Axonemal dynein light chain domain containing 1

Overview
NameAxonemal dynein light chain domain containing 1
Smed IDSMED30032668
Length (bp)3154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Axonemal dynein light chain domain containing 1 (SMED30032668) t-SNE clustered cells

Violin plots show distribution of expression levels for Axonemal dynein light chain domain containing 1 (SMED30032668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Axonemal dynein light chain domain containing 1 (SMED30032668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Axonemal dynein light chain domain containing 1 (SMED30032668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032668h1SMcG0014984 dd_Smed_v4_16309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032668h1SMcG0014984 dd_Smed_v4_16309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032668h1SMcG0014984 dd_Smed_v4_8788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032668h1SMcG0014984 dd_Smed_v4_8788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032668h1SMcG0014984 dd_Smed_v4_8788_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032668h1SMcG0014984 dd_Smed_v6_8788_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30032668h1SMcG0014984 dd_Smed_v6_16309_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032668h1SMcG0014984 dd_Smed_v4_16309_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032668h1SMcG0014984 dd_Smed_v4_8788_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 142.124 bits (357), Expect = 7.769e-35
Identity = 110/424 (25.94%), Postives = 199/424 (46.93%), Query Frame = 3
Query:  675 TNNNNDYIPLEIMNSLKNSLSTAN-NENLFPSSTKLFSKGN-------------RNTK-------PPKLTK-------FFDITAIRGDELNKINVQPE-----------------KLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTET 1808
            T+  N++IP E++ SL  + +     ENL P       KG              R  K       P  LT         +D+T  +G    K    P                  K    T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN+IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL ++ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++HF I +S+ DT   + +Q L+ K    + KL  E 
Sbjct:   52 TSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEV 470          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 142.124 bits (357), Expect = 7.769e-35
Identity = 110/424 (25.94%), Postives = 199/424 (46.93%), Query Frame = 3
Query:  675 TNNNNDYIPLEIMNSLKNSLSTAN-NENLFPSSTKLFSKGN-------------RNTK-------PPKLTK-------FFDITAIRGDELNKINVQPE-----------------KLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTET 1808
            T+  N++IP E++ SL  + +     ENL P       KG              R  K       P  LT         +D+T  +G    K    P                  K    T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN+IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL ++ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++HF I +S+ DT   + +Q L+ K    + KL  E 
Sbjct:   52 TSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEV 470          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 142.51 bits (358), Expect = 7.679e-34
Identity = 95/358 (26.54%), Postives = 192/358 (53.63%), Query Frame = 3
Query:  780 FSKGNRNTK---PPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT-------VLTSKIQDLSSKCLKQITKLHTETNKTM 1820
            ++KG    K   PP L +     +++  +   +  +P+ L+  T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN+IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL ++ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++HF I +S+ DT        LT K ++L +K  +++ ++   T++T+
Sbjct:   69 YAKGQTREKAVCPPHLAR-----SLQSHDGVIVPHKPKTLT-DTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETL 415          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 142.51 bits (358), Expect = 9.621e-34
Identity = 111/435 (25.52%), Postives = 207/435 (47.59%), Query Frame = 3
Query:  675 TNNNNDYIPLEIMNSLKNSLSTAN-NENLFPSSTKLFSKG--------------NRNT------KPPKLTK-------FFDITAIRGDELNKINVQPE-----------------KLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT-------VLTSKIQDLSSKCLKQITKLHTETNKTM 1820
            T+  N++IP E++ SL  + +     ENL P       KG               RN        P  LT         +D+T  +G    K    P                  K    T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN+IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL ++ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++HF I +S+ DT        LT K ++L +K  +++ ++   T++T+
