Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2

Overview
NameMacaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2
Smed IDSMED30032663
Length (bp)1794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 (SMED30032663) t-SNE clustered cells

Violin plots show distribution of expression levels for Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 (SMED30032663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 (SMED30032663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 (SMED30032663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Homology
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Match: zgc:158463 (zgc:158463 [Source:ZFIN;Acc:ZDB-GENE-070410-9])

HSP 1 Score: 132.88 bits (333), Expect = 4.069e-36
Identity = 75/125 (60.00%), Postives = 87/125 (69.60%), Query Frame = 2
Query: 1373 DFLEE*IAFS*MKLSNNRSVMPLDVRGRTRATMAVTASFIPS*KWPGNLLNHCRVRNSGLKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNGNISIIG--RRQSNLII 1741
            +FLE  +AFS  + SNNRSVMPLDVRG TRATM  +    P+ +  GN LN  R  + GLKLF +NEEF VSA H LALI SLPFVHTARRYYRL+GLVRS D   R  +    G  RR+SNLI+
Sbjct:   14 NFLEGQVAFSHARWSNNRSVMPLDVRGCTRATMGGSTCAYPAPRGAGNPLNPARDWDWGLKLFPINEEFPVSAGHKLALIKSLPFVHTARRYYRLDGLVRSSDRPRRGSSPGPGGAPRRRSNLIL 138          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Match: AL935186.10 (pep chromosome:GRCz11:4:77561226:77561679:-1 gene:ENSDARG00000115978.1 transcript:ENSDART00000180809.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL935186.10)

HSP 1 Score: 118.627 bits (296), Expect = 6.844e-31
Identity = 64/97 (65.98%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1391 IAFS*MKLSNNRSVMPLDVRGRTRATMAVTASFIPS*KWPGNLLNHCRVRNSGLKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLD 1681
            +AFS  +LSNNRSVMPLDVRG TRATM  +    P+    GN LN  R  + GLKLF  NEEF VSA H LALI SLPFVHTARRYYRL+G VRS D
Sbjct:   13 VAFSHARLSNNRSVMPLDVRGCTRATMGGSTCAYPAPTGAGNPLNPARDGDRGLKLFPENEEFPVSAGHQLALIKSLPFVHTARRYYRLSGSVRSSD 109          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Match: AL935186.6 (pep chromosome:GRCz11:CHR_ALT_CTG4_1_15:77561226:77561679:-1 gene:ENSDARG00000111118.1 transcript:ENSDART00000189523.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL935186.6)

HSP 1 Score: 118.627 bits (296), Expect = 6.844e-31
Identity = 64/97 (65.98%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1391 IAFS*MKLSNNRSVMPLDVRGRTRATMAVTASFIPS*KWPGNLLNHCRVRNSGLKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLD 1681
            +AFS  +LSNNRSVMPLDVRG TRATM  +    P+    GN LN  R  + GLKLF  NEEF VSA H LALI SLPFVHTARRYYRL+G VRS D
Sbjct:   13 VAFSHARLSNNRSVMPLDVRGCTRATMGGSTCAYPAPTGAGNPLNPARDGDRGLKLFPENEEFPVSAGHQLALIKSLPFVHTARRYYRLSGSVRSSD 109          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Match: BX548011.1 (pep chromosome:GRCz11:4:68567783:68568233:-1 gene:ENSDARG00000110028.1 transcript:ENSDART00000184284.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX548011.1)

HSP 1 Score: 115.931 bits (289), Expect = 5.519e-30
Identity = 62/97 (63.92%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1391 IAFS*MKLSNNRSVMPLDVRGRTRATMAVTASFIPS*KWPGNLLNHCRVRNSGLKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLD 1681
            +AFS  +LSNNRSVMPLDVRG TRATM  +    P+ +  GN L   R  + GL+LF LNEEF VSA H  ALI SLPFVHTARRYYRL+G VRS D
Sbjct:   13 VAFSHARLSNNRSVMPLDVRGCTRATMGGSTCAYPAPRGAGNPLKPARDWDRGLQLFPLNEEFPVSAGHQPALIKSLPFVHTARRYYRLSGTVRSSD 109          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Match: CT583728.18 (pep chromosome:GRCz11:4:55794876:55795326:1 gene:ENSDARG00000114100.1 transcript:ENSDART00000189043.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT583728.18)

HSP 1 Score: 115.931 bits (289), Expect = 5.914e-30
Identity = 62/97 (63.92%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1391 IAFS*MKLSNNRSVMPLDVRGRTRATMAVTASFIPS*KWPGNLLNHCRVRNSGLKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLD 1681
            +AFS  +LSNNRSVMPLDVRG TRATM  +    P+ +  GN L   R  + GL+LF LNEEF VSA H  ALI SLPFVHTARRYYRL+G VRS D
Sbjct:   13 VAFSHARLSNNRSVMPLDVRGCTRATMGGSTCAYPAPRGAGNPLKPARDWDRGLQLFPLNEEFPVSAGHQPALIKSLPFVHTARRYYRLSGTVRSSD 109          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Xenopus
Match: ENSXETT00000025836.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:88397208:88495673:1 gene:ENSXETG00000014084.1 transcript:ENSXETT00000025836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.924e-10
Identity = 29/34 (85.29%), Postives = 29/34 (85.29%), Query Frame = 1
Query:  388 REPEKRLPHPRKAAGA*ITQYRFGEVVTKNNNMG 489
            REPEKRLPHPRKAAGA IT  R GEVVTKNNN G
Sbjct:   14 REPEKRLPHPRKAAGAQITHSRRGEVVTKNNNTG 47          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Match: A0A078A2G4 (Uncharacterized protein OS=Stylonychia lemnae OX=5949 GN=Contig11071.g11842 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.791e-57
Identity = 96/180 (53.33%), Postives = 111/180 (61.67%), Query Frame = -1
Query:  823 LEHKCTI*QVRVSFVNGINQTNRSTN*ERPCTTTHRIKKELSICQSSQCPDRVRFPVLSQIKPQAPLLVVPFRQFL*VSALQPYFPRNP*T*VSR*LLARRFELPSRTVSWHSLWSELGRYLIVFDPLTFVLD**KHSWQMLSQ*TVC**SKNFTSSTSIHMPPAVSFNHYFSFENQQNK 1362
            L +  T  Q +VSFVNGINQTN STN ERPCTTTHRIKKELSICQSS C D V FPVLSQI+PQAPLLVVPFRQFL VSAL+PY P+NP T +S        ++P    +   L S +G   IV+     V +                 S+NFTS   I MPP +  NHYFS  NQQ +
Sbjct: 1171 LNNGSTSQQAKVSFVNGINQTNHSTNQERPCTTTHRIKKELSICQSSLCLDLVSFPVLSQIEPQAPLLVVPFRQFLQVSALRPYSPQNPKTLISH-------KVPKADKA--RLRSLVG---IVYGQDQDVFN----------------KSENFTSDNQILMPPTIPINHYFSPSNQQRR 1322          

HSP 2 Score: 63.5438 bits (153), Expect = 2.791e-57
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = -3
Query: 1523 QSVVATGGVYKGQGRNQRKLVTCAY*EFLVQVE*FQSTIPDTTVI 1657
            +SV ATGGVYKGQG NQRKL+TCAY EFLVQ   FQ +IP TT I
Sbjct: 1074 KSVGATGGVYKGQGLNQRKLMTCAYQEFLVQDLQFQRSIPITTHI 1118          

HSP 3 Score: 40.817 bits (94), Expect = 2.791e-57
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = -1
Query: 1729 IIPQVHLRKPCYDFYFL*MIKF 1794
            I+PQVHLRKPCYDF FL ++ F
Sbjct: 1032 ILPQVHLRKPCYDFSFLQVLWF 1053          

HSP 4 Score: 39.6614 bits (91), Expect = 2.791e-57
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -2
Query: 1416 ACGPGHLRASQTCYC 1460
            ACGPGHLRASQTCYC
Sbjct: 1139 ACGPGHLRASQTCYC 1153          

HSP 5 Score: 62.3882 bits (150), Expect = 6.909e-7
Identity = 34/49 (69.39%), Postives = 36/49 (73.47%), Query Frame = -2
Query:  345 GPILLFFVTTSPNRYWVIYAPAAFRGCGSRFSGSLSGIEH*FPVTRYNH 491
            GP  LF VTTS ++ WVIYAPAAF  CGSRFSGSLSGIE    VTR  H
Sbjct: 1402 GP--LFLVTTSLSQDWVIYAPAAFLRCGSRFSGSLSGIEPQSSVTRERH 1448          

HSP 6 Score: 21.9422 bits (45), Expect = 6.909e-7
Identity = 10/14 (71.43%), Postives = 11/14 (78.57%), Query Frame = -3
Query:  506 QLILDKVFKMFSLQ 547
            QLIL K FK +SLQ
Sbjct: 1382 QLILVKGFKFYSLQ 1395          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Match: J9HKN0 (Uncharacterized protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_14248 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.037e-54
Identity = 74/96 (77.08%), Postives = 79/96 (82.29%), Query Frame = -1
Query: 1096 SKKSAFALEHKCTI*QVRVSFVNGINQTNRSTN*ERPCTTTHRIKKELSICQSSQCPDRVRFPVLSQIKPQAPLLVVPFRQFL*VSALQPYFPRNP 1383
            SKKS   L +  T  Q +VSFVNGINQTN STN ERPCTTTHRIKKELSICQSS C D V FPVLSQI+PQAPLLVVPFRQFL VSAL+PY P+NP
Sbjct: 1242 SKKSC-PLSNGSTSQQAKVSFVNGINQTNHSTNQERPCTTTHRIKKELSICQSSLCLDLVSFPVLSQIEPQAPLLVVPFRQFLQVSALRPYSPQNP 1336          

HSP 2 Score: 63.929 bits (154), Expect = 1.037e-54
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = -3
Query: 1523 QSVVATGGVYKGQGRNQRKLVTCAY*EFLVQVE*FQSTIPDTTVI 1657
            +SV ATGGVYKGQG NQRKL+TCAY EFLVQ   FQ +IP TT I
Sbjct: 1151 KSVGATGGVYKGQGLNQRKLMTCAYQEFLVQDLQFQRSIPITTHI 1195          

HSP 3 Score: 41.5874 bits (96), Expect = 1.037e-54
Identity = 17/22 (77.27%), Postives = 19/22 (86.36%), Query Frame = -1
Query: 1729 IIPQVHLRKPCYDFYFL*MIKF 1794
            I+PQVHLRKPCYDF FL +I F
Sbjct: 1109 ILPQVHLRKPCYDFSFLQVIWF 1130          

HSP 4 Score: 36.965 bits (84), Expect = 1.037e-54
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -2
Query: 1416 ACGPGHLRASQTCYC 1460
            ACGPGHLRASQTCYC
Sbjct: 1216 ACGPGHLRASQTCYC 1230          

HSP 5 Score: 26.9498 bits (58), Expect = 1.037e-54
Identity = 16/36 (44.44%), Postives = 20/36 (55.56%), Query Frame = -2
Query: 1002 SPGTHRLRFPGDFSQGDLNYLRELSVGIVYGQN*DG 1109
            SP   +   P +  + D   LR L VGIVYGQ+ DG
Sbjct: 1332 SPQNPKTLNPQNPPKADKARLRSL-VGIVYGQDQDG 1366          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Match: J9I0R4 (Uncharacterized protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_13058 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.232e-53
Identity = 76/102 (74.51%), Postives = 82/102 (80.39%), Query Frame = -1
Query: 1078 SKKSAFALEHKCTI*QVRVSFVNGINQTNRSTN*ERPCTTTHRIKKELSICQSSQCPDRVRFPVLSQIKPQAPLLVVPFRQFL*VSALQPYFPRNP*T*VSR 1383
            SKKS   L +  T  Q +VSFVNGINQTN STN ERPCTTTHRIKKELSICQSS C D V FPVLSQI+PQAPLLVVPFRQFL VSAL+PY P+NP T +S 
Sbjct: 1242 SKKSC-PLSNGSTSQQAKVSFVNGINQTNHSTNQERPCTTTHRIKKELSICQSSLCLDLVSFPVLSQIEPQAPLLVVPFRQFLQVSALRPYSPQNPKTLISH 1342          

HSP 2 Score: 63.929 bits (154), Expect = 5.232e-53
Identity = 33/45 (73.33%), Postives = 36/45 (80.00%), Query Frame = -3
Query: 1523 QSVVATGGVYKGQGRNQRKLVTCAY*EFLVQVE*FQSTIPDTTVI 1657
            +SV ATGGVYKGQG NQRKL+TCAY EFLVQ   FQ +IP TT I
Sbjct: 1151 KSVGATGGVYKGQGLNQRKLMTCAYQEFLVQDLQFQRSIPITTHI 1195          

HSP 3 Score: 41.5874 bits (96), Expect = 5.232e-53
Identity = 17/22 (77.27%), Postives = 19/22 (86.36%), Query Frame = -1
Query: 1729 IIPQVHLRKPCYDFYFL*MIKF 1794
            I+PQVHLRKPCYDF FL +I F
Sbjct: 1109 ILPQVHLRKPCYDFSFLQVIWF 1130          

HSP 4 Score: 36.965 bits (84), Expect = 5.232e-53
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = -2
Query: 1416 ACGPGHLRASQTCYC 1460
            ACGPGHLRASQTCYC
Sbjct: 1216 ACGPGHLRASQTCYC 1230          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Match: A0A0R0GH50 (Uncharacterized protein OS=Glycine max OX=3847 GN=GLYMA_13G012500 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.766e-46
Identity = 69/151 (45.70%), Postives = 78/151 (51.66%), Query Frame = 1
Query: 1243 LFLDSVGGGAWPFLVGGAICLVNSVNERDSNLLNSTFVF*RKC*LLRGINSV*LNEIEQ*QVCDALRCPGPHARYNGSNSEFYS*LEMAG*PAKSLSCQE*WIEIIPLERGIPSKRKSLACADYVPALCTHRPSLLPIEWFSEIVGF*FKE 1695
            LFLDS+GGGAWPFLVGGAICLVNSVNERD +LLNS         LLRG  ++                                                  I I+ L+RGIPSKR+S A  DYVPALCTHRPSLLPIEW  E+ G   +E
Sbjct:  235 LFLDSMGGGAWPFLVGGAICLVNSVNERDLSLLNSYVEVTLHGQLLRGTMAI--------------------------------------------------IAIVGLQRGIPSKRESSARVDYVPALCTHRPSLLPIEWSGEVFGLRRRE 335          

HSP 2 Score: 88.5817 bits (218), Expect = 2.766e-46
Identity = 60/89 (67.42%), Postives = 67/89 (75.28%), Query Frame = 3
Query:  924 QSTAKAFAKNVFINQERKSEDRRRSDTVLVLTINYAN*QFAKVIQISLREVTGKPKXXXXXXXXVAKLKLKGIDGRAPPGVEPAA*FDS 1190
            ++TAKAFAK+VFINQERK   RRRSDTVLV TIN A+   A V   +      K KS+GSGGSMVA+LKLKGIDGRAPPGVEPA   DS
Sbjct:  151 RTTAKAFAKDVFINQERKLGARRRSDTVLVSTINDADQGSADVAFRTPLAPYEKSKSLGSGGSMVARLKLKGIDGRAPPGVEPALFLDS 239          

HSP 3 Score: 36.1946 bits (82), Expect = 2.766e-46
Identity = 24/59 (40.68%), Postives = 26/59 (44.07%), Query Frame = 1
Query:  718 WVLRMTDKFTLKKLECLKQAYACILLHGIIK*DFGFILLVFETEVMIKRDCRGHMYAGA 894
            W  R +   TLKKLEC KQ             D   I+L F   VMI RD RG   A A
Sbjct:  111 WPGRASGAVTLKKLECSKQ-------------DSDPIVLAFGIGVMINRDSRGRTTAKA 156          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Match: A0A3Q7YGQ3 (uncharacterized protein LOC113787721 OS=Cicer arietinum OX=3827 GN=LOC113787721 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 5.531e-46
Identity = 68/147 (46.26%), Postives = 76/147 (51.70%), Query Frame = 1
Query: 1243 LFLDSVGGGAWPFLVGGAICLVNSVNERDSNLLNSTFVF*RKC*LLRGINSV*LNEIEQ*QVCDALRCPGPHARYNGSNSEFYS*LEMAG*PAKSLSCQE*WIEIIPLERGIPSKRKSLACADYVPALCTHRPSLLPIEWFSEIVGF 1683
            LFLDS+GGGAWPFLVGGAICLVNSVNERD +LLNS         LLRG  ++                                                  I I+ L+RGIPSKR+S A  DYVPALCTHRPSLLPIEW  E+ G 
Sbjct:  156 LFLDSMGGGAWPFLVGGAICLVNSVNERDLSLLNSYVEVTLHGQLLRGTMAI--------------------------------------------------IAIVGLKRGIPSKRESSARVDYVPALCTHRPSLLPIEWSGEVFGL 252          

HSP 2 Score: 86.6557 bits (213), Expect = 5.531e-46
Identity = 59/89 (66.29%), Postives = 66/89 (74.16%), Query Frame = 3
Query:  924 QSTAKAFAKNVFINQERKSEDRRRSDTVLVLTINYAN*QFAKVIQISLREVTGKPKXXXXXXXXVAKLKLKGIDGRAPPGVEPAA*FDS 1190
            ++TAK FAK+VFINQERK   RRRSDTVLV TIN A+   A V   +      K KS+GSGGSMVA+LKLKGIDGRAPPGVEPA   DS
Sbjct:   72 RTTAKTFAKDVFINQERKLGARRRSDTVLVSTINDADQGSADVAFRTPLAPYEKSKSLGSGGSMVARLKLKGIDGRAPPGVEPALFLDS 160          

HSP 3 Score: 39.2762 bits (90), Expect = 5.531e-46
Identity = 24/57 (42.11%), Postives = 26/57 (45.61%), Query Frame = 1
Query:  718 WVLRMTDKFTLKKLECLKQAYACILLHGIIK*DFGFILLVFETEVMIKRDCRGHMYA 888
            W  R     TLKKLEC KQ             D+G I+L F   VMI RD RG   A
Sbjct:   32 WPSRTFGAVTLKKLECSKQ-------------DYGPIVLAFGIGVMINRDSRGRTTA 75          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Match: EDO32480 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPZ7])

HSP 1 Score: 75.8702 bits (185), Expect = 2.472e-17
Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 2
Query: 1550 LKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNG 1699
            L+L  LNEEFLVSASH LALITSLPFVHTARRYYRLNGLVR   SD R G
Sbjct:    3 LQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRP--SDWRRG 50          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Match: EDO32586 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPZ7])

HSP 1 Score: 75.8702 bits (185), Expect = 2.472e-17
Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 2
Query: 1550 LKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNG 1699
            L+L  LNEEFLVSASH LALITSLPFVHTARRYYRLNGLVR   SD R G
Sbjct:    3 LQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRP--SDWRRG 50          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Match: EDO34225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPZ7])

