TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30032686
Length (bp)1457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30032686) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30032686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30032686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30032686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032686SMESG000026628.1 SmedASXL_006438SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032686SMESG000026628.1 dd_Smed_v6_12770_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30032686SMESG000026628.1 dd_Smed_v6_10281_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_10281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_10281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_10281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_10281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30032686SMESG000026628.1 dd_Smed_v4_10281_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_12770_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032686SMESG000026628.1 dd_Smed_v4_12770_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 119.783 bits (299), Expect = 2.421e-28
Identity = 91/341 (26.69%), Postives = 164/341 (48.09%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQL----WKIEDK------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S         +  +  +LSR D+ L     ++ D       LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  229 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGL--LESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 119.783 bits (299), Expect = 2.421e-28
Identity = 91/341 (26.69%), Postives = 164/341 (48.09%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQL----WKIEDK------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S         +  +  +LSR D+ L     ++ D       LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  229 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGL--LESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 115.931 bits (289), Expect = 3.723e-27
Identity = 90/354 (25.42%), Postives = 166/354 (46.89%), Query Frame = 1
Query:  406 KSNPSDCPFSYIGCRNK---------QPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIED-----------KLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            K   +DCP   + C +K         +  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S         +  +  +LSR D Q+  + D            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  191 KHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGL--LESQLSRHD-QMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 115.931 bits (289), Expect = 3.723e-27
Identity = 90/354 (25.42%), Postives = 166/354 (46.89%), Query Frame = 1
Query:  406 KSNPSDCPFSYIGCRNK---------QPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIED-----------KLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            K   +DCP   + C +K         +  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S         +  +  +LSR D Q+  + D            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  191 KHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGL--LESQLSRHD-QMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 110.153 bits (274), Expect = 2.662e-25
Identity = 56/158 (35.44%), Postives = 88/158 (55.70%), Query Frame = 1
Query:  904 LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  326 LETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 480          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 63.1586 bits (152), Expect = 1.850e-10
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  874 DRQLWKIEDKLETVN--FG-EFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQS 1182
            DRQ  +I    ET    FG + +W +    Q+ NEA+   +T  +S  F +H+ GYKM       G     G  +++Y  L++G FD  L WP    +  +L+DQ+
Sbjct:  245 DRQT-RILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQN 349          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 60.4622 bits (145), Expect = 8.664e-10
Identity = 26/70 (37.14%), Postives = 42/70 (60.00%), Query Frame = 1
Query:  964 NEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALI 1173
            N++ +SI    YS  F++H  GYKM     P G       + +++ CLM+G +D+IL WP + DVTF+++
Sbjct:  177 NKSHRSI----YSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSIL 242          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 75.8702 bits (185), Expect = 2.356e-14
Identity = 45/171 (26.32%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  865 SRFDRQLWKIEDKLE--TVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNK-KIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            SR  +Q+  ++  +   ++N+ G  +W + D+S K+ EAR     E  S  F+T + GYK+   +   G   G+ +H+++Y  ++ G +D +L WP    +TF L +Q            F   P    + +P+    ++G+G+ +FI   ELL +    + D +F++  V
Sbjct:  300 SRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 75.8702 bits (185), Expect = 2.485e-14
Identity = 45/171 (26.32%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  865 SRFDRQLWKIEDKLE--TVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNK-KIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            SR  +Q+  ++  +   ++N+ G  +W + D+S K+ EAR     E  S  F+T + GYK+   +   G   G+ +H+++Y  ++ G +D +L WP    +TF L +Q            F   P    + +P+    ++G+G+ +FI   ELL +    + D +F++  V
Sbjct:  309 SRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 55.0694 bits (131), Expect = 8.509e-8
Identity = 39/164 (23.78%), Postives = 71/164 (43.29%), Query Frame = 1
Query:  868 RFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKI-GYGYHKFIEIEELLKNPSIFQEDRIFIK 1356
            R  RQ   ++ +      G  VW ++     +   R + N + YS   +T  +GYK C R++   I   K   L+++  LMQ   D  L WP K  +   ++  +   +    T      P+  A++KP       G+G+ ++  I  +++      +DR+ IK
Sbjct:  315 RLARQQAPVDPRYSN---GTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLN---IQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDT--IMTKPEILAFHKPREAISTRGFGFLEYANISNIIQL-GFCADDRLLIK 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 54.6842 bits (130), Expect = 9.820e-8
Identity = 38/147 (25.85%), Postives = 64/147 (43.54%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGY----HKFIEIEELLKNPSIFQEDRIF 1350
            G  +W +KD+S+K+ E+ K  +T  +S  F     GY + L +   G    KG ++     ++ G +D +L+WP +      + DQ T        A  +D+       K + +      Y    HK I     L+N S+F E R+ 
