Activated rna polymerase ii transcriptional coactivator p15 like protein

Overview
NameActivated rna polymerase ii transcriptional coactivator p15 like protein
Smed IDSMED30032667
Length (bp)364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Activated rna polymerase ii transcriptional coactivator p15 like protein (SMED30032667) t-SNE clustered cells

Violin plots show distribution of expression levels for Activated rna polymerase ii transcriptional coactivator p15 like protein (SMED30032667) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Activated rna polymerase ii transcriptional coactivator p15 like protein (SMED30032667) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Activated rna polymerase ii transcriptional coactivator p15 like protein (SMED30032667) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032667

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032667 SmedASXL_018829SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032667 dd_Smed_v4_976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Match: SUB1 (SUB1 regulator of transcription [Source:HGNC Symbol;Acc:HGNC:19985])

HSP 1 Score: 76.2554 bits (186), Expect = 1.622e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Match: SUB1 (SUB1 regulator of transcription [Source:HGNC Symbol;Acc:HGNC:19985])

HSP 1 Score: 76.2554 bits (186), Expect = 1.622e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Match: SUB1 (SUB1 regulator of transcription [Source:HGNC Symbol;Acc:HGNC:19985])

HSP 1 Score: 76.2554 bits (186), Expect = 1.622e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Match: SUB1 (SUB1 regulator of transcription [Source:HGNC Symbol;Acc:HGNC:19985])

HSP 1 Score: 76.2554 bits (186), Expect = 1.622e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Match: SUB1 (SUB1 regulator of transcription [Source:HGNC Symbol;Acc:HGNC:19985])

HSP 1 Score: 76.2554 bits (186), Expect = 1.622e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Celegans
Match: T13F2.2 (Putative RNA polymerase II transcriptional coactivator [Source:UniProtKB/Swiss-Prot;Acc:Q94045])

HSP 1 Score: 59.3066 bits (142), Expect = 2.520e-12
Identity = 30/61 (49.18%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYY-SNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQ 317
            F IG+ +YA V KFK K +V+IREYY   D  ++ PS+KG+ L   QW+ LK  I +IDK+
Sbjct:   63 FEIGNLRYATVSKFKGKEYVNIREYYIDRDSQKMMPSRKGISLSKAQWANLKDLIPEIDKK 123          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Match: sub1b (SUB1 regulator of transcription b [Source:ZFIN;Acc:ZDB-GENE-040718-209])

HSP 1 Score: 74.7146 bits (182), Expect = 3.994e-18
Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP KKG+ L PEQWS LK  + DID  I+
Sbjct:   61 FQIGKLRYVSVRDFKGKVLIDIREYWMDQAGEMKPGKKGISLNPEQWSQLKEQMSDIDDAIK 122          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Match: sub1b (SUB1 regulator of transcription b [Source:ZFIN;Acc:ZDB-GENE-040718-209])

HSP 1 Score: 74.7146 bits (182), Expect = 3.994e-18
Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP KKG+ L PEQWS LK  + DID  I+
Sbjct:   61 FQIGKLRYVSVRDFKGKVLIDIREYWMDQAGEMKPGKKGISLNPEQWSQLKEQMSDIDDAIK 122          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Match: sub1b (SUB1 regulator of transcription b [Source:ZFIN;Acc:ZDB-GENE-040718-209])

HSP 1 Score: 74.7146 bits (182), Expect = 3.994e-18
Identity = 33/62 (53.23%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP KKG+ L PEQWS LK  + DID  I+
Sbjct:   61 FQIGKLRYVSVRDFKGKVLIDIREYWMDQAGEMKPGKKGISLNPEQWSQLKEQMSDIDDAIK 122          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Match: sub1a (SUB1 regulator of transcription a [Source:ZFIN;Acc:ZDB-GENE-050522-151])

HSP 1 Score: 72.0182 bits (175), Expect = 4.248e-17
Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQW+ LK  I +ID  ++
Sbjct:   60 FQIGKMRYVSVRDFKGKVLIDIREYWMDQEGEMKPGRKGISLNPEQWNQLKEQISEIDDAVK 121          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Match: sub1a (SUB1 regulator of transcription a [Source:ZFIN;Acc:ZDB-GENE-050522-151])

HSP 1 Score: 72.0182 bits (175), Expect = 4.248e-17
Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQW+ LK  I +ID  ++
Sbjct:   60 FQIGKMRYVSVRDFKGKVLIDIREYWMDQEGEMKPGRKGISLNPEQWNQLKEQISEIDDAVK 121          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Xenopus
Match: fam199x (family with sequence similarity 199, X-linked [Source:Xenbase;Acc:XB-GENE-965912])

HSP 1 Score: 75.0998 bits (183), Expect = 5.638e-18
Identity = 32/64 (50.00%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +D+REY+ +  GE+KP +KG+ L PEQW+ LK  + DID  IR L
Sbjct:   65 FQIGKMRYVSVRDFKGKVLIDVREYFMDQAGEMKPGRKGISLNPEQWNQLKEQMSDIDDAIRKL 128          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Mouse
Match: Sub1 (SUB1 homolog, transcriptional regulator [Source:MGI Symbol;Acc:MGI:104811])

HSP 1 Score: 73.1738 bits (178), Expect = 2.176e-17
Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L  EQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Mouse
Match: Sub1 (SUB1 homolog, transcriptional regulator [Source:MGI Symbol;Acc:MGI:104811])

HSP 1 Score: 73.1738 bits (178), Expect = 2.176e-17
Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L  EQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Match: sp|Q5R6D0|TCP4_PONAB (Activated RNA polymerase II transcriptional coactivator p15 OS=Pongo abelii OX=9601 GN=SUB1 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.790e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Match: sp|Q4R947|TCP4_MACFA (Activated RNA polymerase II transcriptional coactivator p15 OS=Macaca fascicularis OX=9541 GN=SUB1 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.790e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Match: sp|P53999|TCP4_HUMAN (Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 7.790e-18
Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Match: sp|Q5ZK63|TCP4_CHICK (Activated RNA polymerase II transcriptional coactivator p15 OS=Gallus gallus OX=9031 GN=SUB1 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.029e-17
Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQW+ LK  I DID  +R L
Sbjct:   63 FQIGKMRYVSVRDFKGKVLIDIREYWMDQEGEMKPGRKGISLNPEQWNQLKEQISDIDDAVRKL 126          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Match: sp|P11031|TCP4_MOUSE (Activated RNA polymerase II transcriptional coactivator p15 OS=Mus musculus OX=10090 GN=Sub1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 1.522e-16
Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L  EQWS LK  I DID  +R L
Sbjct:   64 FQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAVRKL 127          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Match: A0A131YAD2 (Putative transcriptional coactivator p15 OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.619e-19
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 3
Query:  123 DSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            D E  F +  K+Y  VR+FK +  VDIRE+Y +++G+LKP KKG+CL+ +QW+ LK HIDDID  IR
Sbjct:   46 DGEARFMLAKKRYLTVREFKGRVMVDIREFYEDNNGDLKPGKKGICLQLDQWNALKGHIDDIDAAIR 112          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Match: A0A0K8R661 (Putative transcriptional coactivator p15 OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.933e-19
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 3
Query:  123 DSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            D E  F +  K+Y  VR+FK +  VDIRE+Y +++G+LKP KKG+CL+ +QW+ LK HIDDID  IR
Sbjct:   46 DGEARFMLAKKRYLTVREFKGRVMVDIREFYEDNNGDLKPGKKGICLQLDQWNALKGHIDDIDAAIR 112          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Match: A0A131XJT0 (Putative activated rna polymerase ii transcriptional coactivator p15-like protein OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.121e-18
Identity = 38/68 (55.88%), Postives = 51/68 (75.00%), Query Frame = 3
Query:  123 DSELGFF-IGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            D+E G F +  K+Y  VR+F+ K  VDIREYY + +G+LKP KKG+CL+ +QW+ LK+HIDDID  IR
Sbjct:   44 DNEDGMFMLAKKRYVSVREFRGKVMVDIREYYEDGNGDLKPGKKGICLQLDQWNALKNHIDDIDAAIR 111          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Match: A0A224YQL5 (Activated rna polymerase ii transcriptional coactivator p15 like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.334e-18
Identity = 38/68 (55.88%), Postives = 51/68 (75.00%), Query Frame = 3
Query:  123 DSELGFF-IGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            D+E G F +  K+Y  VR+FK +  VDIREYY + +G+LKP KKG+CL+ +QW+ LK+HIDDID  IR
Sbjct:   44 DNEDGMFMLAKKRYVSVREFKGRVMVDIREYYEDGNGDLKPGKKGICLQLDQWNALKNHIDDIDAAIR 111          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Match: B7PB72 (Single-stranded DNA binding protein P9, putative OS=Ixodes scapularis OX=6945 GN=8027306 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.370e-18
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 3
Query:  123 DSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            D E  F +  K+Y  VR+FK +  VDIRE+Y +++G+LKP KKG+CL+ +QW+ LK HIDDID  IR
Sbjct:   46 DGEERFMLAKKRYLTVREFKGRVMVDIREFYEDNNGDLKPGKKGICLQLDQWNALKGHIDDIDAAIR 112          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Cavefish
Match: ENSAMXT00000032525.1 (activated RNA polymerase II transcriptional coactivator p15-like [Source:NCBI gene;Acc:103047074])

HSP 1 Score: 78.5666 bits (192), Expect = 1.215e-19
Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  GE+KP +KG+ L PEQW+ LK  IDDID+ +R
Sbjct:   63 FQIGKMRYVSVRDFKGKVLIDIREYWMDQEGEMKPGRKGISLNPEQWNQLKEQIDDIDEAVR 124          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Cavefish
Match: sub1b (SUB1 regulator of transcription [Source:NCBI gene;Acc:103047583])

HSP 1 Score: 73.9442 bits (180), Expect = 6.877e-18
Identity = 32/62 (51.61%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ +  G++KP KKG+ L PEQW+ LK  + DID  IR
Sbjct:   63 FQIGKMRYVSVRDFKGKVLIDIREYWMDQAGDMKPGKKGISLNPEQWNQLKEQMSDIDDAIR 124          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Yeast
Match: SUB1 (Transcriptional regulator; facilitates elongation through factors that modify RNAP II; role in peroxide resistance involving Rad2p; role in nonhomologous end-joining (NHEJ) of ds breaks in plasmid DNA, but not chromosomal DNA; role in the hyperosmotic stress response through polymerase recruitment at RNAP II and RNAP III genes; negatively regulates sporulation; protein abundance increases in response to DNA replication stress; functionally complemented by human SUB1 (PC4) [Source:SGD;Acc:S000004642])

HSP 1 Score: 52.7582 bits (125), Expect = 8.339e-10
Identity = 29/72 (40.28%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  117 LEDSELGFFIGDKKYAKVRKFKNKTFVDIREYY-SNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            L  S+  F +G  K   VR+F+N   +DIREYY  +  GE+KP KKG+ L  + +  L  H  +ID+ +R L
Sbjct:   34 LSASDAIFDLGKNKRVTVRQFRNINLIDIREYYLDSSTGEMKPGKKGISLTEDLYDELLKHRLNIDEALRRL 105          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Medaka
Match: sub1 (SUB1 regulator of transcription [Source:NCBI gene;Acc:100049295])

HSP 1 Score: 74.7146 bits (182), Expect = 4.470e-18
Identity = 32/62 (51.61%), Postives = 42/62 (67.74%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ N  GE+KP KKG+ L PEQW+ LK  + +ID+ I+
Sbjct:   62 FQIGKMRYVSVRDFKGKVLIDIREYWMNQDGEMKPGKKGISLNPEQWNQLKDQMSEIDEAIK 123          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Medaka
Match: sub1 (SUB1 regulator of transcription [Source:NCBI gene;Acc:100049295])

HSP 1 Score: 74.7146 bits (182), Expect = 4.470e-18
Identity = 32/62 (51.61%), Postives = 42/62 (67.74%), Query Frame = 3
Query:  138 FFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR 323
            F IG  +Y  VR FK K  +DIREY+ N  GE+KP KKG+ L PEQW+ LK  + +ID+ I+
Sbjct:   62 FQIGKMRYVSVRDFKGKVLIDIREYWMNQDGEMKPGKKGISLNPEQWNQLKDQMSEIDEAIK 123          
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Planmine SMEST
Match: SMESG000024368.1 (SMESG000024368.1)

HSP 1 Score: 177.563 bits (449), Expect = 4.264e-59
Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 3
Query:   24 MAPKRKSEKAXXXXXXXXXXXXXPVSKKKPQLEDSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 329
            MAPKRKSEKAEHESSDLSSLEDEPVSKKKPQLEDSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL
Sbjct:    1 MAPKRKSEKAEHESSDLSSLEDEPVSKKKPQLEDSELGFFIGDKKYAKVRKFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIRIL 102          
The following BLAST results are available for this feature:
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SUB11.622e-1853.13SUB1 regulator of transcription [Source:HGNC Symbo... [more]
SUB11.622e-1853.13SUB1 regulator of transcription [Source:HGNC Symbo... [more]
SUB11.622e-1853.13SUB1 regulator of transcription [Source:HGNC Symbo... [more]
SUB11.622e-1853.13SUB1 regulator of transcription [Source:HGNC Symbo... [more]
SUB11.622e-1853.13SUB1 regulator of transcription [Source:HGNC Symbo... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T13F2.22.520e-1249.18Putative RNA polymerase II transcriptional coactiv... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sub1b3.994e-1853.23SUB1 regulator of transcription b [Source:ZFIN;Acc... [more]
sub1b3.994e-1853.23SUB1 regulator of transcription b [Source:ZFIN;Acc... [more]
sub1b3.994e-1853.23SUB1 regulator of transcription b [Source:ZFIN;Acc... [more]
sub1a4.248e-1748.39SUB1 regulator of transcription a [Source:ZFIN;Acc... [more]
sub1a4.248e-1748.39SUB1 regulator of transcription a [Source:ZFIN;Acc... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam199x5.638e-1850.00family with sequence similarity 199, X-linked [Sou... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sub12.176e-1751.56SUB1 homolog, transcriptional regulator [Source:MG... [more]
Sub12.176e-1751.56SUB1 homolog, transcriptional regulator [Source:MG... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R6D0|TCP4_PONAB7.790e-1853.13Activated RNA polymerase II transcriptional coacti... [more]
sp|Q4R947|TCP4_MACFA7.790e-1853.13Activated RNA polymerase II transcriptional coacti... [more]
sp|P53999|TCP4_HUMAN7.790e-1853.13Activated RNA polymerase II transcriptional coacti... [more]
sp|Q5ZK63|TCP4_CHICK1.029e-1751.56Activated RNA polymerase II transcriptional coacti... [more]
sp|P11031|TCP4_MOUSE1.522e-1651.56Activated RNA polymerase II transcriptional coacti... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131YAD25.619e-1953.73Putative transcriptional coactivator p15 OS=Ixodes... [more]
A0A0K8R6615.933e-1953.73Putative transcriptional coactivator p15 OS=Ixodes... [more]
A0A131XJT01.121e-1855.88Putative activated rna polymerase ii transcription... [more]
A0A224YQL51.334e-1855.88Activated rna polymerase ii transcriptional coacti... [more]
B7PB721.370e-1853.73Single-stranded DNA binding protein P9, putative O... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000032525.11.215e-1953.23activated RNA polymerase II transcriptional coacti... [more]
sub1b6.877e-1851.61SUB1 regulator of transcription [Source:NCBI gene;... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SUB18.339e-1040.28Transcriptional regulator; facilitates elongation ... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sub14.470e-1851.61SUB1 regulator of transcription [Source:NCBI gene;... [more]
sub14.470e-1851.61SUB1 regulator of transcription [Source:NCBI gene;... [more]
back to top
BLAST of Activated rna polymerase ii transcriptional coactivator p15 like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024368.14.264e-59100.00SMESG000024368.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032667 ID=SMED30032667|Name=Activated rna polymerase ii transcriptional coactivator p15 like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=364bp
GTTTATATTATCAATTAATATAAATGGCACCTAAAAGAAAGTCAGAAAAA
GCTGAGCATGAGTCTTCTGATCTCAGTAGTCTAGAAGATGAACCTGTTAG
TAAAAAAAAGCCTCAACTAGAAGATAGTGAGTTGGGATTTTTTATAGGCG
ATAAGAAATATGCTAAAGTTCGTAAGTTTAAGAACAAAACATTCGTGGAT
ATTAGAGAATACTATTCCAATGATCATGGTGAGCTGAAACCATCGAAAAA
AGGTGTTTGTTTGAAACCTGAACAATGGTCTCTTCTAAAATCACACATTG
ATGATATTGATAAGCAAATTAGAATTCTTTGAAAGATTGATAATAAAATT
TTGTCATTGTCTTT
back to top

protein sequence of SMED30032667-orf-1

>SMED30032667-orf-1 ID=SMED30032667-orf-1|Name=SMED30032667-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MAPKRKSEKAEHESSDLSSLEDEPVSKKKPQLEDSELGFFIGDKKYAKVR
KFKNKTFVDIREYYSNDHGELKPSKKGVCLKPEQWSLLKSHIDDIDKQIR
IL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003713transcription coactivator activity
Vocabulary: INTERPRO
TermDefinition
IPR003173PC4
IPR009044ssDNA-bd_transcriptional_reg
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009044ssDNA-binding transcriptional regulatorGENE3DG3DSA:2.30.31.10coord: 38..102
e-value: 1.5E-25
score: 90.4
IPR009044ssDNA-binding transcriptional regulatorSUPERFAMILYSSF54447ssDNA-binding transcriptional regulator domaincoord: 41..100
IPR003173Transcriptional coactivator p15 (PC4)PFAMPF02229PC4coord: 41..90
e-value: 5.9E-21
score: 73.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availablePANTHERPTHR13215:SF0ACTIVATED RNA POLYMERASE II TRANSCRIPTIONAL COACTIVATOR P15coord: 7..100
NoneNo IPR availablePANTHERPTHR13215RNA POLYMERASE II TRANSCRIPTIONAL COACTIVATORcoord: 7..100