HSP 1 Score: 75.8702 bits (185), Expect = 2.472e-17
Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 2
Query: 1550 LKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNG 1699
            L+L  LNEEFLVSASH LALITSLPFVHTARRYYRLNGLVR   SD R G
Sbjct:    3 LQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRP--SDWRRG 50          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Match: EDO26390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC51])

HSP 1 Score: 75.8702 bits (185), Expect = 2.496e-17
Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 2
Query: 1550 LKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNG 1699
            L+L  LNEEFLVSASH LALITSLPFVHTARRYYRLNGLVR   SD R G
Sbjct:    3 LQLLILNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRP--SDWRRG 50          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Match: EDO32479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY8])

HSP 1 Score: 74.3294 bits (181), Expect = 8.122e-17
Identity = 40/50 (80.00%), Postives = 41/50 (82.00%), Query Frame = 2
Query: 1550 LKLFHLNEEFLVSASH*LALITSLPFVHTARRYYRLNGLVRSLDSDLRNG 1699
            L+L   NEEFLVSASH LALITSLPFVHTARRYYRLNGLVR   SD R G
Sbjct:    3 LQLLIFNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVRP--SDWRRG 50          
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Planmine SMEST
Match: SMESG000078439.1 (SMESG000078439.1)

HSP 1 Score: 54.299 bits (129), Expect = 2.139e-7
Identity = 27/30 (90.00%), Postives = 28/30 (93.33%), Query Frame = 2
Query: 1652 RLNGLVRSLDSDLRNGNISIIGRRQSNLII 1741
            RLNGLVRS DSDLR GNISIIGRRQSNLI+
Sbjct:  491 RLNGLVRSSDSDLREGNISIIGRRQSNLIM 520          
The following BLAST results are available for this feature:
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1584634.069e-3660.00zgc:158463 [Source:ZFIN;Acc:ZDB-GENE-070410-9][more]
AL935186.106.844e-3165.98pep chromosome:GRCz11:4:77561226:77561679:-1 gene:... [more]
AL935186.66.844e-3165.98pep chromosome:GRCz11:CHR_ALT_CTG4_1_15:77561226:7... [more]
BX548011.15.519e-3063.92pep chromosome:GRCz11:4:68567783:68568233:-1 gene:... [more]
CT583728.185.914e-3063.92pep chromosome:GRCz11:4:55794876:55795326:1 gene:E... [more]
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000025836.11.924e-1085.29pep primary_assembly:Xenopus_tropicalis_v9.1:7:883... [more]
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A078A2G42.791e-5753.33Uncharacterized protein OS=Stylonychia lemnae OX=5... [more]
J9HKN01.037e-5477.08Uncharacterized protein OS=Oxytricha trifallax OX=... [more]
J9I0R45.232e-5374.51Uncharacterized protein OS=Oxytricha trifallax OX=... [more]
A0A0R0GH502.766e-4645.70Uncharacterized protein OS=Glycine max OX=3847 GN=... [more]