Sbjct:  255 GHLIWRIKDYSKKLEES-KQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTN------VADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVL 394          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 54.6842 bits (130), Expect = 9.820e-8
Identity = 38/147 (25.85%), Postives = 64/147 (43.54%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGY----HKFIEIEELLKNPSIFQEDRIF 1350
            G  +W +KD+S+K+ E+ K  +T  +S  F     GY + L +   G    KG ++     ++ G +D +L+WP +      + DQ T        A  +D+       K + +      Y    HK I     L+N S+F E R+ 
Sbjct:  255 GHLIWRIKDYSKKLEES-KQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTN------VADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVL 394          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 118.242 bits (295), Expect = 5.236e-28
Identity = 95/339 (28.02%), Postives = 177/339 (52.21%), Query Frame = 1
Query:  424 CPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITN--------SKRENKKLKKEIEIMKFDSERKEALIS-DLLMNDRM-KTEQIEYLFQQLH--QSDSDSDETQYTHVDD-KSEVSS-----VRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKL---ETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            C F   GC  K  +++E+ +H ++    H +++     +L+ +++ +KSE+          S R  +  ++  E+ + + + ++ L+S  +LM+    K  ++E   ++L   ++  +  ET    V+  +S VSS     V + S S + +  ++ +++ +D +S  D +L +++ KL   ET +F G  +W ++D+ ++  EA  S     YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ     H+     F   P + ++ +PT    I  G   F+  + +L+N +  ++D IFIK TV T+
Sbjct:  234 CSFIRYGCSYKG-LNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHL--GDAFKPDPSSSSFRRPTGEMNIASGCPLFV-AQTVLENGTYIKDDTIFIKVTVDTS 568          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 102.064 bits (253), Expect = 8.401e-23
Identity = 56/166 (33.73%), Postives = 98/166 (59.04%), Query Frame = 1
Query:  898 DKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            ++L   + G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL+IY  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP +++       +G+GY KFI  EE+ K  +  +++ IF+K ++
Sbjct:  300 EELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 102.064 bits (253), Expect = 8.401e-23
Identity = 56/166 (33.73%), Postives = 98/166 (59.04%), Query Frame = 1
Query:  898 DKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            ++L   + G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL+IY  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP +++       +G+GY KFI  EE+ K  +  +++ IF+K ++
Sbjct:  300 EELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.198e-22
Identity = 79/303 (26.07%), Postives = 135/303 (44.55%), Query Frame = 1
Query:  469 EEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            E+I DH    +  H  LL+  I  +K  L+S++ ++    R  ++L  E+++  F++      I  +L  +  ++      + + H+ D D  E     V        +R                         D  + ++E K+  ++     G FVW + DFS+K  +A        +S +F+T K GYKMCLR+   G   G+G+HL+++F +M+G  D +L WP    VT  L+DQ+    H+    R D    +F   +P ++  I  G   F  + +L    S  ++D IFIK  V
Sbjct:    4 EKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQMVELSRRCQEL--ELKVNTFEN------IVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLR-------------------------DLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSF--QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.198e-22
Identity = 79/303 (26.07%), Postives = 135/303 (44.55%), Query Frame = 1
Query:  469 EEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            E+I DH    +  H  LL+  I  +K  L+S++ ++    R  ++L  E+++  F++      I  +L  +  ++      + + H+ D D  E     V        +R                         D  + ++E K+  ++     G FVW + DFS+K  +A        +S +F+T K GYKMCLR+   G   G+G+HL+++F +M+G  D +L WP    VT  L+DQ+    H+    R D    +F   +P ++  I  G   F  + +L    S  ++D IFIK  V
Sbjct:    4 EKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQMVELSRRCQEL--ELKVNTFEN------IVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLR-------------------------DLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNRE-HIIDAFRPDISSSSF--QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 270          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 117.087 bits (292), Expect = 1.574e-27
Identity = 98/390 (25.13%), Postives = 182/390 (46.67%), Query Frame = 1
Query:  256 CENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRE-----NKKLKKEIEIMKFDSERK--EALISDL---LMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKIN---DKLSRFDRQLWKIEDK---LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            C NQ+  +E     D    S    V++  P      S     +   ++   + PS C F   GC  K   +++I  H  +  + H  L+ +    L+ ++  +++E +   +      N+    EIEI +   + +  EA I  L   +     K + ++   + L Q+  ++D  +  +   ++ +S +  M+ + ++ +     ++IN     LS  D +L  ++ +   LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  V+  L+DQ     H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  175 CRNQVPLVEMQKHEDVDCPS----VVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKG-TNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 556          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 110.538 bits (275), Expect = 2.482e-25
Identity = 87/344 (25.29%), Postives = 165/344 (47.97%), Query Frame = 1
Query:  421 DCPFSYIGCRN---------KQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRE-----NKKLKKEIEIMKFDSERK--EALISDL---LMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKIN---DKLSRFDRQLWKIEDK---LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            DCP   I C +          +  +++I  H  +  + H  L+ +    L+ ++  +++E +   +      N+    EIEI +   + +  EA I  L   +     K + ++   + L Q+  ++D  +  +   ++ +S +  M+ + ++ +     ++IN     LS  D +L  ++ +   LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  V+  L+DQ     H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  191 DCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 99.3673 bits (246), Expect = 7.810e-22
Identity = 57/172 (33.14%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  880 QLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +L K  ++L   + G  +W + D+S+K+ EA+   N E +S  F+THK GYK+ +     G   G+GS+L++Y  ++ G +DN+L WP  + VTF+L+DQS   +    H+  T  F+  P+   + KPT ++       +G+GY KFI  E++ K  +  +++ IF++ +V
Sbjct:  294 ELRKQVEELSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHI--TETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKR-NYVRDNAIFLRASV 462          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 94.3597 bits (233), Expect = 2.033e-20
