLEG-RLLYTVQGH----EGPILGTAFSHCGEMFASGGADHQVFLWQ--AGQL 949
            GH+  +   KF+P G  +ASA  D+ + LW     IK +  V   H   +  +  S D+  + T S DKT+ +W     +       H + V  V   S   +L  S SDD  I+LWD+  +   HT       V  +A+ P G YI SGG ++ +N WD+R  K++Q +  HT  + +V+    GNFL+S+S D++++++D    + G R    + GH    E  +L  A+S  G+    G AD  V++W    GQ+
Sbjct:   58 GHKGEVFCGKFAPEGSFLASAGHDREIILWNTYGDIK-DLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDAKHS-VLDVAYSPFGDYIFSGGIENVINQWDVREMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTRPFVRGERCTKLMVGHLHNFEKNLLRCAWSVDGKRVTCGSADKNVYVWDMYTGQI 313          

HSP 2 Score: 120.553 bits (301), Expect = 9.971e-30
Identity = 80/293 (27.30%), Postives = 139/293 (47.44%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFV-GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMV-TGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR--------MNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFL 931
              GHK +V C  F P  S LAS G D  +++WN     +    + GH  AIL ++FS     + +AS DKTV +W   +      F+ HT+ V SV       E+  +GSDD  I++W    +  +++++  K+ V  V +S  G  I S   +  I  WD    + I TF  H   + S+A   +G+++ S   D+ + +WD R           ++ H  +    +   ++   G  +   S D ++ ++D+  G+++Y + GH G +  TAF     +  S  +D ++F+
Sbjct:   56 LSGHKGEVFCGKFAPEGSFLASAGHDREIILWNTYGDIKDLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDA-KHSVLDVAYSPFGDYIFSGGIENVINQWDVREMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTRPFVRGERCTKLMVGHLHNFEKNLLRCAWSVDGKRVTCGSADKNVYVWDMYTGQIMYKLPGHVGSVNETAFHPHEPILLSVSSDTKIFM 347          

HSP 3 Score: 77.411 bits (189), Expect = 4.237e-15
Identity = 46/165 (27.88%), Postives = 82/165 (49.70%), Query Frame = 2
Query:  461 LNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQ-ECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVS-FHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQL 949
            L+ HK  V C +F+ +G  +AS+  D+ I LW+ +   + +     H G +  L F  +  +I +  TD  V IWD R+ + ++ +  HTS VN+VS    +     S SDD  ++++D       +T+      +L  A+S  G+   SGG ++ +  W   ++
Sbjct:   56 LSGHKGEVFCGKFAPEGSFLASAGHDREIILWNTYGDIKDLAVLSGHNGAILDLQFSSDSDWIYTASTDKTVMIWDTRVGERVKKFKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHTIDAKHS-VLDVAYSPFGDYIFSGGIENVINQWDVREM 219          

HSP 4 Score: 76.2554 bits (186), Expect = 8.624e-15
Identity = 53/213 (24.88%), Postives = 99/213 (46.48%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSC-LMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVW---------KMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIR 691
            FKGH   V  V    ++ +L   G D C + +W+ + +   +  +  + ++L V +SP G  + S   +  +  W          F  HT ++ SV +S D   +++ S D T++VW         +  +    +  N  KN +RC  +S DG+ +   S DK + +WD +  + ++    H G V   AFHP+   + S  +D+ + + +I+
Sbjct:  141 FKGHTSIVNSVSAVSHTRELFCSGSDDCKIRLWDKRVKNTTHT-IDAKHSVLDVAYSPFGDYIFSGGIENVINQWDVREMKIIQTFAGHTDSITSVAVSNDGNFLLSNSVDNTLRVWDTRPFVRGERCTKLMVGHLHNFEKNLLRCA-WSVDGKRVTCGSADKNVYVWDMYTGQIMYKLPGHVGSVNETAFHPHEPILLSVSSDTKIFMGEIQ 351          
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Match: SMESG000057676.1 (SMESG000057676.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.383e-29
Identity = 83/285 (29.12%), Postives = 134/285 (47.02%), Query Frame = 2
Query:  104 VTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAF--------HPNGS-YIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFL 931
            VT +D+N + S LA+G  D    IWN    T       H+  I ++K++  G  V +A  DKT  +W  S       F  H A    VD   D     + S D  I + K+       +   H+N V  +++   G+ +AS SDDK++KLW  +   C+  F  H   + ++ +        +PN   Y+AS   DS V +WDI      ++ T HT PV +VSF P G FL + S D ++ I+++  G +++T     G I    ++  G+  A+  +D  + +
Sbjct:  309 VTSLDWNTDGSLLATGSYDGFARIWNID-GTLVSTLGQHKGPIFALKWNKKGNYVLTAGVDKTTIVWEASTNTMIQQFSFHKAPTLDVDWK-DAKTFGSCSTDSKIHICKVGNTSVVKTFKGHENEVNAIKWDPTGRFLASCSDDKSLKLWSMNEDNCVQNFVGHTKEIYTIQWSKTGPNTDYPNSPLYLASASFDSTVRLWDIERGICSKYLTGHTEPVYSVSFSPDGRFLATGSFDQNVMIWNVDRGSVIHTYSC-SGGIFEVCWNSRGDKVAASASDGSIVI 590          