A0A3Q7YGQ35.531e-4646.26uncharacterized protein LOC113787721 OS=Cicer arie... [more]
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO324802.472e-1782.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325862.472e-1782.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342252.472e-1782.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263902.496e-1782.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324798.122e-1780.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078439.12.139e-790.00SMESG000078439.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032663 ID=SMED30032663|Name=Macaca fascicularis brain cDNA clone: QflA-20247, similar to human stathmin-like 2 (STMN2), mRNA, RefSeq: NM_007029.2|organism=Schmidtea mediterranea sexual|type=transcript|length=1794bp
CTGGTTGATCCTGCCAGTAGTCATATGCTTATCTCAAAGATTAAGCCATG
CATGTCTTAGTACACAGACTAGTACTCTGAAACCGCGGATGGCTCATTAT
AACAGCTATGATTTGAGAGATTTTATCATTTTGCCACAAGATAACTGTGG
TAATTCTAGAGCTAATATTTTTAAGAATGCCGTGACTCACGAAGCGGCGG
ATTTATTAGATCAAAATCAACCCGCTGAAAGGCGGTATTTTGATGACTCT
GGATAATTTTACTGATCGTACGACCTTTGTGTTGACGACATATCTCTTGA
AGTGGCTGACCTATCAACTTTCGATGGTAAGATAAACGCTTACCATGGTT
GTAACGGGTAACGGGGAATCAGTGTTCGATTCCGGAGAGGGAGCCTGAGA
AACGGCTACCACATCCACGGAAGGCAGCAGGCGCGTAAATTACCCAATAC
CGGTTCGGTGAGGTAGTGACAAAAAATAACAATATGGGCCCTAGTGGTTT
CATAATTGCAATGAGAACATTTTAAATACTTTATCAAGTATCAATTGGAG
GGCAAGTCTGGTGCCAGCAGCCGCGGTAATTCCAGCTCCAATAGCGTATA
TTAAAGTTGTTGCAGTTAAAAAGCTCGTAGTTGAAATTGAGGAAAAAGAT
GGTTTGAAATCTATGATTGAGAGCTATCTTGTCCTTCGAAGTCGTGTATA
TCTTTGATGCTCTTTAATGGGTGTTGAGGATGACCGACAAGTTTACTTTG
AAAAAATTAGAGTGCTTAAAGCAGGCTTACGCTTGTATATTGTTGCATGG
AATAATAAAATAGGACTTCGGTTTTATTTTGTTGGTTTTCGAAACTGAAG
TAATGATTAAAAGAGACTGCCGGGGGCATATGTATGCTGGTGCTAGAGGT
GAAATTCTTAGATCATCAGCAGACAGTCTACTGCGAAAGCATTTGCCAAG
AATGTTTTCATTAATCAAGAACGAAAGTCAGAGGATCGAAGACGATCAGA
TACCGTCCTAGTTCTGACCATAAACTATGCCAACTGACAGTTCGCGAAGG
TAATTCAAATCTCCTTGCGAGAAGTCACCGGGAAACCTAAGTCTATGGGT
TCCGGGGGAAGTATGGTTGCAAAGCTGAAACTTAAAGGAATTGACGGAAG
GGCACCACCAGGAGTGGAGCCTGCGGCTTAATTTGACTCAACACGGGAAA
TCTCACCCGGTCCGGACACTGTGAGGATTGACAGATTGATAGCTCTTTCT
TGATTCGGTGGGTGGTGGTGCATGGCCGTTCTTAGTTGGTGGAGCGATTT
GTCTGGTTAATTCCGTTAACGAACGAGACTCTAACCTGCTAAATAGTACA
TTTGTGTTCTAACGCAAATGCTGACTTCTTAGAGGAATAAATAGCGTTTA
GCTAAATGAAATTGAGCAATAACAGGTCTGTGATGCCCTTAGATGTCCGG
GGCCGCACGCGCGCTACAATGGCAGTAACAGCGAGTTTTATTCCTAGCTA
GAAATGGCCGGGTAACCTGCTAAATCACTGTCGTGTCAGGAATAGTGGAT
TGAAATTATTCCACTTGAACGAGGAATTCCTAGTAAGCGCAAGTCACTAG
CTTGCGCTGATTACGTCCCTGCCCTTTGTACACACCGCCCGTCGCTACTA
CCGATTGAATGGTTTAGTGAGATCGTTGGATTCTGATTTAAGGAATGGCA
ACATTTCTATAATTGGGAGAAGACAATCAAACTTGATCATTTAGAGGAAG
TAAAAGTCGTAACAAGGTTTCCGTAGGTGAACCTGCGGAATGAT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0002111X2 cell
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.609