Identity = 51/156 (32.69%), Postives = 87/156 (55.77%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDD-HPD--NFAWNKPTTNKKIGYGYHKFIEIEELLKNP--SIFQEDRIFIKCTVHTN 1374
            G F+W + D + K ++A        YS +F+T K GYK+CLR+   G   GKG+H++++F +M+G +D +L WP K  VTF L+D +       R + FD   PD  + ++ +P  +  +  G   F  I + L +P  +  +E+ ++I+C + TN
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNN------RDSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAK-LNSPKHAYIRENTLYIRCIIDTN 378          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 95.5153 bits (236), Expect = 2.129e-20
Identity = 52/150 (34.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEEL--LKNPSIFQEDRIFIKCTV 1365
            G+ +W + D+ +K  EA +      +S  F+T   GY++C R    G   GKGS L++YF +M+G FD+IL WP K  VT  L+DQS    H+    R D  P++ ++ +P +   I  G  +F    +L   KN    ++D +FIK  V
Sbjct:  384 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 531          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 120.553 bits (301), Expect = 9.962e-29
Identity = 91/342 (26.61%), Postives = 164/342 (47.95%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIED-----------KLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S   +     +  +  +LSR D Q+  + D            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  228 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGL--LESQLSRHD-QMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 116.701 bits (291), Expect = 1.591e-27
Identity = 89/349 (25.50%), Postives = 167/349 (47.85%), Query Frame = 1
Query:  418 SDCPFSYIGCRNK---------QPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQL----WKIEDK------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            +DCP   + C +K         +  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S   +     +  +  +LSR D+ L     ++ D       LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  194 TDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGL--LESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 116.701 bits (291), Expect = 1.591e-27
Identity = 89/349 (25.50%), Postives = 167/349 (47.85%), Query Frame = 1
Query:  418 SDCPFSYIGCRNK---------QPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQL----WKIEDK------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            +DCP   + C +K         +  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S   +     +  +  +LSR D+ L     ++ D       LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  194 TDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGL--LESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 98.2117 bits (243), Expect = 9.271e-23
Identity = 48/149 (32.21%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIF-QEDRIFIKCTV 1365
            G+ +W V D+  K  EA +      +S  F+T + GY++C R    G   GKG+HL++YF +M+G FD++L WP +  VT  L+DQS    H+  T + D  P++ ++ +P     I  G  +F+    L  + + + ++D +F+K  V
Sbjct:   96 GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 98.2117 bits (243), Expect = 9.271e-23
Identity = 48/149 (32.21%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIF-QEDRIFIKCTV 1365
            G+ +W V D+  K  EA +      +S  F+T + GY++C R    G   GKG+HL++YF +M+G FD++L WP +  VT  L+DQS    H+  T + D  P++ ++ +P     I  G  +F+    L  + + + ++D +F+K  V
Sbjct:   96 GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 6.968e-28
Identity = 91/342 (26.61%), Postives = 164/342 (47.95%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIED-----------KLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S   +     +  +  +LSR D Q+  + D            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  228 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGL--LESQLSRHD-QMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.162e-27
Identity = 91/341 (26.69%), Postives = 164/341 (48.09%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQL----WKIEDK------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   Q+  ++D  + +    ++ V+ + ++  S         +  +  +LSR D+ L     ++ D       LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:  229 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGL--LESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHL--GDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.093e-22
Identity = 87/347 (25.07%), Postives = 155/347 (44.67%), Query Frame = 1
Query:  379 RIQNRIISIKSNPSDCPFSYIGCRNKQP----IDEE---IDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDL--LMNDRMKTE----QIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIF-QEDRIFIKCTV 1365
            R+   +        DCPF + GC  K      ++ E   + DH+    L  +  L   I  L   L+  +S+I       KK +KE++       R    +S++  L +   K+     Q+  L Q ++Q  S  D        D  +    +  +  +     +   SK +  ++    QL K E++ + +      G+ +W V D+  K  EA +      +S  F+T + GY++C R    G   GKG+HL++YF +M+G FD++L WP +  VT  L+DQS    H+  T + D  P++ ++ +P     I  G  +F+    L  + + + ++D +F+K  V
Sbjct:  207 RVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHML-LVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 3.052e-21
Identity = 57/179 (31.84%), Postives = 99/179 (55.31%), Query Frame = 1
Query:  862 LSRFDRQLWKIEDKLETVNFGE---FVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNF----AWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +SR  ++L ++  +LE ++ G     +W +  + +++ EA+   N E +S +F+THK GYK+ +     G   G+G+HL+IY  ++ G FDN+L WP    VTF+L+DQS   +    H+  T   D +  NF     W        +G+GY KFI  +++ K  +  ++D +FI+ +V
Sbjct:  285 VSRQRQELQELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRASV 462          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.487e-21
Identity = 56/179 (31.28%), Postives = 98/179 (54.75%), Query Frame = 1
Query:  862 LSRFDRQLWKIEDKLETVNFGE---FVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNF----AWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +SR  ++L ++  +LE ++ G     +W +  + +++ EA+   N E +S +F+THK GYK+ +     G   G+G+HL++Y  ++ G FDN+L WP    VTF+L+DQS   +    H+  T   D +  NF     W        +G+GY KFI  +++ K  +  ++D +FI+  V
Sbjct:  285 VSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRAAV 462          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 9.585e-40
Identity = 123/485 (25.36%), Postives = 229/485 (47.22%), Query Frame = 1
Query:   43 MANGKSENLTKIISNGVAENNHDSFEDDL-CVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDS--------------------DSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFG--------------------EFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDN-FAWNKPTTNKK-IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVH 1368
            M   K +N+ +++S    +   +S  +DL C++CN +  + C S CGC YC+ CI  YL+     CPG   +C+   LN+E D+  +  L++RISR++VK P     ++ ++ R++  +        +CP   IGC  +  + +E+  HLT+Q L H++L++ S C+       +KSEI ++   N+  K++I      S  KE L     +ND  KT Q+E+L ++L   D+                     S E++   +  KS++   R               + I +++    ++++ I+  +++ N                      +F+W ++++S+K    R+++ T+ YSDSF +H   YK CL +      +  G +L ++  +M+G  D+ L WPM+  VT ++I+Q +   H     ++D +  N  A+++P   +     G    +    + + P I   D I + C VH
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIM-SFCN------ELKSEINHN---NETTKEDI------SHLKEVLRVQKALNDE-KTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKL--KSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKK----RRTV-TDVYSDSFQSH--NYKFCLNL------YIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVVH 453          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A291RBW5 (TRAF3 OS=Sinanodonta woodiana OX=1069815 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.896e-27
Identity = 94/374 (25.13%), Postives = 165/374 (44.12%), Query Frame = 1
Query:  376 KRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLL--------------IDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDS-----------------ERK--EALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKIND---KLSRFDRQLWKIEDKL----------ETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIK 1356
            + IQ  + S    P +C F  IGC      +EE+ +H  N  + H ++L              I+ I  +  E   +K  +   K E   LK ++E +K  S                 ERK  + +  D++     +T +++   ++L +  +  +    T V        VR                ++ND   +L+  DRQ   ++ +L          ET ++ G  +W ++D++++  EA        YS  F++ + GYKMC RV   G   GK +H++++F +M+G +D +L WP +  VT  L+DQ +G  H+  T  F   P + ++ +PTT   I  G   F+    +L+ P+  ++D IFIK
Sbjct:  191 REIQGHLESCPRKPKECRFKVIGC-TYMATEEEVSNHEINDGVHHMEILSIFVTNSGLNRLQLINQIQEIAAERDGLKRRLEQHKEELASLKSQVEALKTASKDAKMRMVSQTERIIQLERKSEDTVKRDVMERCEQQTRELQVTIRELREKLTLLERRPATGVGSSEAGVQVRP--------------EELNDMKQQLTMHDRQFHNLDVRLAELDLRFQVLETASYDGILLWKIRDYTRRKQEAITGKTLSLYSQPFYSSRFGYKMCARVYLNGDGMGKNTHMSLFFVVMRGEYDALLPWPFQQKVTLMLLDQQSGQRHLSDT--FKPDPASSSFKRPTTEMNIASGCPLFVS-HSVLETPTYIKDDIIFIK 546          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A5N4E4B7 (TNF receptor-associated factor 3 OS=Camelus dromedarius OX=9838 GN=Cadr_000006503 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 6.010e-27
Identity = 93/342 (27.19%), Postives = 164/342 (47.95%), Query Frame = 1
Query:  415 PSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALI----SDLLMNDRMKTEQIEYL------FQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIED-----------KLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            PS C F   GC   Q  +++I  H  +  + H  LL +   SL+ ++  +++E     +  + L  +I   + + ER++ ++    S +L   R+   Q E L       +   QS  ++D  + +    +S V+ + ++  S   +     +  +  +LSR D Q+  + D            LET ++ G  +W ++D+ ++  EA        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ +   H+     F   P++ ++ KPT    I  G   F+  + +L+N +  ++D IFIK  V T+
Sbjct:   32 PSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQSWEEADSVKSSVESLQSRVTELESVDKSAGQAARNTGL--LESQLSRHD-QMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKVIVDTS 366          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: C3Y0R3 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_237984 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.891e-27
Identity = 99/341 (29.03%), Postives = 163/341 (47.80%), Query Frame = 1
Query:  418 SDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSL-------KHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDD-KSEVSSVRTMXXXXXXXXXXXXXXK-----INDKLSRFDRQLWKIEDK-----------LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            ++C FS  GC  K      + DH +     H +L+  S+ SL       K ELQ   +E    K + K+ + E+  MK  + ++EA I+ L    +M   Q +   +Q++         +   VD  K E+SSV+          +  +        +  +L+  DRQL  I D            LET +F G  +W +KD++++ +EA        YS  F+T + GYKMC RV   G   GKG+H++++F +M+G +D +L WP +  VT  L+DQ  G  H+  T R D  P + ++ +PT++  I  G   F+  + + ++ +   +D IFIK  V
Sbjct:  195 AECSFSSHGCPFKGR-RSALQDHESQSMTEHFELVTRSLGSLELEHSRTKRELQEKNNETEVLKEKVKQQEAEVASMKQSNSKQEAKIAAL---QKMMASQTD---RQINIEQGLGSTAKKEEVDQQKRELSSVKEQVKRLDNRVNTGNTVDFLSGVMETQLNAHDRQLG-IHDVRLAEMDLRFQILETASFDGTLLWKIKDYTRRKHEAVTGRTLSLYSQPFYTSQFGYKMCARVYLNGDGMGKGTHMSLFFVVMRGEYDALLPWPFRQKVTLMLLDQDQGRRHLSDTFRPD--PTSSSFKRPTSDMNIASGCPLFVS-QSVAESKTYLNDDTIFIKVIV 524          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.548e-26
Identity = 109/440 (24.77%), Postives = 196/440 (44.55%), Query Frame = 1
Query:  130 CVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNL------SHSKLLI---------------------DSICSLKHELQSIKSEITNSKR-ENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            CV+C +I ++   + CGC+YC +CI+NYL   +K C     DC + I       + D++    IS + VK   +   F D +K I+  +   +     C      C  +  I EE  +HL N+ L       + + L+                     ++IC      +S  + + + K  ENK L+  + +  FD ++   LI    M + + T   E+    +  ++    E Q  H++++  +       +  +    +  + K +  +SR D  L +    +     G+++W +K FS+    A +  N    S++F+T   GYKMC+++ P G   GKG+HL+I+F +M+G +D+IL WP K  V   + D  +   ++  T  F   P +  + +P     I  G  KFI   EL    +  ++D ++I+  V
Sbjct:   31 CVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVI----TSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSL----CGMEYIIKEE-SNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHV--FDCKQ---LIPKDQMTEHLNTSSYEHTLTIV--TELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISR-DTSLKRANKTI--FRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDT--FKPDPKSICYQRPEEEYNIASGSPKFISFSEL---KNFLKKDTLYIQINV 446          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 9.730e-26
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  922 GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            G  +W ++D+ ++  EA  S     YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ     H+     F   P++ ++ +PT    I  G   F+  + +L+N +  ++D IFIK TV T+
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDA--FKPDPNSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTVDTS 151          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 100.908 bits (250), Expect = 1.549e-22
Identity = 55/166 (33.13%), Postives = 99/166 (59.64%), Query Frame = 1
Query:  898 DKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            ++L   + G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL+IY  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP++++       +G+GY KFI  +E+ K  +  +++ IF+K ++
Sbjct:  300 EELSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKR-NYIRDNAIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 100.908 bits (250), Expect = 1.933e-22
Identity = 59/177 (33.33%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  847 KINDKLSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            ++   L+  D QL + E  L  + F    G FVW + DFS++  +A        +S +F++ K GYKMCLR+   G   G+GSHL+++F +M+G +D +L WP    VT  L+DQ+    H+    R D    +F   +P +   I  G   F  + +L    S  ++D IFIK  V
Sbjct:  353 QLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDISSTSF--QRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 100.523 bits (249), Expect = 2.697e-22
Identity = 58/175 (33.14%), Postives = 99/175 (56.57%), Query Frame = 1
Query:  859 KLSRFDRQLWKIEDKLET---VNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNP--SIFQEDRIFIKCTV 1365
            +L R D Q+  ++  +     V++ G F+W + D SQK+ EA     +  YS +F+T + G+K+C+R+   G   GKG+H++++F +M+G +D +LSWP K  VTF LIDQ+    H+    R D    +F   +P +   +  G   F  + + L++P  +  ++D +FIKC V
Sbjct:  367 RLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVDAFRPDLRSASF--QRPVSEMNVASGCPLFFPLSK-LRSPKHAYVKDDTLFIKCVV 537          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 100.523 bits (249), Expect = 3.098e-22
Identity = 58/175 (33.14%), Postives = 99/175 (56.57%), Query Frame = 1
Query:  859 KLSRFDRQLWKIEDKLET---VNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNP--SIFQEDRIFIKCTV 1365
            +L R D Q+  ++  +     V++ G F+W + D SQK+ EA     +  YS +F+T + G+K+C+R+   G   GKG+H++++F +M+G +D +LSWP K  VTF LIDQ+    H+    R D    +F   +P +   +  G   F  + + L++P  +  ++D +FIKC V
Sbjct:  344 RLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQ-REHVVDAFRPDLRSASF--QRPVSEMNVASGCPLFFPLSK-LRSPKHAYVKDDTLFIKCVV 514          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 3.966e-30
Identity = 86/348 (24.71%), Postives = 173/348 (49.71%), Query Frame = 1
Query:  418 SDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKREN---------KKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLH----QSDSDS-----DETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKL----------ETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            ++C FS  GC+ K  + + + +H +     H  L+     +L+ ++  ++S++  ++R N         ++L+KE+  +   + + E+++  +     ++TE++  L + +     ++D D+     D T  T  +  + V+++     S + S +   ++ ++  LSR D QL+  + +L          ET ++ G+ VW ++D++++  +A        YS  F+T   GY+MC R    G   G+G+HL+++F +M+G +D +L WP +  VT  L+DQ      +  T  F   P + ++ +PT++  I  G   F+     L++ S  Q+D IFIK  V T 
Sbjct:  131 AECFFSQFGCKYKGTL-QGLKEHESGATQQHLSLVTARSANLELKVSMLQSQL--AERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQGTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDT--FKPDPASSSFRRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIKVVVDTG 472          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.350e-26
Identity = 80/330 (24.24%), Postives = 148/330 (44.85%), Query Frame = 1
Query:  424 CPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKT---------EQIE--YLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKIND-KLSRFDRQLWKIEDK---LETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            C F  +GC  KQ   E + +H  +   SH  L+I     L+ +   ++  I +    ++ L + +  ++ D      L      N R+ +         EQ++  ++ Q+  Q D+D   T     D  +    +R +  +            +++ +L+  D  L   E +   LET  + G+ VW ++D++++  EA        YS  F+T   GYKMC R    G   G+G+HL+++F +M+G +D +L WP +  VT +L+DQ     H+  T  F   P + ++ +P  +  +  G   F+     L+  S   +D +F++  V
Sbjct:   91 CGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGS--NNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDAD---TAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNVASGCPLFVS-HVALEGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 73.9442 bits (180), Expect = 2.913e-14
Identity = 52/196 (26.53%), Postives = 91/196 (46.43%), Query Frame = 1
Query:  865 SRFDRQL-WKIEDKLETVNFGEFVWIVKDFSQKINEARKS----------INTEFYSDSFFTHKNGYKMCLRVD-------PIGIS------FGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQS-TGYVHMCRTARFDDHPDNFAWNKPTTNKKI-GYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            +R  R L  ++ +    +  G F W V+ FS+ +     S               +S  F+T   GY++CLR+        P G +       G+  HLA++  L+QG +D+ L WP K  +  +++DQ     VH+  T   D  P   A+ +P+ ++   G+GY  F++I   L + S  ++D + ++C V T 
Sbjct:  373 TRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHV--TEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINT-LHHRSYLRDDCLVVRCEVVTT 565          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 5.432e-7
Identity = 28/96 (29.17%), Postives = 47/96 (48.96%), Query Frame = 1
Query:  871 FDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSIN--TEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKF 1152
              R+L ++E+   T   G F+W +K    ++ EA        +  S +FFT + GY++ LR+         G H++ Y  L  GP+D  L+WP + 
Sbjct:  311 LTRRLAELEN---TAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRL------CRSGEHVSAYAMLGPGPYDATLAWPYQL 397          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 110.538 bits (275), Expect = 4.983e-26
Identity = 98/415 (23.61%), Postives = 186/415 (44.82%), Query Frame = 1
Query:  226 DKCCPGLLVDCENQILNIENDILLDQSLTSRISRVI---VKYPEQAGQFSDDIKRIQNRIISIKSNP-----SDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKF----------DSERKEALISDLLMNDRMKTEQI------EYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKL----------ETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +K CP  L+ C    +  +ND+  +++L   + +     ++ P + G     +KRI+ + +S  +       +DC FS +GC  K      + +H     + H  LL  +    +  L  +++++     EN   K E+E  K+          D   +  ++   + N +    +I      E L  ++   D        T  + +  +S    M        SQ + +K+N +LS+ +  +   + KL          + +++ G F+W +  F+++  EA+    T  YS  F+TH+ GYK+C R+ P G    + ++L+I+  LM+G +D+IL WP +  +T  LIDQ  G   M  +  FD  P + ++ +PT N  +  G  +F   + +L+      E+ +F+K  V
Sbjct:  127 EKECPFRLITC----VYCQNDVP-ERTLIEHLKKCPAFPIECPNECG-----VKRIERKKLSAHTRECPNALTDCRFSPLGCTYKVK-KIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLS---LMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG---MNISETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVKVVV 523          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 102.449 bits (254), Expect = 2.490e-23
Identity = 93/367 (25.34%), Postives = 165/367 (44.96%), Query Frame = 1
Query:  328 VIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEI----EIMKFDSERKEALISDLLMNDRMKTEQIEYLFQ-----QLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDK----LSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVH-MCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            V+  +    G   D++   Q  I      P  C F+  GC  K    E ++ H  +Q   H  LL+ +  + +     + ++++  ++E  K ++++    E +   ++        L + +R   EQ   L +     QL + ++   E        ++E S     S    +     ++ +  D+    L+  D QL + + KL+ +      G ++W + +++++  E         YS  F+  + GYK C RV P G   GKGSHL+++F LM+G FD +L WP +  VTF L+DQ    VH +  T R D  P + ++ +PT+N  I  G   FI     L+  +  ++D +FIK  V T 
Sbjct:  166 VVCPHCGAEGICRDELLHHQTNICEQAELP--CSFAKHGCHFKG-TREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDR--VHDIGDTFRPD--PTSSSFKRPTSNMNIASGCPLFISHTN-LQTRAYVRDDTMFIKIAVDTT 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 96.6709 bits (239), Expect = 1.435e-21
Identity = 55/181 (30.39%), Postives = 98/181 (54.14%), Query Frame = 1
Query:  847 KINDKLSRFDRQLWKIEDKL---ETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWN-----KPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            + ++KLS     + K E +L   E +   + +W ++D+++K+ EA+       +S +F T K+GY++C  V   G   GKG+H++++  +++G FD +L WP  + VTF L+DQ+       +  RF   P+  A N     +P   K   +G  KF + EE++   +  +ED IF+K +V
Sbjct:  274 RFSEKLSEHGTLIEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQR-KHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSR-NYIKEDTIFLKISV 452          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 91.6633 bits (226), Expect = 7.033e-20
Identity = 47/158 (29.75%), Postives = 91/158 (57.59%), Query Frame = 1
Query:  904 LETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTG---YVHMCRTARFDDHPDNFAW-NKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            LE +   + +W ++D+++K+ EA+       +S +F T K+GY++C  V   G   GKG+H++++  +++G FD +L WP  + VTF L++Q        H+  + + +  PDN  +  +P   K   +G  KFI+ EE +++ +  ++D +F+K +V
Sbjct:  300 LEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEE-IESGNFIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 89.3521 bits (220), Expect = 3.929e-19
Identity = 52/162 (32.10%), Postives = 85/162 (52.47%), Query Frame = 1
Query:  892 IEDKLETVNFGEF----VWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +E++L T+    F    +W + + + K +EA     T FYS  FFT  +GYKMC R+   G   G+  H++++F +M+G FD +L WP +  VT  L+DQ     H+    R D  P + ++ +P     I  G   F   E+L ++  I ++D +F+K  V
Sbjct:  319 LEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN-VEHVIDAFRPD--PSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYI-RDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 107.457 bits (267), Expect = 7.360e-25
Identity = 112/475 (23.58%), Postives = 188/475 (39.58%), Query Frame = 1
Query:   79 ISNGVAENNHDSFEDDLCVICNNIPINLCS---SLCGCKYCWDCIENYLNGKDKCCPGLL-----------VDCENQILNIE-------NDILLDQSLTSRISRVIV----KYPEQAGQFSDDIKR---IQNRIISIKSNPSDCPFSYIGCRNKQPIDE--------------EIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNF-GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            +  G  ++  ++ E   C  C    + LC    + CG ++C+ CI + L+  +  CP  +           V C  +I+ ++       N      SL      V V    + P   G+  + + R    ++     K   S C F    C+NK P+ E                 +H T+ +L  S+ L+ S     H  + ++       R  ++L+ E+E +                  R   + +      L Q    S ETQ    DD   V  +R                 + D   RF          LET ++ G  +W ++D+ ++  +A        YS  F+T   GYKMC RV   G   GKG+HL+++F +M+G +D +L WP K  VT  L+DQ     H+     F   P + ++ +P     I  G   F+  + +L++ +  ++D IFIK TV T+
Sbjct:   30 VRGGFRDHFVEAPEAKYC--CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEF----CKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSS-----HTEKLLEL--ELELRSLRQLRDEMESL------------------RGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIR-----------------LADMDLRFQ--------VLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHL--GDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTVDTS 445          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 102.449 bits (254), Expect = 5.638e-23
Identity = 58/181 (32.04%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  862 LSRFDRQLWKIEDKLETVNF---GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +SR  +++ ++  ++E ++    G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL++Y  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP + +       +G+GY KFI  EE+ K  +  +++ IFIK ++
Sbjct:  285 VSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 102.064 bits (253), Expect = 5.879e-23
Identity = 58/181 (32.04%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  862 LSRFDRQLWKIEDKLETVNF---GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +SR  +++ ++  ++E ++    G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL++Y  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP + +       +G+GY KFI  EE+ K  +  +++ IFIK ++
Sbjct:  285 VSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 102.064 bits (253), Expect = 6.368e-23
Identity = 58/181 (32.04%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  862 LSRFDRQLWKIEDKLETVNF---GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYV----HMCRTARFDDHPDNFAWNKPTTNKK------IGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            +SR  +++ ++  ++E ++    G  +W + D+S+K+ EA+   N EF+S  F+TH+ GYK+ +     G   G+GSHL++Y  ++ G +DN+L WP  + VTF+++DQS   +    H+  T  F+  P+   + KP + +       +G+GY KFI  EE+ K  +  +++ IFIK ++
Sbjct:  278 VSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHI--TETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASI 455          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 95.1301 bits (235), Expect = 1.721e-20
Identity = 79/330 (23.94%), Postives = 147/330 (44.55%), Query Frame = 1
Query:  400 SIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIE----YLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNF----GEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            S   + S CPFS +GC++    + +I +H  +  + H +LL+  + S+       ++ +  S     +    + + +   +   A  S   ++   K   +E     L +++ +S    +   + H  D+ ++ ++               I ++   L+  D QL + E  +  + +    G FVW + DFS +  EA        +S +F++ K GYKMCLR+   G   G+G+HL+++F +M+  +D +L WP    VT  L+DQ+    H+    R D    +F   +P +   I  G   F  + +L       ++D IFIK  V
Sbjct:  204 SCAKSKSACPFSEVGCKSVVE-NGKISEHEHSSTMEHLRLLLPMVLSM------TRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSN------------KIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN-REHIIDAFRPDITSTSF--QRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026628.1 (SMESG000026628.1)

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 444/445 (99.78%), Postives = 444/445 (99.78%), Query Frame = 1
Query:   43 MANGKSENLTKIISNGVAENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTNC 1377
            MANGKSENLTKIISNGV ENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMSISRSASHSQRSISKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTNC
Sbjct:    1 MANGKSENLTKIISNGVVENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMSISRSASHSQRSISKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTNC 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067216.1 (SMESG000067216.1)

HSP 1 Score: 285.804 bits (730), Expect = 3.625e-91
Identity = 151/437 (34.55%), Postives = 264/437 (60.41%), Query Frame = 1
Query:  130 CVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDL--LMNDRMK--------TEQIEYLFQQLHQSDSDSDETQYTHVDD-KSEVSSVRTMXXXXXXXXXXXX---XXKINDK--------LSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTN 1374
            C+IC +I IN  S  CGC YC++CI  YL+   + CPG   +C+ + LNI  DI++D+S    +S+++VK P +   F D++++I+N +         CP+  IGC+  +   EE+  H+  + ++HSKLL++SI +L++E++S+K  +   + E K+L +E+E++  D   KE +   L   M++++         +++ +++  +  +   +++ET     +  K + +S + M    S   +       SK  DK        +     Q+ KIE  LE  N+GEF+WI++++ +K ++A+  I + F+SD+FFTHK GYK+CLR+ P+GI  GKGSHL+++F +M G FDN L WP K D+TF + DQ +GY H+ ++  ++  P++ ++ KPT++K IG G  KFIEI+EL  N ++  ++++FI+C+V+ N
Sbjct:   25 CLICKSIVINAHSGPCGCLYCFECIVTYLSKGIRFCPGNTEECQVKTLNINEDIVVDRSSNVSVSKLVVKCPNKNCSFKDELRQIENHLRICNMKCEKCPYFEIGCKESEISTEELSGHILQEIVNHSKLLLESIDNLRNEVESLKRTVEKLQVEKKQLTEEVELVMIDKIVKEMVREQLKQAMDEKVGGFNENTQISKKEDFVLYKCEKKLINANETSNEAANRVKGKSNSEQPMKDKSSNEVTGAQCEGFSKFTDKSNKSLVIDVQNLQSQILKIESNLEKENYGEFLWILENWWEKFHQAKLGIQSSFFSDAFFTHKYGYKLCLRIYPVGIGEGKGSHLSVFFHVMSGQFDNTLPWPCKLDITFKMSDQESGYDHVVQSCSYESKPNSSSYRKPTSDKNIGIGIPKFIEIKELFSNINLSSDNKLFIRCSVNIN 461          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025558.1 (SMESG000025558.1)

HSP 1 Score: 269.626 bits (688), Expect = 4.651e-85
Identity = 141/403 (34.99%), Postives = 240/403 (59.55%), Query Frame = 1
Query:  175 CGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVD------DKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            CGC++C+ CI  +L+G +K CPG   +C+ +ILN++ +I +DQ +  +ISR+ VK PE++ +F D+++++++     K   + CP+S IGC       +++ DHL ++ L+H+KLL++ + +  +E++ +K+         + L+ EI  +K D ER+   I++L +N      +   + + + +  SD +  Q    D      D+ E   +  + +  S  +     +KI+  +   DR+L ++         GEFVW +  F+ K+ +A+  IN   YS+SF THKNG+KMCL V P G S GKG+HL +YF LM+G FD IL WP +  VTFALI+Q T   H+ +T +  ++P+N A+ +P T++  G+G+H+F+  EELL NP + + ++IFIKC+V
Sbjct:   43 CGCRFCFSCISGFLDGGNKICPGFTEECKLEILNLDKNIYVDQPMNIKISRLKVKCPEKSCEFVDELRKMEDHSRMCKYRSAACPYSNIGCDKCNISQDKVSDHLQSEILAHTKLLMNFVGNFNNEMEMLKANNNGLSAVIELLRNEINDLKLDGERRREEIAELQVNIICLNGENVAMRENVDKLISDGERNQVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTEISNKIDKSMDNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLCVYPDGFSDGKGTHLPVYFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANNPNNEAFIQP-TDRNTGWGFHQFVSHEELLSNPDLMRNNQIFIKCSV 444          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025566.1 (SMESG000025566.1)

HSP 1 Score: 267.7 bits (683), Expect = 1.977e-84
Identity = 149/448 (33.26%), Postives = 256/448 (57.14%), Query Frame = 1
Query:   43 MANGKSENLTKIISNGVAENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMN-------DRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            MA  K EN+ +II N   E+  +   D  C++C  + IN  ++ CGC++C+ CI  +L+ ++K CPG    C+ + L++  +I +D  +  +IS++ VK  E++ +F D++ ++++   + K   + CP+S IGC       +++ DHL ++ L+H+KLL+D   +  +E++ +K+     + ENK L+ EI  +K D ER+   I++L  N       +    E +  L     ++  +  + Q    D   E+  +  + +  S  +     +KI+  +   DR+L ++E     +N+GEF W +  F+ K+  A+  INT+ YS+SF THKN YKMCL V+P G   GKG+HL + F LM+G FD IL WP ++ VT ALI+Q T   H+C+T    ++P++ A  +P T++  G G+ +F+  EEL  NP + + ++IFIKC+V
Sbjct:    1 MAFSKLENVWQIIINNKYESLAEIQHDMQCLLCKKLLINARNAPCGCRFCFSCISGFLDNENKICPGNTEFCKLEKLDMNINICVDNPINIKISQIKVKCAEKSCEFVDELIKMEDHSRTCKYRSAACPYSNIGCDKCNISLDKVADHLQSEILTHTKLLMDFFGNFNNEMEMLKTNNYGLRAENKLLRNEINELKLDGERRREEIAELQRNIICLNGENVAMREIMNKLISDWERNRVEIGDLQRKCADQVEEIK-LLNLEMPTSRKNLTEISNKIDKSMDNVDRKLLEMEANQNQLNYGEFAWKLDKFTDKMAHAKNGINTDIYSESFLTHKNSYKMCLSVNPDGFGDGKGTHLTVGFHLMKGEFDEILEWPFRYSVTLALINQRTRLPHVCKTTNCANNPNSKALIQP-TDRNGGMGFPQFVSHEELASNPDLMRNNQIFIKCSV 446          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 267.314 bits (682), Expect = 3.622e-84
Identity = 147/448 (32.81%), Postives = 256/448 (57.14%), Query Frame = 1
Query:   43 MANGKSENLTKIISNGVAENNHDSFEDDLCVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLTNQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSERKEALISDLLMNDRMKTEQIEYL------FQQLHQSDSDS-DETQYTHVDDKSEVSSVRTMXXXXXXXXXXXXXXKINDKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTV 1365
            M+  K EN+ +I+ +   E+  +   D LC +C  + +N   + CGC++C+ CI ++L+ K+K CPG   +C+ ++L++  +I +D  +  +IS++ VK  E +  + D+++++++   + K     CP+S IGC       +++ DHL ++  +H+KLL+D + +  +E++ +K+        N+ L+ EI  +K D ER+   I+DL      + E+IE L       + + ++ SD  D  Q     ++ E+        ++         +KI+      DR+L ++         GEF+W +  F+ K+ +A+  INT  YS+SF THKNG+KMCLRVDP G   GKG+HL+++F LM+G FD IL WP +  VTFALI+Q T   H+ +T +  ++P++ A  +P T++  G G+ KF+  EEL  NP + + ++IFIKC+V
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQP-TDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSV 447          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF32.421e-2826.69TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.421e-2826.69TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.723e-2725.42TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.723e-2725.42TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.662e-2535.44TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.850e-1032.08TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-28.664e-1037.14TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf42.356e-1426.32gene:FBgn0026319 transcript:FBtr0334401[more]
Traf42.485e-1426.32gene:FBgn0026319 transcript:FBtr0077429[more]
Traf68.509e-823.78gene:FBgn0265464 transcript:FBtr0071188[more]
Traf-like9.820e-825.85gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like9.820e-825.85gene:FBgn0030748 transcript:FBtr0074274[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.236e-2828.02TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf4a8.401e-2333.73tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a8.401e-2333.73tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
BX901915.11.198e-2226.07pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.11.198e-2226.07pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.574e-2725.13slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh22.482e-2525.29slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl27.810e-2233.14synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
hspb62.033e-2032.69heat shock protein family B (small) member 6 [Sour... [more]
slc12a12.129e-2034.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf39.962e-2926.61TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.591e-2725.50TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.591e-2725.50TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf59.271e-2332.21TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf59.271e-2332.21TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE6.968e-2826.61TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.162e-2726.69TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE7.093e-2225.07TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q61382|TRAF4_MOUSE3.052e-2131.84TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|Q9BUZ4|TRAF4_HUMAN8.487e-2131.28TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1019.585e-4025.36TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A291RBW51.896e-2725.13TRAF3 OS=Sinanodonta woodiana OX=1069815 GN=TRAF3 ... [more]
A0A5N4E4B76.010e-2727.19TNF receptor-associated factor 3 OS=Camelus dromed... [more]
C3Y0R36.891e-2729.03Uncharacterized protein (Fragment) OS=Branchiostom... [more]
T1DBK61.548e-2624.77TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.19.730e-2635.76pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf4a1.549e-2233.13TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b1.933e-2233.33TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf12.697e-2233.14TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf13.098e-2233.14TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.13.966e-3024.71pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.350e-2624.24pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf62.913e-1426.53TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.15.432e-729.17pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352374.983e-2623.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.490e-2325.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.435e-2130.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328497.033e-2029.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.929e-1932.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf37.360e-2523.58TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a5.638e-2332.04TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a5.879e-2332.04TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a6.368e-2332.04TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b1.721e-2023.94TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026628.10.000e+099.78SMESG000026628.1[more]
SMESG000067216.13.625e-9134.55SMESG000067216.1[more]
SMESG000025558.14.651e-8534.99SMESG000025558.1[more]
SMESG000025566.11.977e-8433.26SMESG000025566.1[more]
SMESG000025794.13.622e-8432.81SMESG000025794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032686 ID=SMED30032686|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1457bp
CTATATAAATCTTATATGTTTTTTTAGAATTGTTAGTAATAAATGGCTAA
TGGAAAATCTGAAAATCTAACAAAGATTATCAGCAATGGAGTTGCGGAGA
ACAATCACGATTCGTTTGAAGACGACCTTTGTGTAATTTGTAATAATATT
CCCATCAATTTGTGCTCCAGTTTATGTGGCTGTAAATATTGCTGGGATTG
CATTGAGAATTATTTGAACGGCAAGGACAAATGTTGTCCTGGCCTACTAG
TTGATTGTGAAAATCAAATCTTAAATATTGAAAATGATATTCTCTTGGAT
CAATCACTGACGAGTAGAATATCGCGAGTAATTGTCAAGTACCCAGAACA
AGCGGGACAGTTTTCAGATGACATAAAAAGAATTCAAAACCGTATAATAT
CAATAAAGTCTAATCCCAGTGATTGCCCCTTTTCATATATCGGATGCCGA
AACAAACAACCAATCGACGAAGAGATCGATGATCACCTGACCAATCAGAA
TTTATCTCATAGCAAATTGTTGATAGACTCCATTTGCAGTTTGAAACATG
AATTGCAATCAATAAAATCTGAAATTACAAATTCTAAAAGAGAAAATAAA
AAGCTTAAAAAGGAAATCGAAATTATGAAGTTTGATTCGGAAAGAAAAGA
GGCATTGATCTCCGACTTACTAATGAATGACAGAATGAAAACCGAGCAAA
TCGAGTATCTGTTTCAACAACTGCACCAATCTGACAGCGATTCTGATGAA
ACGCAATACACTCATGTTGATGATAAATCAGAGGTGTCAAGTGTGAGAAC
GATGTCGATATCGAGATCCGCAAGCCATAGCCAACGGTCTATAAGCAAAA
TCAACGATAAACTCAGTCGTTTCGACAGACAGCTTTGGAAAATCGAAGAC
AAACTAGAAACTGTCAACTTTGGAGAATTCGTATGGATTGTTAAAGATTT
TTCTCAGAAAATCAACGAAGCCCGGAAGTCAATCAACACGGAGTTTTATA
GCGATTCGTTCTTCACTCATAAAAACGGTTATAAAATGTGCCTTCGTGTC
GATCCGATTGGAATCAGTTTTGGAAAGGGATCTCATTTGGCGATTTATTT
CTGTTTGATGCAGGGTCCATTTGACAACATTCTCTCTTGGCCAATGAAAT
TCGATGTGACATTCGCACTAATCGACCAATCAACTGGTTATGTTCACATG
TGCCGAACAGCGCGGTTTGATGATCATCCAGACAATTTCGCTTGGAACAA
GCCGACGACGAATAAAAAGATCGGATATGGCTACCACAAATTTATAGAGA
TCGAGGAATTGTTGAAGAACCCATCGATATTTCAGGAGGATCGGATATTT
ATCAAGTGCACCGTTCACACGAATTGTTAGAAAAAAATTTTTTGATAGAC
ATTTTCTCCTCGTTTGTTTGACTTTTTTTTCAAATTATTTTTCATTTGAT
AGATTTT
back to top

protein sequence of SMED30032686-orf-1

>SMED30032686-orf-1 ID=SMED30032686-orf-1|Name=SMED30032686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MANGKSENLTKIISNGVAENNHDSFEDDLCVICNNIPINLCSSLCGCKYC
WDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKY
PEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRNKQPIDEEIDDHLT
NQNLSHSKLLIDSICSLKHELQSIKSEITNSKRENKKLKKEIEIMKFDSE
RKEALISDLLMNDRMKTEQIEYLFQQLHQSDSDSDETQYTHVDDKSEVSS
VRTMSISRSASHSQRSISKINDKLSRFDRQLWKIEDKLETVNFGEFVWIV
KDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLA
IYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFA
WNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVHTNC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000136whole organism
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 171..198
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 26..443
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 4.46512E-5
score: 38.6025
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 25..66
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 298..423
e-value: 3.5E-8
score: 43.2
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 293..441
score: 19.445
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 253..445
e-value: 1.1E-45
score: 157.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 295..442
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 26..443