HSP 2 Score: 99.7525 bits (247), Expect = 8.860e-22
Identity = 75/312 (24.04%), Postives = 129/312 (41.35%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQT----------------RAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESL-VFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGN---------FLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 940
             KGH  +V    +NP    LASG  DS   IWN                     R  + V     + S+ ++  G L+A+ S D   R+W  +I G  +     H   + ++  +     ++T   DKT  VW+          + HK     V +  D +   S S D  I +    N   + TF+ H   V ++ + P G ++AS   D  + +W +  +  +Q++  HT  +  + +  +G          +L S+S DS+++++D+  G     + GH  P+   +FS  G   A+G  D  V +W  
Sbjct:  244 LKGHTSEVFICAWNPVKDLLASGSGDSTARIWNLTSDNYFDHTNKELVLTHCVNRGGQNVLSNKDVTSLDWNTDGSLLATGSYDGFARIW--NIDGTLVSTLGQHKGPIFALKWNKKGNYVLTAGVDKTTIVWEASTNTMIQQFSFHKAPTLDVDWK-DAKTFGSCSTDSKIHICKVGNTSVVKTFKGHENEVNAIKWDPTGRFLASCSDDKSLKLWSMNEDNCVQNFVGHTKEIYTIQWSKTGPNTDYPNSPLYLASASFDSTVRLWDIERGICSKYLTGHTEPVYSVSFSPDGRFLATGSFDQNVMIWNV 552          

HSP 3 Score: 75.485 bits (184), Expect = 4.055e-14
Identity = 52/168 (30.95%), Postives = 81/168 (48.21%), Query Frame = 2
Query:   83 FKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQ---------LVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 559
            FKGH+++V  + ++P    LAS   D  L +W+         FVGH   I ++++S TG           +ASAS D TVRLW       S     HT  V SV  S D   + TGS D+ + +W + R    ++ +     +  V ++S G  +A+S+ D +I + D
Sbjct:  426 FKGHENEVNAIKWDPTGRFLASCSDDKSLKLWSMNEDNCVQNFVGHTKEIYTIQWSKTGPNTDYPNSPLYLASASFDSTVRLWDIERGICSKYLTGHTEPVYSVSFSPDGRFLATGSFDQNVMIWNVDRGSVIHTYSCSGG-IFEVCWNSRGDKVAASASDGSIVILD 592          