Sbjct:   52 TSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETL 481          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Zebrafish
Match: axdnd1 (axonemal dynein light chain domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050208-341])

HSP 1 Score: 124.02 bits (310), Expect = 3.369e-28
Identity = 88/295 (29.83%), Postives = 166/295 (56.27%), Query Frame = 3
Query:  894 IKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVDK-AMIVFPSEFPESRHEVKYLHKTLCEMLTNQN-QPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSK 1772
            ++T+IP+++H++K+     L+  D + T   E +K  + VFPS  P  R EV  L K + +ML       +F      + +   I+ ++ELI     IYNI+FHE+ RQ+     +RG ++ +LR KY+ L+ ++P+++  L +    Q   D+ LT +I  F+ +I  L  +L  +K  D  V++ AE   +EL  AL++S R+  ++ EYH LY+LQ++RL+  ++ ++ E++ W    ++L++KI   + L+  +RL +  +   + +  F  +++  D+   S I DL+++
Sbjct:  159 LETLIPEEYHIIKNKGLKGLQCYDDKFTVLLEDEKNKLRVFPSMKPSGRLEVVQLMKVMDKMLEKAGVNEEFQ----ELTEISQIENLLELIQTEQNIYNIVFHEVIRQVSVECAERGQLLAKLRQKYVALLDRIPRQVKGLHTQTLAQRALDRRLTEEILHFKNSIASLNMELSAMKVHDENVSKEAEEAKEELAKALEESQRNANIVAEYHELYELQRKRLEGQMSHLDGERDLWRKATYSLAVKIIKINKLHLVRRLHISEQTWAKAADRFTFFLTAKDSEYFSHIMDLTNR 449          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:Xenbase;Acc:XB-GENE-5920309])

HSP 1 Score: 144.05 bits (362), Expect = 4.424e-35
Identity = 84/278 (30.22%), Postives = 162/278 (58.27%), Query Frame = 3
Query:  897 KTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVD-KAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQ-YSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYIS 1724
            ++++P++++++K+     LEY + + TT  + D K + +FPS  P  R EV  L K +  ML      D  +D+   +     I  ++EL+     IYNI+FHE+ RQ+     +RG ++ +LR +Y  L  ++P+++  L +D+  Q   D+ LT +I  F+ +I  +T +L +V+E D++V+ +A   H EL  AL ++ ++  +L+EY  LY+LQ+ RL+KHL  +  E++ WSS  + ++ K+ + + L+ +++L +  K    + +HF + ++
Sbjct:  154 ESLVPEEYYIVKNKGILGLEYHEDKYTTLLKDDEKKLRLFPSLKPSGRSEVLQLIKVMDSMLK-----DAGVDEDLKLEGPTPIHNLLELLKAEQNIYNIVFHEVIRQVSVECVERGELLAKLRQRYAMLFDKIPRQVLSLYNDLLAQRALDRCLTKEIMNFKNSIEDMTNELYQVREHDLRVSRDANQAHAELAKALSEAKKNANILDEYRELYELQRSRLEKHLVDLTEERDLWSSATYMIASKVIERNQLHLARKLCMCEKTWTNIIRHFIVMLA 426          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:Xenbase;Acc:XB-GENE-5920309])

HSP 1 Score: 116.316 bits (290), Expect = 2.305e-27
Identity = 67/202 (33.17%), Postives = 116/202 (57.43%), Query Frame = 3
Query: 1026 PESRHEVKYLHKTLCEMLTNQNQPDFAIDQ-YSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLK 1628
            P  R EV  L K +  ML      D  +D+   +     I  ++EL+     IYNI+FHE+ RQ+     +RG ++ +LR +Y  L  ++P+++  L +D+  Q   D+ LT +I  F+ +I  +T +L +V+E D++V+ +A   H EL  AL ++ ++  +L+EY  LY+LQ+ RL+KHL  +  E++ WSS  + ++ K
Sbjct:   15 PSGRSEVLQLIKVMDSML-----KDAGVDEDLKLEGPTPIHNLLELLKAEQNIYNIVFHEVIRQVSVECVERGELLAKLRQRYAMLFDKIPRQVLSLYNDLLAQRALDRCLTKEIMNFKNSIEDMTNELYQVREHDLRVSRDANQAHAELAKALSEAKKNANILDEYRELYELQRSRLEKHLVDLTEERDLWSSATYMIASK 211          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 134.42 bits (337), Expect = 1.601e-31
Identity = 87/347 (25.07%), Postives = 176/347 (50.72%), Query Frame = 3
Query:  825 FFDITAIRGDELNKINVQP---------------EKLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKT 1817
             +D+  ++G+ + K    P               EK    T++P++FH++ +   S LE Y D   T   + +  +++FPS  P  R EV  L   +  ML         I+  +      + +++ ++ +   IYN +FHEL RQ+      RG ++ ++R KY+ ++  + +++ +   D+  Q + D+ +  ++  F+  I  LT +L  V+  D K+T+ AE + K L  AL ++ ++ +++ +YH LY +Q+ R++  + ++  E++ WSS  + L+LK+ + + +  +K+L L  K   + ++HF I +S  DT     ++ L+ K  K + K   +  +T
Sbjct:   64 LYDVKYVKGEAVEKKLCPPNKSTQSQSSAMVPHKEKTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERA-----GIENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFYKDLVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERT 405          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 134.035 bits (336), Expect = 2.813e-31
Identity = 87/347 (25.07%), Postives = 176/347 (50.72%), Query Frame = 3
Query:  825 FFDITAIRGDELNKINVQP---------------EKLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKT 1817
             +D+  ++G+ + K    P               EK    T++P++FH++ +   S LE Y D   T   + +  +++FPS  P  R EV  L   +  ML         I+  +      + +++ ++ +   IYN +FHEL RQ+      RG ++ ++R KY+ ++  + +++ +   D+  Q + D+ +  ++  F+  I  LT +L  V+  D K+T+ AE + K L  AL ++ ++ +++ +YH LY +Q+ R++  + ++  E++ WSS  + L+LK+ + + +  +K+L L  K   + ++HF I +S  DT     ++ L+ K  K + K   +  +T
Sbjct:  129 LYDVKYVKGEAVEKKLCPPNKSTQSQSSAMVPHKEKTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERA-----GIENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFYKDLVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERT 470          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 133.65 bits (335), Expect = 3.578e-31
Identity = 87/347 (25.07%), Postives = 176/347 (50.72%), Query Frame = 3
Query:  825 FFDITAIRGDELNKINVQP---------------EKLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKT 1817
             +D+  ++G+ + K    P               EK    T++P++FH++ +   S LE Y D   T   + +  +++FPS  P  R EV  L   +  ML         I+  +      + +++ ++ +   IYN +FHEL RQ+      RG ++ ++R KY+ ++  + +++ +   D+  Q + D+ +  ++  F+  I  LT +L  V+  D K+T+ AE + K L  AL ++ ++ +++ +YH LY +Q+ R++  + ++  E++ WSS  + L+LK+ + + +  +K+L L  K   + ++HF I +S  DT     ++ L+ K  K + K   +  +T
Sbjct:  129 LYDVKYVKGEAVEKKLCPPNKSTQSQSSAMVPHKEKTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERA-----GIENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFYKDLVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERT 470          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 84.7297 bits (208), Expect = 1.503e-16
Identity = 57/239 (23.85%), Postives = 113/239 (47.28%), Query Frame = 3
Query: 1002 MIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVV------------------------------LELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLK 1628
            +++FPS  P  R EV  L   +  ML         I+  +      + +++ ++ +   IYN +FHEL RQ+      RG ++                              L  R KY+ ++  + +++ +   D+  Q + D+ +  ++  F+  I  LT +L  V+  D K+T+ AE + K L  AL ++ ++ +++ +YH LY +Q+ R++  + ++  E++ WSS  + L+LK
Sbjct:   12 LLLFPSMKPNKRVEVVQLSNVMDTMLERA-----GIENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIRYLLIFCVRAAREEPGFPPITSPPVLCLSHREKYVQMLDHIAQQMIEFYKDLVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALK 245          
BLAST of Axonemal dynein light chain domain containing 1 vs. UniProt/SwissProt
Match: sp|Q5T1B0|AXDN1_HUMAN (Axonemal dynein light chain domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AXDND1 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 4.621e-33
Identity = 111/435 (25.52%), Postives = 207/435 (47.59%), Query Frame = 3
Query:  675 TNNNNDYIPLEIMNSLKNSLSTAN-NENLFPSSTKLFSKG--------------NRNT------KPPKLTK-------FFDITAIRGDELNKINVQPE-----------------KLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT-------VLTSKIQDLSSKCLKQITKLHTETNKTM 1820
            T+  N++IP E++ SL  + +     ENL P       KG               RN        P  LT         +D+T  +G    K    P                  K    T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN+IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL ++ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++HF I +S+ DT        LT K ++L +K  +++ ++   T++T+
Sbjct:   52 TSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETL 481          
BLAST of Axonemal dynein light chain domain containing 1 vs. UniProt/SwissProt
Match: sp|Q95LP5|AXDN1_MACFA (Axonemal dynein light chain domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=AXDND1 PE=2 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 1.610e-32
Identity = 99/375 (26.40%), Postives = 196/375 (52.27%), Query Frame = 3
Query:  729 SLSTANNENLFPSSTKLFSKGNRNTK---PPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLE-YKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT-------VLTSKIQDLSSKCLKQITKLHTETNKTM 1820
            SL+ A  +  F    K ++KG    K   PP L +     +++  +   +  +P+ L+  T+IP++FH++     S LE Y D   T   + +  +++FPS  P  R EV  L+  +  ML         ++         + +++ ++ +   IYN IFHEL RQ+      RG ++ ++R +Y+ ++ Q+ +++     D+  Q V D+ +  ++  F+  I  LT +L  V+  D+K+T+  E  HK+L  AL D+ ++ +++ EYH LY LQ++R++  +  +  E++ WSS  + L+LK+ + + +  ++RL L  K   + ++H  I +++ DT        LT K ++L +K  +++ ++   T +T+
Sbjct:  118 SLTGAGRDISFLYDVK-YTKGQTREKAVCPPHLAR-----SLQSHDGVIVPHKPKTLT-DTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERA-----GVENQEYTGPTKMHKLLHILKKEQTIYNTIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLDAEKNAKMVEEYHDLYTLQRERMENDMKQLMAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHLIILLANKDTEDLALLQKLTQKWRNLVNKFKQEVEEMEESTRETL 480          
BLAST of Axonemal dynein light chain domain containing 1 vs. UniProt/SwissProt
Match: sp|Q3UZ57|AXDN1_MOUSE (Axonemal dynein light chain domain-containing protein 1 OS=Mus musculus OX=10090 GN=Axdnd1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.211e-18
Identity = 53/201 (26.37%), Postives = 108/201 (53.73%), Query Frame = 3
Query: 1026 PESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLK 1628
            P  R EV  L   +  ML         I+  +      + +++ ++ +   IYN +FHEL RQ+      RG ++ ++R KY+ ++  + +++ +   D+  Q + D+ +  ++  F+  I  LT +L  V+  D K+T+ AE + K L  AL ++ ++ +++ +YH LY +Q+ R++  + ++  E++ WSS  + L+LK
Sbjct:    3 PNKRVEVVQLSNVMDTMLERA-----GIENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFYKDLVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALK 198          
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Match: A0A1S3HFQ7 (axonemal dynein light chain domain-containing protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154496 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.325e-51
Identity = 123/306 (40.20%), Postives = 192/306 (62.75%), Query Frame = 3
Query:  825 FFDITAIRGDELNKINVQ-PEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVD-KAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT 1736
             +D++ +R DEL K ++Q P+     T+IP+++HV+K+     LEY D + TTK E   + +++FPS  P SR+EV  L KT+ +ML      D   D   V     +  ++ELI +   I+NI+FHEL RQ      +RG ++ +LRNKY  L+ ++P+++  L  +V  Q   D+ LT ++  F+  I  LT++L +VKE D KVT+ A    +EL++AL DS +S  LL EYH LY+LQ+ RL+K +T+++ EKE WS+ A++L+LK+++E  LNT+KRL +  K   +L+ HF I +SD DT
Sbjct:  159 LYDVSVVRKDELPKKSLQLPD-----TLIPEEYHVVKNKGVMGLEYHDDKYTTKPEDHVQHLVMFPSMKPSSRYEVIQLKKTMEQMLDRLGIDD---DDIEVKGPTQMHNLLELIKKEQNIFNIVFHELIRQTSVECVERGELLSDLRNKYSGLLNKVPRQIKSLHEEVLAQRALDRRLTEELMRFKNTIGVLTDELSQVKEHDKKVTQQAHQAQEELKNALVDSEKSASLLAEYHDLYELQRIRLEKLVTMLSEEKELWSTAAYSLALKVTEEHSLNTAKRLHISEKAWAKLANHFTILLSDKDT 456          
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Match: A0A1S3HE75 (axonemal dynein light chain domain-containing protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154496 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.395e-51
Identity = 123/306 (40.20%), Postives = 192/306 (62.75%), Query Frame = 3
Query:  825 FFDITAIRGDELNKINVQ-PEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVD-KAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDT 1736
             +D++ +R DEL K ++Q P+     T+IP+++HV+K+     LEY D + TTK E   + +++FPS  P SR+EV  L KT+ +ML      D   D   V     +  ++ELI +   I+NI+FHEL RQ      +RG ++ +LRNKY  L+ ++P+++  L  +V  Q   D+ LT ++  F+  I  LT++L +VKE D KVT+ A    +EL++AL DS +S  LL EYH LY+LQ+ RL+K +T+++ EKE WS+ A++L+LK+++E  LNT+KRL +  K   +L+ HF I +SD DT
Sbjct:  159 LYDVSVVRKDELPKKSLQLPD-----TLIPEEYHVVKNKGVMGLEYHDDKYTTKPEDHVQHLVMFPSMKPSSRYEVIQLKKTMEQMLDRLGIDD---DDIEVKGPTQMHNLLELIKKEQNIFNIVFHELIRQTSVECVERGELLSDLRNKYSGLLNKVPRQIKSLHEEVLAQRALDRRLTEELMRFKNTIGVLTDELSQVKEHDKKVTQQAHQAQEELKNALVDSEKSASLLAEYHDLYELQRIRLEKLVTMLSEEKELWSTAAYSLALKVTEEHSLNTAKRLHISEKAWAKLANHFTILLSDKDT 456          
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Match: V4CR80 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_109702 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.196e-50
Identity = 113/311 (36.33%), Postives = 189/311 (60.77%), Query Frame = 3
Query:  828 FDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEY-KDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQ 1757
             D + IR D   K   QP +L   T++P+++H++K+     +E+ +D   T  E+ +K ++VFPS  P SR+EV  L K L ++L      D  +D   V     +  ++ELI +   IYN++FHEL RQ      +RG ++  LR KY DL+ ++P ++  L  +V  Q   D+ LT ++  F+  I  LT +L E+KE DI+VT+ A+   ++L+ AL ++ ++  LL+EYH LY+LQ+QRL++ ++ + +E+E WS+ A++L++K+++E  L T+KRL +  K   +L+ HF I +SD DT L + IQ
Sbjct:  110 IDGSVIRNDFEEKPK-QPLQLP-DTLVPEEYHIVKNKGVLGIEFHEDKYSTHIEDHEKHLMVFPSMKPTSRYEVLQLKKVLDDLLEKIGANDTDVD---VRGPTQMHNLLELIKKEQNIYNVVFHELIRQTSVECAERGELLATLRKKYSDLLNRIPSQIKSLHEEVMAQRALDRRLTEELMRFKTTISILTSELTEIKEHDIRVTKEAQKAQEDLKYALSEAQKNASLLSEYHDLYELQRQRLEQQVSTLTSERELWSTAAYSLAMKVTEECQLTTAKRLHVSEKAWAKLAHHFTILLSDKDTELLTIIQ 415          
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Match: A0A3S1BDY7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006097 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.099e-49
Identity = 117/318 (36.79%), Postives = 195/318 (61.32%), Query Frame = 3
Query:  807 PPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEY-KDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQ 1757
            PPK     D +A+R  +   +  +P +L   T++PD++H++K+     ++Y  D   T  E+ +K ++VFPS  P SR+EV  L + L  ML      D  +D    +    +  +++LI +   IYN++FHEL RQ      +RG ++ ELR+KY DL+ ++P+++  L  +V  Q   D+ LT ++  F+  I  LT +L +VKE D KVT+ A+   ++L SAL +S ++  LL EYH LY+LQ++RL++ + +++ E+E WS+ A++L+LK+++E  LNT+KRL+L  K   +++ HF I +SD DT L +KIQ
Sbjct:  137 PPK-PDILDKSAVRKSD-GALPNKPLQLP-NTLLPDEYHIVKNKGVVGIDYHADRYSTKPEDHEKHLVVFPSMKPGSRYEVLQLKQALANMLDKAGVND--LDMEGGSGPTQMHNLLDLIKKEQNIYNVVFHELIRQTSVECVERGELLAELRSKYSDLLNKVPQQIMSLHEEVMAQRALDRRLTDELMRFKGTIGVLTSELTDVKEHDRKVTKEAQKAQEDLRSALIESQKNASLLAEYHDLYELQRRRLERQVFMLSEEREVWSTAAYSLALKVTEEYQLNTAKRLQLSEKGWVKMANHFTILLSDRDTDLLTKIQ 449          
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Match: C3Y2S2 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_271120 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.415e-44
Identity = 114/363 (31.40%), Postives = 209/363 (57.58%), Query Frame = 3
Query:  792 NRNTKPPKLTKFFDITAIRGDELNKINVQPEKLSIK-TMIPDKFHVMKDDSKSYLEYKDHEPTTKEEV-DKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKTMNNFYDLFHFLNDKFDSFT 1874
            ++   PP   K+ D ++IR D + +++   + +++  ++IPD++H++K      LEY D + TT ++  +K + +FPS  P  R+EV +L K + +ML      D   D+  V     +  ++ELI +   IYNIIFHEL RQ+     +RG ++  LR +Y  L+ ++P+++  L ++V  Q   D+ LT ++  F+ +I  LT +L +V+E D +VT  A+   ++L  AL +S ++  LL+EYH LY+LQ++RL+ H+  ++ E+E WS+ A+ L+LK+ + + L+T++RL +  K   +L+ HF I + D DT   + IQ         +TK + + +    N    F+ + +K  +++
Sbjct:  156 DKEPTPPTRDKY-DRSSIRADAVKEVD---KNIALPDSLIPDEYHIVKSKGVMGLEYHDDKFTTDKDDHEKHLTMFPSLRPSGRYEVVHLQKVMDDMLNKVGVED---DELEVKGPTQMHNLLELIRKEQKIYNIIFHELIRQVSVECSERGELLSNLRQRYATLLDKVPRQVKSLHAEVMAQRALDRRLTEELMRFKGSITSLTSELADVREHDRQVTREAQQAQEDLAVALTESEKNASLLSEYHDLYELQRRRLETHVIQLSEERELWSTAAYNLALKVIELNSLSTARRLYISEKAWCKLTSHFTILLGDKDTEELAIIQHHVETWRDLVTKFNLQLSAGDKNLKQKFNNMKEKLTAWS 511          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Cavefish
Match: axdnd1 (axonemal dynein light chain domain containing 1 [Source:NCBI gene;Acc:103025755])

HSP 1 Score: 128.642 bits (322), Expect = 9.467e-30
Identity = 89/330 (26.97%), Postives = 171/330 (51.82%), Query Frame = 3
Query:  891 SIKTMIPDKFHVMKDDSKSYLEYKDHEPTT--KEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSS----------KCLKQITKLHTETNKTMNNFYDLFH 1844
            SI T+IP+++H++K      L+  D + T   K++ +K  I FPS  P  R E   L + + +ML        + +   +     +  ++EL+     I+NI+FHEL RQ+     +RG ++ +LR +Y+ L+ ++P++L  L ++   Q   D+ L  +I  F+ +I  L E+L +++E D  V+  AE   +EL  AL+ S    +++ EYH LY++Q++RL+  +  +  E++ WS + ++++LK+     L    RL +  +   + + HF  +++  D+   + I  L+           K LK+I +   E  +T+ +    +H
Sbjct:  177 SIGTLIPEEYHLVKHKGLRGLQCYDEKFTVLLKDDENKFKI-FPSMKPSGRLEAVQLMRVMDDMLEKAG---VSQEFEELTGLSQMHGLLELVRVEQNIFNIVFHELIRQVSVECAERGQLLAKLRQRYVALLDRIPRQLKGLHTENLAQRALDRRLMEEIICFKHSITQLNEELSKLREHDDHVSSQAEKAQEELAKALEQSRHKSDMVEEYHKLYEMQRKRLEGQVATLTEERDLWSKITYSIALKVVKLKNLQLVSRLHVSEQTWSRTADHFTRFLTTKDSEDLNHIMQLTDQWREHLTSFMKKLKEIERNQCEVIRTIQSGIAKWH 502          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003307.1 (pep scaffold:Pmarinus_7.0:GL477417:7150:25215:1 gene:ENSPMAG00000003022.1 transcript:ENSPMAT00000003307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 1.834e-37
Identity = 91/314 (28.98%), Postives = 170/314 (54.14%), Query Frame = 3
Query:  861 NKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVD-KAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELR-NKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKL 1796
            N I  QP+++  +T IP++FH++++     L+ KD + TT  E D K M  FPS  P +R+EV  L + L   L         +    +     I  +++L+ Q   IYN +FHE+ RQ+     +RG ++ +LR  +Y  L+ ++P  ++ L  DV     + + L  Q+  FQ ++  +  +L  V+ERD +V   A+   ++L+  L +S R+  LL EYH +Y L + RL+  + V+  E++ W+S A AL+ ++++E  + T +RLR  ++    ++Q   + +S+ D  + ++++ L S   ++  +L
Sbjct:   65 NMIVAQPKEVLSETFIPEEFHIIQNHGVVGLQLKDSKYTTYLEDDEKNMRTFPSMRPMARNEVVELTRVLDTWLEK-------LGPMEIEGPTSIHSLLQLVQQEQCIYNAVFHEVIRQVSVQCMERGQLLAKLRWERYSSLLSRVPVLVAGLHGDVLATRAQHRRLMEQLTAFQTSVNRMASELSSVRERDGRVNAQAQREREDLKRVLNESRRNANLLEEYHSVYGLHRHRLESSMGVLQRERDGWASAALALASQLTEERSIVTVRRLRGHSQAWANVAQQHLLLLSNRDGSVVAEVRSLVSSWAEKAARL 371          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Nematostella
Match: EDO47152 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT0])

HSP 1 Score: 177.563 bits (449), Expect = 2.829e-47
Identity = 117/398 (29.40%), Postives = 200/398 (50.25%), Query Frame = 3
Query:  687 NDYIPLEIMNSLKNSLSTANNENLFPSST--KL------------------FSKGNRNTK-----PPKLTKFF-DIT----AIRGDELNKINVQPEKLSIK----------------TMIPDKFHVMKDDSKSYLEYKDHEPTTK-EEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTV 1739
            +D+IP++I+NSL    +    E L P S   KL                  + KG    K     PP L     DI+    A++  +  ++    EK+                   T++P ++H++K+     LE+ D + TT   + +  + VFPS  P  R EV  L   +  +L      D   D   +     I  ++EL+ +   IYN+ F+E+ RQ+     +RG ++ +LR +Y  L+ ++P+++  L  +V  Q   D+ LT ++  F+ +I  LT +L  VK  D +VT+ A    + LE AL +S ++  LL+EYH LY+LQ+ RL   +  +  E++ W S A+ L+LK++D+  LNT+K+L L  K   +L++HFAI++S+ D++
Sbjct:    1 SDFIPMDILNSLTQIPAPPTREQLGPPSKHKKLRPIEQVILTGHRPANVWNYPKGREKLKHLVEQPPCLCGAGKDISFLYDAVQEKQSPEVTKTLEKIPASVEREIQALDGSSQIPDTLLPSEYHIVKNPGVMGLEFHDEKYTTYVHDHEDHLTVFPSMKPSGRQEVLKLKHAMASLLARAGADD---DGKELTGPTQIHNLLELVKKEQNIYNVCFNEIIRQVTVECTERGELLADLRRRYSGLLDRIPRQVKSLHQEVIAQRALDRRLTEELVRFKASISALTGELASVKAHDREVTQQAIEAQRNLEEALHESEKNASLLSEYHGLYELQRNRLQAQIGSLTEERDLWGSAAYTLALKVTDKHSLNTAKKLHLCEKAWAKLARHFAIFLSEKDSI 395          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Nematostella
Match: EDO32969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ9])

HSP 1 Score: 59.6918 bits (143), Expect = 3.522e-10
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 3
Query: 1509 LLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHF 1709
            LL+EYH LY+LQ+ RL   +  +  E++ W S A+ L+LK++D+  LNT+K+L L  K L +    F
Sbjct:   24 LLSEYHGLYELQRNRLQAQIGSLTEERDLWGSAAYTLALKVTDKHSLNTAKKLHLCEKSLGKARAPF 90          
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Medaka
Match: ENSORLT00000010925.2 (pep primary_assembly:ASM223467v1:4:14252955:14257409:-1 gene:ENSORLG00000008702.2 transcript:ENSORLT00000010925.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 9.447e-14
Identity = 60/207 (28.99%), Postives = 101/207 (48.79%), Query Frame = 3
Query: 1026 PESRHEVKYLHKTLCEML--TNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESA-LQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISD 1637
            P SR E   L K + +ML     ++ +  + Q S      +  +  L+     IYN +FHEL RQ+     ++G V+ +LR +Y  L+ ++P+ L  L ++    TV  K+L           R LTE++  +K    +   +AE ++K      L D      +L  YH LY+L + RL+  L  +  E+ +WS L F+L+LK+ +
Sbjct:  140 PSSRKEAVELMKNMDDMLEKAGVDRQNEELSQLSQVGPAPL-WLTGLVKVEQNIYNTVFHELIRQVTVGCAEKGQVLAKLRQRYQALLDRIPRRLKALHTE----TVAQKSLG----------RRLTEEIHRIKSSLHR--RSAEILYKNSNCELLNDWDPFLSVLQRYHELYELLRTRLEAQLLQMTEERNNWSKLTFSLALKVGN 329          
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Match: SMESG000011832.1 (SMESG000011832.1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 409/409 (100.00%), Postives = 409/409 (100.00%), Query Frame = 3
Query:  660 MESEITNNNNDYIPLEIMNSLKNSLSTANNENLFPSSTKLFSKGNRNTKPPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKTMNNFYDLFHFLNDKFDSFTKLNL 1886
            MESEITNNNNDYIPLEIMNSLKNSLSTANNENLFPSSTKLFSKGNRNTKPPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKTMNNFYDLFHFLNDKFDSFTKLNL
Sbjct:    1 MESEITNNNNDYIPLEIMNSLKNSLSTANNENLFPSSTKLFSKGNRNTKPPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMKDDSKSYLEYKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLTNQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKTMNNFYDLFHFLNDKFDSFTKLNL 409          
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Match: SMESG000011833.1 (SMESG000011833.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 330/330 (100.00%), Postives = 330/330 (100.00%), Query Frame = 3
Query: 2088 MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQXXXXXXXXXXXXXXXXXXTLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQXXXXXXXXXXIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYESENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 3077
            MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQIENLKINNENNENIEFIITLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQFKEFSESFESIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYESENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD
Sbjct:    1 MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQIENLKINNENNENIEFIITLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQFKEFSESFESIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYESENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 330          
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Match: SMESG000011833.1 (SMESG000011833.1)

HSP 1 Score: 353.599 bits (906), Expect = 6.713e-115
Identity = 207/207 (100.00%), Postives = 207/207 (100.00%), Query Frame = 3
Query: 2088 MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQXXXXXXXXXXXXXXXXXXTLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQXXXXXXXXXXIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYE 2708
            MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQIENLKINNENNENIEFIITLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQFKEFSESFESIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYE
Sbjct:    1 MQHDFEANNNQPVIFSELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQIENLKINNENNENIEFIITLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVSFSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQFKEFSESFESIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYE 207          
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Match: SMESG000011833.1 (SMESG000011833.1)

HSP 1 Score: 241.891 bits (616), Expect = 1.509e-74
Identity = 123/125 (98.40%), Postives = 125/125 (100.00%), Query Frame = 3
Query: 2703 YESENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 3077
            ++SENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD
Sbjct:    7 FQSENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 131          
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Match: SMESG000011833.1 (SMESG000011833.1)

HSP 1 Score: 241.506 bits (615), Expect = 2.365e-74
Identity = 123/125 (98.40%), Postives = 125/125 (100.00%), Query Frame = 3
Query: 2703 YESENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 3077
            ++SENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD
Sbjct:   12 FQSENNLWTAVAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDSSMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDKLAVITAEYRELIKTD 136          
The following BLAST results are available for this feature:
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AXDND17.769e-3525.94axonemal dynein light chain domain containing 1 [S... [more]
AXDND17.769e-3525.94axonemal dynein light chain domain containing 1 [S... [more]
AXDND17.679e-3426.54axonemal dynein light chain domain containing 1 [S... [more]
AXDND19.621e-3425.52axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
axdnd13.369e-2829.83axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wsb14.424e-3530.22WD repeat and SOCS box containing 1 [Source:Xenbas... [more]
wsb12.305e-2733.17WD repeat and SOCS box containing 1 [Source:Xenbas... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Axdnd11.601e-3125.07axonemal dynein light chain domain containing 1 [S... [more]
Axdnd12.813e-3125.07axonemal dynein light chain domain containing 1 [S... [more]
Axdnd13.578e-3125.07axonemal dynein light chain domain containing 1 [S... [more]
Axdnd11.503e-1623.85axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5T1B0|AXDN1_HUMAN4.621e-3325.52Axonemal dynein light chain domain-containing prot... [more]
sp|Q95LP5|AXDN1_MACFA1.610e-3226.40Axonemal dynein light chain domain-containing prot... [more]
sp|Q3UZ57|AXDN1_MOUSE2.211e-1826.37Axonemal dynein light chain domain-containing prot... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HFQ72.325e-5140.20axonemal dynein light chain domain-containing prot... [more]
A0A1S3HE752.395e-5140.20axonemal dynein light chain domain-containing prot... [more]
V4CR805.196e-5036.33Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A3S1BDY71.099e-4936.79Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
C3Y2S21.415e-4431.40Uncharacterized protein (Fragment) OS=Branchiostom... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
axdnd19.467e-3026.97axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003307.11.834e-3728.98pep scaffold:Pmarinus_7.0:GL477417:7150:25215:1 ge... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471522.829e-4729.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329693.522e-1041.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000010925.29.447e-1428.99pep primary_assembly:ASM223467v1:4:14252955:142574... [more]
back to top
BLAST of Axonemal dynein light chain domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011832.10.000e+0100.00SMESG000011832.1[more]
SMESG000011833.10.000e+0100.00SMESG000011833.1[more]
SMESG000011833.16.713e-115100.00SMESG000011833.1[more]
SMESG000011833.11.509e-7498.40SMESG000011833.1[more]
SMESG000011833.12.365e-7498.40SMESG000011833.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032668 ID=SMED30032668|Name=Axonemal dynein light chain domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3154bp
CTATGTTAGATCGAGGTCGTTCATTCTTTAAAATGTCATCGTTTCGGGTG
AGAATCTACCTGCGTTTATCATACAATGGGTCTTAATTCCTGATAGGTAT
CGATCTGTATTCGACTCTCTAATGTATAATTTTAATTATCTATCCAATTG
AAATAATTATGTGCGCATTTCAACACTTTGTGAGTTTCTCGTGATCGTTC
AATGTCGAACCGGATGTTCGGACATGACATCACCATCGACATTCGGAGTG
ATTTTGAACCTGTCTATTCCTACGCAGTTACGATATCCGTTCGTACTTTA
CACCGGTATCTTTGATTATTGACGGGTTCATTATCGATCACAATTCAATA
GTTGACATTGGAATTATCGTAGGTATTTGTTCGAATTGGGTCTAGTTTTG
TACATTCATGTTTCTGCTGGATGGTCCTTATGTTATCAGGAGTCGGTACG
GTTGTATCATGGATTCATTGTTTGCTCTATGGGGTCTAAGGAGCTATAGC
GTTTGGGGAGTTGCTTGTGACAATTATTTGGATGTGATTGATCGTTTGCT
GTTTTCGATTCCGCACTTATATGAAATCAAATCGTGCCGTGAAGATTAAA
CAGTTGAAATCTATATCGTCAGTTATACTGGGATGAAATCAAAGAAATTA
ATGACAGCCATGGAAAGTGAAATCACAAATAATAATAACGACTACATTCC
TTTGGAAATAATGAATAGTTTAAAAAATTCATTAAGTACAGCTAATAATG
AAAATTTATTTCCTAGTTCAACCAAATTATTTTCAAAGGGTAATAGAAAT
ACTAAACCACCAAAATTAACAAAATTCTTCGATATCACAGCAATAAGGGG
TGATGAATTGAATAAGATCAATGTACAACCTGAAAAATTATCAATCAAAA
CGATGATTCCAGATAAATTTCACGTAATGAAAGATGATTCGAAATCATAT
TTGGAATATAAGGACCATGAACCAACAACCAAAGAAGAAGTGGACAAAGC
AATGATCGTATTTCCTTCAGAATTTCCTGAATCCCGGCATGAAGTGAAAT
ACCTCCATAAAACTCTTTGTGAAATGCTGACCAATCAGAACCAACCTGAT
TTTGCGATTGATCAATATTCCGTTGCTGATAGCGATGACATTGACGAGAT
GATTGAATTGATAATTCAATTAGACGGAATATATAATATTATTTTTCATG
AATTGGCTCGACAAATAATGTCATCATCTGAACAAAGGGGAAATGTTGTT
TTAGAATTAAGAAATAAATATATGGACCTCGTATGCCAATTACCAAAAGA
ACTCTCAAAATTAAAATCTGATGTGAAAGATCAAACGGTAAAAGATAAAA
ACCTTACAACTCAAATCGCAGAATTTCAAATGGCCATTCGATATTTAACA
GAGCAATTGAAAGAAGTAAAAGAACGAGACATAAAAGTAACAGAAAATGC
TGAAAATATTCACAAAGAACTTGAAAGTGCATTACAAGATTCATCGCGAA
GTAAAGAACTGTTAAATGAATACCATGTATTGTATGACCTACAAAAACAA
AGACTTGATAAGCATTTGACAGTTGTAAACAACGAAAAAGAAGATTGGAG
TTCTTTGGCATTTGCTCTATCCTTAAAAATATCGGATGAATCTTTATTGA
ACACAAGCAAGAGATTGAGATTAATAACTAAAAAATTATTTCAATTATCT
CAACATTTTGCAATTTATATTTCCGACTGTGACACAGTGTTGACTAGTAA
AATACAAGATTTATCCAGTAAATGCCTTAAACAAATAACTAAATTACATA
CTGAAACAAACAAAACAATGAATAACTTTTATGATTTATTTCATTTTCTC
AATGACAAATTTGATTCATTTACCAAGTTAAATTTAAACGAATCTAAAGT
TCATTTTAATATTATTGAGAATCATTTGAATTCTTTAAAATCATTTTTGG
CTGAAAGTTCATTGACAAGTATTTTTACTGATATTTCATCAGACAGTATA
TCAAATTATTGTTTAATCATTCAATCTGTCAATGATTTGGTAAAACAATT
GAGAGATAATGTTGTCAAAATATCCAATAGAACTGGAATGCAACATGATT
TTGAAGCCAATAATAATCAACCAGTGATTTTTTCTGAATTATTTGAGGAA
ATTGAAACATGGAATGATGAATTTACTTCTCGGTTAAATACAATTAGAAA
TTTCGATCCGTTTTTTAATGACATGAAATCATGTATTGCCAAAATTGAGT
TTCAAATCGAAAACCTTAAAATAAATAATGAAAATAATGAGAACATTGAA
TTTATCATTACACTGGTTAATGACTTATACCTGGAAATGTTTAACAGTGA
AGAATTAAAAGCAATTGAAAAAAACGAAGATTTTACTGAATTCAACAAAT
TCTACAATTCTACACAAATGGCATTGGTGTCATTCTCCAACCGAATCGAT
CGATTCGATTCTGAATTAATGGAAACTATTATAAATCAGCAGTCAACAAT
CACAACATGGATTATTGATGCACTTTTCTTATTTTCAAACATGGGCCTAA
CCGAGAATATTGAAATGCAATTTAAAGAATTTAGTGAAAGCTTTGAATCG
ATTGTGTCTGAAAATAATAAAATATTTCATTATACAATGGAATGTACAGA
GAAATTCAGTTTGGATTTTGATCGAGAAAACATTAAGATTGAAATGGACG
ATTATGAGAGTGAAAACAACCTGTGGACCGCTGTTGCTGAAATGCTGATA
AATGACATTGGAAATAAAATTAAAAAGGAATTGATAAATCGAAGAAGACA
AAGCGAAAAGTTAATTCAAGAAATGCCACTAGAAAGCTTATCTGAATTCC
TTGATGAAATAATCTTGAGATCGAACGATTCCAGTATGTACCTAGCTATT
GGGACCGTGAAAAATTTGCAAGCGGAAATCGATACCAATGTGATGAGGAT
CGCGTCAGCCAATGAAAAACAGTTATTACTTTCTGATACATTATTGGAGC
AGGACTCAAAGATCAAAGAATTAGAGGATAAATTAGCAGTGATAACTGCT
GAATATCGAGAATTGATTAAAACTGATTAAAAATTAAAACAATATCGAGT
TTTGACTTTAATTGATTTCCCCAATTTTCTAAATCATTTATATTATCAAG
ATCG
back to top

protein sequence of SMED30032668-orf-1

>SMED30032668-orf-1 ID=SMED30032668-orf-1|Name=SMED30032668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=816bp
MKSKKLMTAMESEITNNNNDYIPLEIMNSLKNSLSTANNENLFPSSTKLF
SKGNRNTKPPKLTKFFDITAIRGDELNKINVQPEKLSIKTMIPDKFHVMK
DDSKSYLEYKDHEPTTKEEVDKAMIVFPSEFPESRHEVKYLHKTLCEMLT
NQNQPDFAIDQYSVADSDDIDEMIELIIQLDGIYNIIFHELARQIMSSSE
QRGNVVLELRNKYMDLVCQLPKELSKLKSDVKDQTVKDKNLTTQIAEFQM
AIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVL
YDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITK
KLFQLSQHFAIYISDCDTVLTSKIQDLSSKCLKQITKLHTETNKTMNNFY
DLFHFLNDKFDSFTKLNLNESKVHFNIIENHLNSLKSFLAESSLTSIFTD
ISSDSISNYCLIIQSVNDLVKQLRDNVVKISNRTGMQHDFEANNNQPVIF
SELFEEIETWNDEFTSRLNTIRNFDPFFNDMKSCIAKIEFQIENLKINNE
NNENIEFIITLVNDLYLEMFNSEELKAIEKNEDFTEFNKFYNSTQMALVS
FSNRIDRFDSELMETIINQQSTITTWIIDALFLFSNMGLTENIEMQFKEF
SESFESIVSENNKIFHYTMECTEKFSLDFDRENIKIEMDDYESENNLWTA
VAEMLINDIGNKIKKELINRRRQSEKLIQEMPLESLSEFLDEIILRSNDS
SMYLAIGTVKNLQAEIDTNVMRIASANEKQLLLSDTLLEQDSKIKELEDK
LAVITAEYRELIKTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane