60S ribosomal protein L3

Overview
Name60S ribosomal protein L3
Smed IDSMED30032680
Length (bp)552
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L3 (SMED30032680) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L3 (SMED30032680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032680h1SMcG0021847 SmedASXL_011003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032680h1SMcG0021847 SmedASXL_011003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30032680h1SMcG0021847 SmedASXL_011002SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032680h1SMcG0021847 SmedASXL_011002SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30032680h1SMcG0021847 dd_Smed_v4_12559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032680h1SMcG0021847 dd_Smed_v4_12559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032680h1SMcG0021847 dd_Smed_v4_12559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032680h1SMcG0021847 dd_Smed_v4_12559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032680h1SMcG0021847 dd_Smed_v4_13357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Match: RPL3 (ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10332])

HSP 1 Score: 242.276 bits (617), Expect = 6.903e-81
Identity = 112/158 (70.89%), Postives = 133/158 (84.18%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D+ GKK +E D + MKKYC+
Sbjct:   34 SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQ 190          
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Match: RPL3 (ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10332])

HSP 1 Score: 244.588 bits (623), Expect = 4.978e-80
Identity = 113/159 (71.07%), Postives = 134/159 (84.28%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D+ GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Match: RPL3 (ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10332])

HSP 1 Score: 240.736 bits (613), Expect = 1.105e-79
Identity = 112/158 (70.89%), Postives = 133/158 (84.18%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D+ GKK +E D + MKKYC+
Sbjct:   29 SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQ 185          
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 204.142 bits (518), Expect = 4.400e-64
Identity = 101/159 (63.52%), Postives = 127/159 (79.87%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHG LGFLP KR  R +GKVKT+P+DD S PVHLT+F  YKAG T  +RE++    K +  +E V+ VTI+ETPP+ +VG+VGY+ TP+GLRSFKT++AEH+SDECRRRFYK+W+KS+KKAFTK+ K+W D  GKK ++ D   MKKYCK
Sbjct:    1 MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREVHRPGLKISK-REEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Match: RPL3 (ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10332])

HSP 1 Score: 196.052 bits (497), Expect = 7.215e-64
Identity = 90/123 (73.17%), Postives = 105/123 (85.37%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNW 444
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKN 
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNC 122          
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Match: rpl-3 (60S ribosomal protein L3 [Source:UniProtKB/Swiss-Prot;Acc:P50880])

HSP 1 Score: 221.09 bits (562), Expect = 6.818e-72
Identity = 97/158 (61.39%), Postives = 125/158 (79.11%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRKFSAPRHG +GF P+KR    +G++K FPKDD+S P+HLT+F  YKAG T +VR+++   +K N  KEVV+ VTI+ETPPM I G+ GY++TP+G R+  T+WAEH+S+E RRRFY NW KS+KKAFTK +KKW D+ GKKLIE+D  K+KKYC
Sbjct:    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNK-KEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYC 157          
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Match: rpl-3 (60S ribosomal protein L3 [Source:UniProtKB/Swiss-Prot;Acc:P50880])

HSP 1 Score: 221.476 bits (563), Expect = 1.855e-71
Identity = 97/158 (61.39%), Postives = 125/158 (79.11%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRKFSAPRHG +GF P+KR    +G++K FPKDD+S P+HLT+F  YKAG T +VR+++   +K N  KEVV+ VTI+ETPPM I G+ GY++TP+G R+  T+WAEH+S+E RRRFY NW KS+KKAFTK +KKW D+ GKKLIE+D  K+KKYC
Sbjct:    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNK-KEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYC 157          
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Match: rpl-3 (60S ribosomal protein L3 [Source:UniProtKB/Swiss-Prot;Acc:P50880])

HSP 1 Score: 221.476 bits (563), Expect = 1.855e-71
Identity = 97/158 (61.39%), Postives = 125/158 (79.11%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRKFSAPRHG +GF P+KR    +G++K FPKDD+S P+HLT+F  YKAG T +VR+++   +K N  KEVV+ VTI+ETPPM I G+ GY++TP+G R+  T+WAEH+S+E RRRFY NW KS+KKAFTK +KKW D+ GKKLIE+D  K+KKYC
Sbjct:    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNK-KEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYC 157          
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Match: rpl-3 (60S ribosomal protein L3 [Source:UniProtKB/Swiss-Prot;Acc:P50880])

HSP 1 Score: 51.2174 bits (121), Expect = 6.765e-8
Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 1
Query:  445 YKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            Y+ + KAFTK +KKW D+ GKKLIE+D  K+KKYC
Sbjct:   25 YRGRIKAFTKYAKKWQDEDGKKLIEADFAKLKKYC 59          

HSP 2 Score: 49.6766 bits (117), Expect = 2.376e-7
Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPK 177
            MSHRKFSAPRHG +GF P+KR    +G++K F K
Sbjct:    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFTK 34          
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Match: rpl-3 (60S ribosomal protein L3 [Source:UniProtKB/Swiss-Prot;Acc:P50880])

HSP 1 Score: 51.2174 bits (121), Expect = 6.765e-8
Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 1
Query:  445 YKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            Y+ + KAFTK +KKW D+ GKKLIE+D  K+KKYC
Sbjct:   25 YRGRIKAFTKYAKKWQDEDGKKLIEADFAKLKKYC 59          

HSP 2 Score: 49.6766 bits (117), Expect = 2.376e-7
Identity = 21/34 (61.76%), Postives = 26/34 (76.47%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPK 177
            MSHRKFSAPRHG +GF P+KR    +G++K F K
Sbjct:    1 MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFTK 34          
BLAST of 60S ribosomal protein L3 vs. Ensembl Fly
Match: RpL3 (gene:FBgn0020910 transcript:FBtr0082346)

HSP 1 Score: 236.884 bits (603), Expect = 4.547e-77
Identity = 110/159 (69.18%), Postives = 127/159 (79.87%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGS+ F P+KR  R +GKVK FPKDD S PVHLT F  YKAG T +VRE +   +K N  KEVV+ VT+LETPPM +VG VGYIETP GLR+   VWA+H+S+ECRRRFYKNWYKS+KKAFTK+SKKWTDD GKK IE+D  KM +YCK
Sbjct:    1 MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINK-KEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Fly
Match: RpL3 (gene:FBgn0020910 transcript:FBtr0336783)

HSP 1 Score: 236.884 bits (603), Expect = 4.547e-77
Identity = 110/159 (69.18%), Postives = 127/159 (79.87%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGS+ F P+KR  R +GKVK FPKDD S PVHLT F  YKAG T +VRE +   +K N  KEVV+ VT+LETPPM +VG VGYIETP GLR+   VWA+H+S+ECRRRFYKNWYKS+KKAFTK+SKKWTDD GKK IE+D  KM +YCK
Sbjct:    1 MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINK-KEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Fly
Match: RpL3 (gene:FBgn0020910 transcript:FBtr0082347)

HSP 1 Score: 186.422 bits (472), Expect = 1.400e-60
Identity = 85/127 (66.93%), Postives = 99/127 (77.95%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQ 456
            MSHRKFSAPRHGS+ F P+KR  R +GKVK FPKDD S PVHLT F  YKAG T +VRE +   +K N  KEVV+ VT+LETPPM +VG VGYIETP GLR+   VWA+H+S+ECRRRFYKNWY S+
Sbjct:    1 MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINK-KEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYVSE 126          
BLAST of 60S ribosomal protein L3 vs. Ensembl Fly
Match: RpL3 (gene:FBgn0020910 transcript:FBtr0302586)

HSP 1 Score: 178.718 bits (452), Expect = 6.700e-58
Identity = 82/122 (67.21%), Postives = 95/122 (77.87%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKN 441
            MSHRKFSAPRHGS+ F P+KR  R +GKVK FPKDD S PVHLT F  YKAG T +VRE +   +K N  KEVV+ VT+LETPPM +VG VGYIETP GLR+   VWA+H+S+ECRRRFYKN
Sbjct:    1 MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINK-KEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKN 121          
BLAST of 60S ribosomal protein L3 vs. Ensembl Zebrafish
Match: rpl3 (ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030131-1291])

HSP 1 Score: 226.098 bits (575), Expect = 6.726e-73
Identity = 111/159 (69.81%), Postives = 134/159 (84.28%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKRC R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM +VG+VGY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  K+W D+ GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRCKRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMIVVGVVGYVMTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKRWQDEEGKKQLEKDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Zebrafish
Match: rpl3 (ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030131-1291])

HSP 1 Score: 226.098 bits (575), Expect = 6.726e-73
Identity = 111/159 (69.81%), Postives = 134/159 (84.28%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKRC R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM +VG+VGY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  K+W D+ GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRCKRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMIVVGVVGYVMTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKRWQDEEGKKQLEKDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Match: rpl3l (ribosomal protein L3 like [Source:NCBI gene;Acc:595000])

HSP 1 Score: 229.95 bits (585), Expect = 3.142e-74
Identity = 106/159 (66.67%), Postives = 130/159 (81.76%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHG LGFLP KR  R +GKVKT+PKDD S PVHLT+F  YKAG T  +RE++ +T    + +E V+ VTI+ETPP+ +VGIVGY+ETP+GLRS KT++AEHISDEC+RRFY+NWYKS+KK+FTK SKKW D+ GKK +E D + MKKYCK
Sbjct:    1 MSHRKFSAPRHGHLGFLPHKRSRRHRGKVKTWPKDDPSKPVHLTAFLGYKAGMTHTLREVH-RTGLKISKREEVEAVTIIETPPLVVVGIVGYVETPRGLRSLKTIFAEHISDECKRRFYRNWYKSKKKSFTKYSKKWQDEEGKKQLEKDFSAMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Match: mrc1 (mannose receptor C-type 1 [Source:Xenbase;Acc:XB-GENE-494275])

HSP 1 Score: 228.409 bits (581), Expect = 1.102e-73
Identity = 113/159 (71.07%), Postives = 133/159 (83.65%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDDQS P+HLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM IVGIVGY++TP+GLRS KT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW DD GKK +E D   MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSKRHRGKVKSFPKDDQSKPIHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMVIVGIVGYVQTPRGLRSLKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDDEGKKQLEKDFASMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Match: mrc1 (mannose receptor C-type 1 [Source:Xenbase;Acc:XB-GENE-494275])

HSP 1 Score: 225.328 bits (573), Expect = 6.530e-73
Identity = 112/158 (70.89%), Postives = 132/158 (83.54%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDDQS P+HLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM IVGIVGY++TP+GLRS KT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW DD GKK +E D   MKKYC+
Sbjct:   10 SHRKFSAPRHGSLGFLPRKRSKRHRGKVKSFPKDDQSKPIHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMVIVGIVGYVQTPRGLRSLKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDDEGKKQLEKDFASMKKYCQ 166          
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Match: mrc1 (mannose receptor C-type 1 [Source:Xenbase;Acc:XB-GENE-494275])

HSP 1 Score: 226.098 bits (575), Expect = 7.105e-73
Identity = 112/158 (70.89%), Postives = 132/158 (83.54%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDDQS P+HLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM IVGIVGY++TP+GLRS KT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW DD GKK +E D   MKKYC+
Sbjct:    3 SHRKFSAPRHGSLGFLPRKRSKRHRGKVKSFPKDDQSKPIHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMVIVGIVGYVQTPRGLRSLKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDDEGKKQLEKDFASMKKYCQ 159          
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Match: mrc1 (mannose receptor C-type 1 [Source:Xenbase;Acc:XB-GENE-494275])

HSP 1 Score: 226.098 bits (575), Expect = 1.067e-72
Identity = 112/158 (70.89%), Postives = 132/158 (83.54%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDDQS P+HLT+F  YKAG T +VRE++   +K N  KEVV+ VT++ETPPM IVGIVGY++TP+GLRS KT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW DD GKK +E D   MKKYC+
Sbjct:   10 SHRKFSAPRHGSLGFLPRKRSKRHRGKVKSFPKDDQSKPIHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTVVETPPMVIVGIVGYVQTPRGLRSLKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDDEGKKQLEKDFASMKKYCQ 166          
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Match: Rpl3 (ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:1351605])

HSP 1 Score: 247.669 bits (631), Expect = 2.593e-84
Identity = 115/158 (72.78%), Postives = 134/158 (84.81%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW DDTGKK +E D N MKKYC+
Sbjct:   23 SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQ 179          
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Match: Rpl3 (ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:1351605])

HSP 1 Score: 251.521 bits (641), Expect = 6.985e-83
Identity = 116/159 (72.96%), Postives = 135/159 (84.91%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW DDTGKK +E D N MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Match: Rpl3 (ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:1351605])

HSP 1 Score: 196.052 bits (497), Expect = 5.647e-64
Identity = 90/123 (73.17%), Postives = 105/123 (85.37%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNW 444
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKN 
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNC 122          
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Match: Rpl3l (ribosomal protein L3-like [Source:MGI Symbol;Acc:MGI:1913461])

HSP 1 Score: 202.216 bits (513), Expect = 1.252e-63
Identity = 100/159 (62.89%), Postives = 127/159 (79.87%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHG LGFLP KR  R +GKVK++P+DD S PVHLT+F  YKAG T  +RE++    K +  +E V+ VTI+ETPP+ +VG+VGY+ TP+GLRSFKT++AEH+SDECRRRFYK+W+KS+KKAFTK+ K+W D  GKK ++ D   MKKYCK
Sbjct:    1 MSHRKFSAPRHGHLGFLPHKRSRRHRGKVKSWPRDDPSQPVHLTAFLGYKAGMTHTLREVHRPGLKISK-REEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKKAFTKACKRWRDADGKKQLQKDFAAMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Match: Rpl3l (ribosomal protein L3-like [Source:MGI Symbol;Acc:MGI:1913461])

HSP 1 Score: 121.324 bits (303), Expect = 2.673e-35
Identity = 62/106 (58.49%), Postives = 84/106 (79.25%), Query Frame = 1
Query:  235 TQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            T  +RE++    K +  +E V+ VTI+ETPP+ +VG+VGY+ TP+GLRSFKT++AEH+SDECRRRFYK+W+KS+KKAFTK+ K+W D  GKK ++ D   MKKYCK
Sbjct:    2 THTLREVHRPGLKISK-REEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKDWHKSKKKAFTKACKRWRDADGKKQLQKDFAAMKKYCK 106          
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Match: sp|P27659|RL3_MOUSE (60S ribosomal protein L3 OS=Mus musculus OX=10090 GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 251.521 bits (641), Expect = 4.886e-82
Identity = 116/159 (72.96%), Postives = 135/159 (84.91%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW DDTGKK +E D N MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Match: sp|P21531|RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus OX=10116 GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 250.751 bits (639), Expect = 1.033e-81
Identity = 116/159 (72.96%), Postives = 135/159 (84.91%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW DDTGKK +E D N MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Match: sp|P39023|RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 2.391e-79
Identity = 113/159 (71.07%), Postives = 134/159 (84.28%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D+ GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Match: sp|P39872|RL3_BOVIN (60S ribosomal protein L3 OS=Bos taurus OX=9913 GN=RPL3 PE=2 SV=2)

HSP 1 Score: 244.202 bits (622), Expect = 3.419e-79
Identity = 113/159 (71.07%), Postives = 133/159 (83.65%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM IVGIVGY+ETP+GLR+FKT++AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D  GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVIVGIVGYVETPRGLRTFKTIFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDADGKKQLERDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Match: sp|Q4R5Q0|RL3_MACFA (60S ribosomal protein L3 OS=Macaca fascicularis OX=9541 GN=RPL3 PE=2 SV=3)

HSP 1 Score: 243.432 bits (620), Expect = 6.842e-79
Identity = 113/159 (71.07%), Postives = 133/159 (83.65%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV  VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW D+ GKK +E D + MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVVAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Match: A0A1S6KMI3 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.723e-95
Identity = 136/159 (85.53%), Postives = 147/159 (92.45%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKRC R +GK K+FP D QS PVHLTSF AYKAG TQVVREINS+TNKTNNGKEVVD VTILETPPM IVG+VGYIETPKGLR+FKTVWAEH+S+ECRRRFYKNWYKS+KKAFT+SSKKWT+D GKKLIE+D NKMKKYCK
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRCRRNKGKCKSFPVDRQSDPVHLTSFLAYKAGCTQVVREINSQTNKTNNGKEVVDQVTILETPPMMIVGVVGYIETPKGLRTFKTVWAEHLSEECRRRFYKNWYKSKKKAFTRSSKKWTEDRGKKLIEADFNKMKKYCK 159          
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Match: T1FI63 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20208512 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.296e-82
Identity = 116/158 (73.42%), Postives = 136/158 (86.08%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRKFSAPRHGSLGFLP+KR  R +GKVK FPKDD+S PVHLT+F  YKAG T VVRE++   +K +  KEVV+ VTILETPPM +VGIVGYIETPKGLR+FKTVWAEH+ DEC+RRFYKNWY+S+KKAFTK+S+KW D+TGKK I+ D NK+KKYC
Sbjct:   14 MSHRKFSAPRHGSLGFLPKKRSRRHRGKVKAFPKDDKSKPVHLTAFLGYKAGMTHVVREVDRPGSKVHK-KEVVEAVTILETPPMIVVGIVGYIETPKGLRTFKTVWAEHLGDECKRRFYKNWYRSKKKAFTKASQKWADETGKKEIDKDFNKIKKYC 170          
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Match: B2YI24 (Putative 60S ribosomal protein RPL3 (Fragment) OS=Phoronis muelleri OX=478209 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 4.829e-82
Identity = 116/159 (72.96%), Postives = 133/159 (83.65%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSL FLP+KR VR +GK K FPKDD S PVHLT+F  YKAG + +VR+++   +K N  KEVV+ VTI+ETPPM  VG+VGYIETPKGLR+FKTVWAEH+S+ECRRRFYKNWYKS+KKAFTK  KKW DD GK+ IE DLNKMKKYCK
Sbjct:    1 MSHRKFSAPRHGSLAFLPKKRSVRHRGKCKAFPKDDSSKPVHLTAFLGYKAGMSHIVRDVDRPGSKANK-KEVVEAVTIVETPPMIAVGVVGYIETPKGLRTFKTVWAEHLSEECRRRFYKNWYKSKKKAFTKYGKKWKDDDGKQAIEKDLNKMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Match: A0A087WQK0 (60S ribosomal protein L3 (Fragment) OS=Mus musculus OX=10090 GN=Rpl3 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 5.376e-81
Identity = 115/158 (72.78%), Postives = 134/158 (84.81%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VGIVGY+ETP+GLR+FKTV+AEHISDEC+RRFYKNW+KS+KKAFTK  KKW DDTGKK +E D N MKKYC+
Sbjct:   23 SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQ 179          
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Match: A0A0A0V6U7 (Ribosomal protein L3 (Fragment) OS=Scytodes thoracica OX=1112478 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 9.081e-81
Identity = 114/159 (71.70%), Postives = 132/159 (83.02%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGS+GF+P+KR  R +GKVK FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTILETPPM IVG+VGYIETPKGLR+FKT+WAEH+S++CRRRFYKNWYKS+KKAF K +KKW DD GKK IE D  KM KYCK
Sbjct:    7 MSHRKFSAPRHGSMGFVPKKRSKRHRGKVKAFPKDDSSKPVHLTAFIGYKAGMTHIVREVDKPGSKVNK-KEVVEAVTILETPPMVIVGVVGYIETPKGLRAFKTIWAEHLSEDCRRRFYKNWYKSKKKAFVKYAKKWQDDVGKKEIEKDFKKMAKYCK 164          
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:103021491])

HSP 1 Score: 244.588 bits (623), Expect = 3.298e-80
Identity = 113/159 (71.07%), Postives = 132/159 (83.02%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GKVK+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+VGY+ETP+GLRSFKT++AEH+SDECRRRFY+NW KS+KKAFTK  KKW DD GKK +E D   MKKYCK
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMIVVGLVGYVETPRGLRSFKTIFAEHLSDECRRRFYRNWSKSKKKAFTKYCKKWQDDEGKKQLEKDFASMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 220.32 bits (560), Expect = 4.104e-70
Identity = 101/158 (63.92%), Postives = 125/158 (79.11%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRKF APRHG +GFLP KR  R  G+V+++PKDD   PVHLT+F  YKAG T  +RE++ +T    + +E V+ VTI+ETPP+ +VG+VGYI T KGLRSFKT++AEH+SDEC+RRFYKNWYKS+KKAFTK SKKW D+TGKK +E D   MKKYC
Sbjct:    1 MSHRKFHAPRHGHMGFLPHKRSKRHHGRVRSWPKDDPKQPVHLTAFLGYKAGMTHTLREVH-RTGMKISKREEVEAVTIIETPPIIVVGVVGYISTIKGLRSFKTIFAEHLSDECKRRFYKNWYKSKKKAFTKYSKKWQDETGKKQLEKDFTLMKKYC 157          
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 218.009 bits (554), Expect = 3.656e-69
Identity = 100/157 (63.69%), Postives = 124/157 (78.98%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            SHRKF APRHG +GFLP KR  R  G+V+++PKDD   PVHLT+F  YKAG T  +RE++ +T    + +E V+ VTI+ETPP+ +VG+VGYI T KGLRSFKT++AEH+SDEC+RRFYKNWYKS+KKAFTK SKKW D+TGKK +E D   MKKYC
Sbjct:   12 SHRKFHAPRHGHMGFLPHKRSKRHHGRVRSWPKDDPKQPVHLTAFLGYKAGMTHTLREVH-RTGMKISKREEVEAVTIIETPPIIVVGVVGYISTIKGLRSFKTIFAEHLSDECKRRFYKNWYKSKKKAFTKYSKKWQDETGKKQLEKDFTLMKKYC 167          
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 196.052 bits (497), Expect = 2.058e-61
Identity = 90/145 (62.07%), Postives = 114/145 (78.62%), Query Frame = 1
Query:  115 LGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            +GFLP KR  R  G+V+++PKDD   PVHLT+F  YKAG T  +RE++ +T    + +E V+ VTI+ETPP+ +VG+VGYI T KGLRSFKT++AEH+SDEC+RRFYKNWYKS+KKAFTK SKKW D+TGKK +E D   MKKYC
Sbjct:    1 MGFLPHKRSKRHHGRVRSWPKDDPKQPVHLTAFLGYKAGMTHTLREVH-RTGMKISKREEVEAVTIIETPPIIVVGVVGYISTIKGLRSFKTIFAEHLSDECKRRFYKNWYKSKKKAFTKYSKKWQDETGKKQLEKDFTLMKKYC 144          
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 195.667 bits (496), Expect = 8.953e-61
Identity = 90/145 (62.07%), Postives = 114/145 (78.62%), Query Frame = 1
Query:  115 LGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            +GFLP KR  R  G+V+++PKDD   PVHLT+F  YKAG T  +RE++ +T    + +E V+ VTI+ETPP+ +VG+VGYI T KGLRSFKT++AEH+SDEC+RRFYKNWYKS+KKAFTK SKKW D+TGKK +E D   MKKYC
Sbjct:    1 MGFLPHKRSKRHHGRVRSWPKDDPKQPVHLTAFLGYKAGMTHTLREVH-RTGMKISKREEVEAVTIIETPPIIVVGVVGYISTIKGLRSFKTIFAEHLSDECKRRFYKNWYKSKKKAFTKYSKKWQDETGKKQLEKDFTLMKKYC 144          
BLAST of 60S ribosomal protein L3 vs. Ensembl Sea Lamprey
Match: RPL3L (ribosomal protein L3 like [Source:HGNC Symbol;Acc:HGNC:10351])

HSP 1 Score: 50.8322 bits (120), Expect = 2.699e-8
Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 1
Query:  445 YKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            YK +KKAFTK+SKKWTDD G+K ++ D   MKK+C
Sbjct:    3 YKCKKKAFTKASKKWTDDAGRKQLDKDFATMKKHC 37          
BLAST of 60S ribosomal protein L3 vs. Ensembl Yeast
Match: RPL3 (Ribosomal 60S subunit protein L3; homologous to mammalian ribosomal protein L3 and bacterial L3; plays an important role in function of eIF5B in stimulating 3' end processing of 18S rRNA in context of 80S ribosomes that have not yet engaged in translation; involved in replication and maintenance of killer double stranded RNA virus [Source:SGD;Acc:S000005589])

HSP 1 Score: 166.007 bits (419), Expect = 1.020e-50
Identity = 94/158 (59.49%), Postives = 121/158 (76.58%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYC 549
            MSHRK+ APRHG LGFLPRKR    + +VK FPKDD+S PV LTSF  YKAG T +VR+++   +K +  +EVV+ VT+++TPP+ +VG+VGY+ETP+GLRS  TVWAEH+SDE +RRFYKNWYKS+KKAFTK S K+  D     IE +L ++KKY 
Sbjct:    1 MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHK-REVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAG--IERELARIKKYA 155          
BLAST of 60S ribosomal protein L3 vs. Ensembl Nematostella
Match: EDO38565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCQ8])

HSP 1 Score: 236.498 bits (602), Expect = 5.122e-80
Identity = 107/159 (67.30%), Postives = 129/159 (81.13%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKF APRHGSLGFLPRKRC R +GKVK+FPKDD + P HLT+F  +KAG T ++RE+    +K N  KE V+ VTI+ETPPM +VG+VGYIETP+G+R  KT+WAEH+S+EC+RRFYKNW  S+KKAFTK+SK+W DD GKK IE D N MKKYCK
Sbjct:    1 MSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILREVEKPGSKLNK-KEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRFYKNWCNSKKKAFTKASKRWADDDGKKSIEEDFNTMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Nematostella
Match: EDO32729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU78])

HSP 1 Score: 237.654 bits (605), Expect = 5.593e-78
Identity = 107/159 (67.30%), Postives = 129/159 (81.13%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKF APRHGSLGFLPRKRC R +GKVK+FPKDD + P HLT+F  +KAG T ++RE+    +K N  KE V+ VTI+ETPPM +VG+VGYIETP+G+R  KT+WAEH+S+EC+RRFYKNW  S+KKAFTK+SK+W DD GKK IE D N MKKYCK
Sbjct:    1 MSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILREVEKPGSKLNK-KEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRFYKNWCNSKKKAFTKASKRWADDDGKKSIEEDFNTMKKYCK 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:101166874])

HSP 1 Score: 239.58 bits (610), Expect = 7.990e-79
Identity = 110/159 (69.18%), Postives = 130/159 (81.76%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GK K+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+ GY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW D+ GKK +E D   MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKCKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGVTGYVSTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDEEGKKQLEKDFASMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:101166874])

HSP 1 Score: 239.965 bits (611), Expect = 1.676e-78
Identity = 110/159 (69.18%), Postives = 130/159 (81.76%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +GK K+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+ GY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW D+ GKK +E D   MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKCKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGVTGYVSTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDEEGKKQLEKDFASMKKYCQ 158          
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:101166874])

HSP 1 Score: 238.81 bits (608), Expect = 6.196e-78
Identity = 109/159 (68.55%), Postives = 130/159 (81.76%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            +SHRKFSAPRHGSLGFLPRKR  R +GK K+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+ GY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW D+ GKK +E D   MKKYC+
Sbjct:    4 LSHRKFSAPRHGSLGFLPRKRSSRHRGKCKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGVTGYVSTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDEEGKKQLEKDFASMKKYCQ 161          
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:101166874])

HSP 1 Score: 238.039 bits (606), Expect = 2.190e-77
Identity = 109/158 (68.99%), Postives = 129/158 (81.65%), Query Frame = 1
Query:   79 SHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            SHRKFSAPRHGSLGFLPRKR  R +GK K+FPKDD S PVHLT+F  YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+ GY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW D+ GKK +E D   MKKYC+
Sbjct:   25 SHRKFSAPRHGSLGFLPRKRSSRHRGKCKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGVTGYVSTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDEEGKKQLEKDFASMKKYCQ 181          
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Match: rpl3 (60S ribosomal protein L3 [Source:NCBI gene;Acc:101166874])

HSP 1 Score: 197.208 bits (500), Expect = 4.580e-62
Identity = 96/159 (60.38%), Postives = 114/159 (71.70%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKR  R +G                     YKAG T +VRE++   +K N  KEVV+ VTI+ETPPM +VG+ GY+ TP+GLRSFKT++AEHISDEC+RRFYKNWYKS+KKAFTK  KKW D+ GKK +E D   MKKYC+
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRG---------------------YKAGMTHIVREVDRPGSKVNK-KEVVEAVTIVETPPMVVVGVTGYVSTPRGLRSFKTIFAEHISDECKRRFYKNWYKSKKKAFTKYCKKWQDEEGKKQLEKDFASMKKYCQ 137          
BLAST of 60S ribosomal protein L3 vs. Planmine SMEST
Match: SMESG000022732.1 (SMESG000022732.1)

HSP 1 Score: 292.738 bits (748), Expect = 4.792e-99
Identity = 136/159 (85.53%), Postives = 147/159 (92.45%), Query Frame = 1
Query:   76 MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYKAGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MSHRKFSAPRHGSLGFLPRKRC R +GK K+FP D QS PVHLTSF AYKAG TQVVREINS+TNKTNNGKEVVD VTILETPPM IVG+VGYIETPKGLR+FKTVWAEH+S+ECRRRFYKNWYKS+KKAFT+SSKKWT+D GKKLIE+D NKMKKYCK
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRCRRNKGKCKSFPVDRQSDPVHLTSFLAYKAGCTQVVREINSQTNKTNNGKEVVDQVTILETPPMMIVGVVGYIETPKGLRTFKTVWAEHLSEECRRRFYKNWYKSKKKAFTRSSKKWTEDRGKKLIEADFNKMKKYCK 159          
BLAST of 60S ribosomal protein L3 vs. Planmine SMEST
Match: SMESG000081260.1 (SMESG000081260.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.466e-48
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
Query:  328 MTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 552
            MTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK
Sbjct:    1 MTIVGIVGYIETPKGLRSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESDLNKMKKYCK 75          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL36.903e-8170.89ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL34.978e-8071.07ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL31.105e-7970.89ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL3L4.400e-6463.52ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
RPL37.215e-6473.17ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl-36.818e-7261.3960S ribosomal protein L3 [Source:UniProtKB/Swiss-... [more]
rpl-31.855e-7161.3960S ribosomal protein L3 [Source:UniProtKB/Swiss-... [more]
rpl-31.855e-7161.3960S ribosomal protein L3 [Source:UniProtKB/Swiss-... [more]
rpl-36.765e-862.8660S ribosomal protein L3 [Source:UniProtKB/Swiss-... [more]
rpl-36.765e-862.8660S ribosomal protein L3 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RpL34.547e-7769.18gene:FBgn0020910 transcript:FBtr0082346[more]
RpL34.547e-7769.18gene:FBgn0020910 transcript:FBtr0336783[more]
RpL31.400e-6066.93gene:FBgn0020910 transcript:FBtr0082347[more]
RpL36.700e-5867.21gene:FBgn0020910 transcript:FBtr0302586[more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl36.726e-7369.81ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl36.726e-7369.81ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl3l3.142e-7466.67ribosomal protein L3 like [Source:NCBI gene;Acc:59... [more]
mrc11.102e-7371.07mannose receptor C-type 1 [Source:Xenbase;Acc:XB-G... [more]
mrc16.530e-7370.89mannose receptor C-type 1 [Source:Xenbase;Acc:XB-G... [more]
mrc17.105e-7370.89mannose receptor C-type 1 [Source:Xenbase;Acc:XB-G... [more]
mrc11.067e-7270.89mannose receptor C-type 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpl32.593e-8472.78ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:13... [more]
Rpl36.985e-8372.96ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:13... [more]
Rpl35.647e-6473.17ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:13... [more]
Rpl3l1.252e-6362.89ribosomal protein L3-like [Source:MGI Symbol;Acc:M... [more]
Rpl3l2.673e-3558.49ribosomal protein L3-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27659|RL3_MOUSE4.886e-8272.9660S ribosomal protein L3 OS=Mus musculus OX=10090 ... [more]
sp|P21531|RL3_RAT1.033e-8172.9660S ribosomal protein L3 OS=Rattus norvegicus OX=1... [more]
sp|P39023|RL3_HUMAN2.391e-7971.0760S ribosomal protein L3 OS=Homo sapiens OX=9606 G... [more]
sp|P39872|RL3_BOVIN3.419e-7971.0760S ribosomal protein L3 OS=Bos taurus OX=9913 GN=... [more]
sp|Q4R5Q0|RL3_MACFA6.842e-7971.0760S ribosomal protein L3 OS=Macaca fascicularis OX... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI31.723e-9585.53Uncharacterized protein OS=Schmidtea mediterranea ... [more]
T1FI631.296e-8273.42Uncharacterized protein OS=Helobdella robusta OX=6... [more]
B2YI244.829e-8272.96Putative 60S ribosomal protein RPL3 (Fragment) OS=... [more]
A0A087WQK05.376e-8172.7860S ribosomal protein L3 (Fragment) OS=Mus musculu... [more]
A0A0A0V6U79.081e-8171.70Ribosomal protein L3 (Fragment) OS=Scytodes thorac... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl33.298e-8071.0760S ribosomal protein L3 [Source:NCBI gene;Acc:103... [more]
RPL3L4.104e-7063.92ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
RPL3L3.656e-6963.69ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
RPL3L2.058e-6162.07ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
RPL3L8.953e-6162.07ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RPL3L2.699e-862.86ribosomal protein L3 like [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPL31.020e-5059.49Ribosomal 60S subunit protein L3; homologous to ma... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO385655.122e-8067.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327295.593e-7867.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl37.990e-7969.1860S ribosomal protein L3 [Source:NCBI gene;Acc:101... [more]
rpl31.676e-7869.1860S ribosomal protein L3 [Source:NCBI gene;Acc:101... [more]
rpl36.196e-7868.5560S ribosomal protein L3 [Source:NCBI gene;Acc:101... [more]
rpl32.190e-7768.9960S ribosomal protein L3 [Source:NCBI gene;Acc:101... [more]
rpl34.580e-6260.3860S ribosomal protein L3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of 60S ribosomal protein L3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022732.14.792e-9985.53SMESG000022732.1[more]
SMESG000081260.11.466e-48100.00SMESG000081260.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032680 ID=SMED30032680|Name=60S ribosomal protein L3|organism=Schmidtea mediterranea sexual|type=transcript|length=552bp
CGATAAAGAAAATAATCTTAAATTAATATGAATATTTGTTTCAATATATA
AAATAAAAAAAACCATAAAAATTAAATGTCCCATAGGAAGTTTTCAGCAC
CTCGTCACGGTAGTTTAGGATTTCTACCACGTAAAAGATGTGTTAGACGA
CAAGGTAAAGTTAAGACATTTCCTAAAGATGACCAATCAAGCCCTGTTCA
TTTGACTAGCTTTTTTGCTTATAAAGCCGGATCAACTCAGGTGGTAAGAG
AAATTAATAGTAAAACAAACAAAACAAATAATGGTAAAGAAGTTGTTGAT
GTTGTTACGATTTTGGAGACTCCACCAATGACAATTGTTGGAATCGTTGG
TTACATTGAAACTCCTAAAGGATTAAGATCTTTTAAAACCGTTTGGGCAG
AACATATCAGCGATGAATGCCGAAGACGATTTTACAAGAATTGGTATAAA
AGCCAAAAGAAAGCCTTCACTAAATCATCGAAGAAGTGGACTGATGATAC
TGGCAAGAAACTTATTGAAAGTGACTTGAATAAAATGAAAAAATACTGCA
AA
back to top

protein sequence of SMED30032680-orf-1

>SMED30032680-orf-1 ID=SMED30032680-orf-1|Name=SMED30032680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MSHRKFSAPRHGSLGFLPRKRCVRRQGKVKTFPKDDQSSPVHLTSFFAYK
AGSTQVVREINSKTNKTNNGKEVVDVVTILETPPMTIVGIVGYIETPKGL
RSFKTVWAEHISDECRRRFYKNWYKSQKKAFTKSSKKWTDDTGKKLIESD
LNKMKKYCK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000597Ribosomal_L3
IPR009000Transl_B-barrel_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0003723RNA binding
GO:00080975S rRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005925focal adhesion
GO:0022625cytosolic large ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0008150biological_process
GO:0071353cellular response to interleukin-4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:4.10.960.10coord: 1..43
e-value: 5.1E-68
score: 231.7
NoneNo IPR availableGENE3DG3DSA:3.30.1430.10coord: 84..159
e-value: 5.1E-68
score: 231.7
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 44..83
e-value: 5.1E-68
score: 231.7
NoneNo IPR availablePANTHERPTHR1136360S RIBOSOMAL PROTEIN L3-RELATEDcoord: 1..159
NoneNo IPR availablePANTHERPTHR11363:SF460S RIBOSOMAL PROTEIN L3coord: 1..159
IPR000597Ribosomal protein L3PFAMPF00297Ribosomal_L3coord: 1..158
e-value: 5.7E-68
score: 229.6
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 4..142