HSP 4 Score: 71.2478 bits (173), Expect = 9.668e-13
Identity = 45/201 (22.39%), Postives = 88/201 (43.78%), Query Frame = 2
Query:  392 MVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVR----------------FSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQ 946
            + +GS D T ++W +    +    N+      CV                 +++DG L+A+ S D   ++W+  +   + T  +H G + +L ++  G+Y+ + G D    +W+   N ++Q ++ H +P   V +  +  F  S S DS + I  +    ++ T +GHE  +    +   G   AS   D  + LW   +
Sbjct:  263 LASGSGDSTARIWNLTSDNYFDHTNKELVLTHCVNRGGQNVLSNKDVTSLDWNTDGSLLATGSYDGFARIWNI-DGTLVSTLGQHKGPIFALKWNKKGNYVLTAGVDKTTIVWEASTNTMIQQFSFHKAPTLDVDWKDAKTFG-SCSTDSKIHICKVGNTSVVKTFKGHENEVNAIKWDPTGRFLASCSDDKSLKLWSMNE 461          
The following BLAST results are available for this feature:
BLAST of POC1 centriolar protein homolog A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A7.124e-14462.59POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1A3.260e-14362.59POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1B8.339e-12657.34POC1 centriolar protein B [Source:HGNC Symbol;Acc:... [more]
POC1A5.211e-12561.83POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1B2.581e-11158.59POC1 centriolar protein B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-102.686e-3631.94F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-103.160e-3631.94F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-103.160e-3631.94F-box/WD repeat-containing protein sel-10 [Source... [more]
lis-11.792e-3530.71Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
wdr-5.14.184e-3526.94WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Poc11.118e-8642.23gene:FBgn0036354 transcript:FBtr0321318[more]
Poc11.467e-8642.23gene:FBgn0036354 transcript:FBtr0075863[more]
wds2.151e-3931.47gene:FBgn0040066 transcript:FBtr0308566[more]
wds2.151e-3931.47gene:FBgn0040066 transcript:FBtr0070438[more]
Lis-14.138e-3827.16gene:FBgn0015754 transcript:FBtr0087241[more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
poc1b2.000e-13360.14POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
poc1b3.023e-13260.41POC1 centriolar protein B [Source:NCBI gene;Acc:38... [more]
poc1a1.486e-6552.20POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b5.218e-4328.66platelet-activating factor acetylhydrolase 1b, reg... [more]
pafah1b1b5.218e-4328.66platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgc695205.483e-15750.41Novel 7 transmembrane receptor (rhodopsin family) ... [more]
mgc695203.737e-14348.16Novel 7 transmembrane receptor (rhodopsin family) ... [more]
ngfr5.201e-13359.66nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.079e-13259.52nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
ngfr1.175e-13259.52nerve growth factor receptor [Source:Xenbase;Acc:X... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Poc1a1.593e-14162.59POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a1.648e-14162.24POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a1.173e-13462.19POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a1.694e-13462.19POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
Poc1a1.418e-13362.19POC1 centriolar protein A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28I85|POC1A_XENTR9.347e-16151.24POC1 centriolar protein homolog A OS=Xenopus tropi... [more]
sp|Q7T0P4|POC1A_XENLA1.406e-14666.21POC1 centriolar protein homolog A OS=Xenopus laevi... [more]
sp|Q8NBT0|POC1A_HUMAN1.565e-14262.59POC1 centriolar protein homolog A OS=Homo sapiens ... [more]
sp|Q2TBP4|POC1A_BOVIN3.276e-14262.59POC1 centriolar protein homolog A OS=Bos taurus OX... [more]
sp|Q8JZX3|POC1A_MOUSE1.114e-14062.59POC1 centriolar protein homolog A OS=Mus musculus ... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HS033.299e-17052.65POC1 centriolar protein homolog A-like isoform X1 ... [more]
A0A193GSD91.191e-16751.29Poc1 OS=Patiria miniata OX=46514 PE=2 SV=1[more]
A0A1I8FY643.971e-16148.99WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
W5N8R14.740e-16050.10POC1 centriolar protein A OS=Lepisosteus oculatus ... [more]
A0A1W2WB283.275e-15948.67POC1 centriolar protein homolog A OS=Ciona intesti... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
poc1a2.583e-14663.95POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
poc1a2.025e-14163.76POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
POC1B9.914e-13158.16POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B3.291e-13057.77POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B4.134e-13058.16POC1 centriolar protein homolog B [Source:NCBI gen... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A3.390e-15164.98POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
pafah1b1b2.316e-4127.22platelet-activating factor acetylhydrolase 1b, reg... [more]
ENSPMAT00000008862.11.585e-3430.29pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
snrnp403.021e-3431.42small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
taf5l1.380e-3328.73TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAF58.270e-3329.18Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
RSA41.709e-3226.73WD-repeat protein involved in ribosome biogenesis;... [more]
COP16.030e-2826.33Alpha subunit of COPI vesicle coatomer complex; co... [more]
MET301.207e-2628.29F-box protein containing five copies of the WD40 m... [more]
PRP466.394e-2431.89Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453463.325e-15267.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418962.168e-4027.90Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
EDO348658.777e-3926.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497676.761e-3826.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463317.209e-3633.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POC1A1.645e-14749.69POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A1.025e-13748.70POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A2.421e-13748.58POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
POC1A5.998e-12759.04POC1 centriolar protein A [Source:NCBI gene;Acc:10... [more]
poc1b1.907e-12657.09POC1 centriolar protein B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of POC1 centriolar protein homolog A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024482.10.000e+094.49SMESG000024482.1[more]
SMESG000008519.14.006e-3629.55SMESG000008519.1[more]
SMESG000008529.11.885e-3230.56SMESG000008529.1[more]
SMESG000045329.13.498e-3031.40SMESG000045329.1[more]
SMESG000057676.11.383e-2929.12SMESG000057676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032689 ID=SMED30032689|Name=POC1 centriolar protein homolog A|organism=Schmidtea mediterranea sexual|type=transcript|length=1678bp
CTTTAACTGAAGCTTAATTTAAATTAGTTTAAAAGTCTTGTTTGCCTTAA
CATTTATGGAAGATCCTAAACTCCAAGTTCACTTCAAAGGTCATAAAGAT
AAAGTCACATGTGTAGATTTTAATCCCAACAGCTCACAATTAGCATCTGG
TGGAATTGATTCATGTCTAATGATCTGGAATTTTAAACCTCAGACTAGGG
CATATCGGTTTGTCGGACACGAAGATGCAATTTTGTCAGTAAAATTTTCA
CCAACAGGACAGTTAGTAGCTTCAGCGTCCAGGGATAAAACTGTCAGACT
TTGGGTACCAAGCATCAAAGGAGAATCTCTAGTGTTTCGTGCTCATACGG
CTACTGTGAGATCGGTCGATATTTCCTGTGATAATCTAGAAATGGTAACT
GGATCTGACGACAAAACTATCAAGGTATGGAAGATGCATCGGCAGAAATT
CTCATATTCTCTCAATGAACACAAGAATTGGGTCAGATGCGTCAGGTTCT
CATCGGATGGACAGTTAATCGCGTCAAGCAGTGATGATAAAACAATCAAA
TTATGGGACAGGCACAACCAGGAGTGCATTCACACATTCCAGGAGCACGG
GGGGTTTGTTCCGTCCCTGGCGTTCCATCCAAACGGGTCTTACATCGCAT
CAGGGGGCACAGATTCCCATGTGAATATCTGGGACATCCGGATGAACAAA
TTACTGCAACATTACACAAGTCACACGAGCCCTGTCAATGCTGTCAGCTT
CCATCCGTCCGGTAATTTCCTCATCTCCAGCAGTGACGATTCCAGTATGA
AAATCTATGATTTGCTGGAGGGCCGCCTCCTCTACACGGTGCAAGGTCAC
GAGGGCCCGATATTAGGCACTGCGTTCTCTCACTGTGGTGAGATGTTCGC
TTCTGGGGGTGCCGATCACCAGGTGTTCCTGTGGCAGGCAGGGCAGCTGT
CCGAGCCAAGTATTGCTGTCCATTCCGGATCGTCCCAGCCCCAGCATCAC
ACGACAACCGGAACAAAATCCACAAGTAAATTGACACAGCCAGTTGTCAG
GAGAACACAGGAGCTGCGTAGACACGATCTCAATGGCGACAGATCGGTCA
ATCAAGATCAATCAGTCCCAGCTAATCACAACACTGCAAATCACAACAAA
ACTGATGGGACCGATTGCGTTCCACCGGGAAAGTCTGGATTAAATGATCG
CCGGAAATGCATTACAACTCTCTCATCAGATGTGATCAGACATCCTGCTG
AGGTTCCGCAAGACATTGAGGTGACTACTGTCGGTGCGCCGATGTTCTCT
CGGGGCCCCGATTCCAATGCAAACAGCAGCTATGTGGAACAGTTGAGTCG
CCGTGAGGAAATGTCGCCTTCAATAGCATCGACATTGGAATACATTGTTG
GTCAACTTGATATATTGACTCAGACCGTATCGATCTTGGAGCAGCGGCTA
ACCTACAACGAGAACAAGCTCAGTGAAATGTCTGACCACCGGGACCGCCA
GCATCCGCCCAATAATCGATATCAGTGACTTATTTGGAATTTGTATTGAT
CTAACCCAAAATTCCCGCTTCCTAATAATTATTATCAATCAATCTGGATC
ATTTTTTGATTTTGATGCCAGACATTTTATATCCTGGATAATTTGAATTT
TTATTGGTTTTTCCTTGCATATAATCAG
back to top

protein sequence of SMED30032689-orf-1

>SMED30032689-orf-1 ID=SMED30032689-orf-1|Name=SMED30032689-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MEDPKLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAY
RFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTAT
VRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSS
DGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASG
GTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKI
YDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLSE
PSIAVHSGSSQPQHHTTTGTKSTSKLTQPVVRRTQELRRHDLNGDRSVNQ
DQSVPANHNTANHNKTDGTDCVPPGKSGLNDRRKCITTLSSDVIRHPAEV
PQDIEVTTVGAPMFSRGPDSNANSSYVEQLSRREEMSPSIASTLEYIVGQ
LDILTQTVSILEQRLTYNENKLSEMSDHRDRQHPPNNRYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton