Peptidase_M14 domain-containing protein

Overview
NamePeptidase_M14 domain-containing protein
Smed IDSMED30032659
Length (bp)1401
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase_M14 domain-containing protein (SMED30032659) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase_M14 domain-containing protein (SMED30032659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase_M14 domain-containing protein (SMED30032659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase_M14 domain-containing protein (SMED30032659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30032659SMESG000056472.1 SmedASXL_012781SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30032659SMESG000056472.1 dd_Smed_v4_5999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032659SMESG000056472.1 dd_Smed_v4_5999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032659SMESG000056472.1 dd_Smed_v4_5999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032659SMESG000056472.1 dd_Smed_v4_5999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032659SMESG000056472.1 Contig39688newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032659SMESG000056472.1 Contig39688uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032659SMESG000056472.1 dd_Smed_v6_5999_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30032659SMESG000056472.1 Contig39688newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30032659SMESG000056472.1 Contig39688uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30032659SMESG000056472.1 dd_Smed_v6_5999_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPO (carboxypeptidase O [Source:HGNC Symbol;Acc:HGNC:21011])

HSP 1 Score: 212.231 bits (539), Expect = 1.018e-63
Identity = 115/303 (37.95%), Postives = 182/303 (60.07%), Query Frame = 2
Query:  386 SISYYMRFVEIKLWL---NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKP--ILWIDAGIHAREWISPSTAIFLINKLLENDKNSM---KLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            S + Y    EI  W+   +EK ++V       LG + E   +  +K+S+    P  I+W+D GIHAREWI+P+   + + ++L+N K++    KLL +   Y+LP+LN DGY YT   +R+WRK+R   +   C G DLNRN+   W   GAS +   + F G+ P SE ETKAV + +   K ++  F+T+HS+GQ I++PYGY+KN+    + +++ +G   ++ L+  YG  Y+VGSSA++LY +SG+S D+A  ++ IP+SYT EL D G YGF+LP   IQ    +    ++   +++
Sbjct:   46 SYNIYHPMGEIYEWMREISEKYKEVVTQHF--LGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNK-SSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGSSRDWAR-DIGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDV 344          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA2 (carboxypeptidase A2 [Source:HGNC Symbol;Acc:HGNC:2297])

HSP 1 Score: 212.616 bits (540), Expect = 2.320e-63
Identity = 124/350 (35.43%), Postives = 195/350 (55.71%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKND----LDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            VK FL+++ +++ IM  D    LD++ + E L NRR+      +R+   +   Y    EI   + N  A     +    +G S ENR + ++K S    KP +W+DAGIHAREW++ +TA++  NK++ +   D +   +L+   I++LP+ NPDGY ++   NRMWRK R   S   C GVD NRN+   +G  GAS +PCS  + G S +SE E K++++   +    VK FITLHS+ Q +M PYGY   +    + +L  +    +  L+ ++G  Y+VG   +++Y+ASG S D++  +  I YS+  EL D GRYGFLLP   I     + +  L    E++ +
Sbjct:   77 VKVFLESQGIAYSIMIEDVQVLLDKENE-EMLFNRRR------ERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVD-FIKSHGKVKAFITLHSYSQLLMFPYGYKCTKL-DDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSY-DYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRD 416          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA1 (carboxypeptidase A1 [Source:HGNC Symbol;Acc:HGNC:2296])

HSP 1 Score: 208.379 bits (529), Expect = 9.257e-62
Identity = 130/415 (31.33%), Postives = 221/415 (53.25%), Query Frame = 2
Query:   65 AKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKA---FLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEI----KLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSK-PILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
             K+ F+   V++I   + + + +++E+    DL H   L L         G  +  ++ F  ++A   FL++  +S+E M  D+   +  EQ   +   F+++ + TD  + + Y    EI     L + E    VS +++   G++ E R I ++K S   SK P +WID GIH+REW++ ++ ++   K+ ++   D     +L+   I++  + NPDG+ +TH  NRMWRK R  T+   C GVD NRN+   +G +GAS +PCS  + G   +SE E K++++ + +   N+K FI++HS+ Q +M PYGY     P Q  +L  +  +  + L  +YG  +  GS    +Y+ASG++ D+   +  I YS+T EL D GRYGFLLP + I     + +  L+   E+  N
Sbjct:   16 GKEDFVGHQVLRISVADEAQVQKVKELE---DLEH---LQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQ--EQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQI---GNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKD-HGNIKAFISIHSYSQLLMYPYGYKTEPVPDQ-DELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQ-GIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLN 416          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA5 (carboxypeptidase A5 [Source:HGNC Symbol;Acc:HGNC:15722])

HSP 1 Score: 198.364 bits (503), Expect = 9.079e-58
Identity = 137/431 (31.79%), Postives = 225/431 (52.20%), Query Frame = 2
Query:   23 IIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSE---VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY--YMRFVEIKLWLN----EKARQVSFMKLETLGHSEENREIILVKMSKDDSK-PILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            ++++S + +A     + +F  D V+++  ++   LS L      GDL       +       +  L +  ++ FSE   +KA+L++  +++ IM  D+   +  E    R+   K++       S SY  Y    EI  W++    E +  VS +++   G+S EN+ I+++K S   S+ P +WID GIH+REWI+ +T I+  NK++ +   D+    +L    I+I  + NPDG+ +TH +NR+WRKN+       C GVDLNRN+   +G NG++ +PCS  + G SP SE E  A++N +T    N K  I++HS+ Q +M PYG        Q  +L  +       L +++G  Y  GS +  LY ASG + D+A  +  I Y+++ EL D G+YGFLLP T I     + +  L    E+  N
Sbjct:   21 LLVFSFILAA--ALGQMNFTGDQVLRVLAKDEKQLSLL------GDLEGLKPQKVDFWRGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEE----RQAMAKSRRLERSTNSFSYSSYHTLEEIYSWIDNFVMEHSDIVSKIQI---GNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTANKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGGNGSNSNPCSETYHGPSPQSEPEVAAIVNFITA-HGNFKALISIHSYSQMLMYPYGRLLEPVSNQ-RELYDLAKDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAY-DSGIKYAFSFELRDTGQYGFLLPATQIIPTAQETWMALRTIMEHTLN 433          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Match: CPA5 (carboxypeptidase A5 [Source:HGNC Symbol;Acc:HGNC:15722])

HSP 1 Score: 198.364 bits (503), Expect = 9.079e-58
Identity = 137/431 (31.79%), Postives = 225/431 (52.20%), Query Frame = 2
Query:   23 IIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSE---VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY--YMRFVEIKLWLN----EKARQVSFMKLETLGHSEENREIILVKMSKDDSK-PILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            ++++S + +A     + +F  D V+++  ++   LS L      GDL       +       +  L +  ++ FSE   +KA+L++  +++ IM  D+   +  E    R+   K++       S SY  Y    EI  W++    E +  VS +++   G+S EN+ I+++K S   S+ P +WID GIH+REWI+ +T I+  NK++ +   D+    +L    I+I  + NPDG+ +TH +NR+WRKN+       C GVDLNRN+   +G NG++ +PCS  + G SP SE E  A++N +T    N K  I++HS+ Q +M PYG        Q  +L  +       L +++G  Y  GS +  LY ASG + D+A  +  I Y+++ EL D G+YGFLLP T I     + +  L    E+  N
Sbjct:   21 LLVFSFILAA--ALGQMNFTGDQVLRVLAKDEKQLSLL------GDLEGLKPQKVDFWRGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEE----RQAMAKSRRLERSTNSFSYSSYHTLEEIYSWIDNFVMEHSDIVSKIQI---GNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTANKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGGNGSNSNPCSETYHGPSPQSEPEVAAIVNFITA-HGNFKALISIHSYSQMLMYPYGRLLEPVSNQ-RELYDLAKDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAY-DSGIKYAFSFELRDTGQYGFLLPATQIIPTAQETWMALRTIMEHTLN 433          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.1 (pep chromosome:WBcel235:I:770892:776369:1 gene:WBGene00020281.1 transcript:T06A4.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.1)

HSP 1 Score: 236.498 bits (602), Expect = 4.573e-71
Identity = 136/356 (38.20%), Postives = 205/356 (57.58%), Query Frame = 2
Query:  263 LKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQG-SISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKD----DSKPILWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVST-------SYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYK-LMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGR---YGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            L+++ +S+ +  NDL + I+ E+  +       KF     G +   Y    EI+  +   K    + + L  +G S ENR ++++K++       SK  +WIDAGIHAREWI+P+TA+++ ++LL   END    KL++    YILP++NPDGYEY+ E NRMWRKNR          S   C GVDLNRN+ + W   G+S DPC   + GS+  SE E++AV + L +     + FI+LHS+ Q  + PYG+ K  +P+ Y+  L  +    +  L E+YG  YQVG+ A+L+YEASG S D+A G+L++PY+Y IEL  +     +GFLLP   I   G + F ++    + L
Sbjct:   89 LESKKISYIVAVNDLSKAIENERGSD-------KFYNPVAGFAYDKYNSLEEIQTEMKRLKKEYPTMITLIDIGQSHENRTLLVMKITGKRNPLGSKISMWIDAGIHAREWIAPATAMYIAHELLLGYENDATVAKLMDHIDFYILPVMNPDGYEYSREKNRMWRKNRSPAKCARQTFSTVCCSGVDLNRNFDWFWASTGSSSDPCHDTYHGSAAFSEPESQAVRDFLEQ--NTPEAFISLHSYSQMWLIPYGHRKQSYPQDYHTGLRPLALRATKALYELYGTKYQVGTGADLMYEASGGSHDWAKGQLKVPYAYLIELRPKNTMMGHGFLLPEREIVPTGLETFESIKVVADEL 435          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.1 (pep chromosome:WBcel235:I:773162:776369:1 gene:WBGene00020281.1 transcript:T06A4.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.1)

HSP 1 Score: 223.402 bits (568), Expect = 7.459e-68
Identity = 113/257 (43.97%), Postives = 160/257 (62.26%), Query Frame = 2
Query:  542 LWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVST-------SYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYK-LMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGR---YGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            +WIDAGIHAREWI+P+TA+++ ++LL   END    KL++    YILP++NPDGYEY+ E NRMWRKNR          S   C GVDLNRN+ + W   G+S DPC   + GS+  SE E++AV + L +     + FI+LHS+ Q  + PYG+ K  +P+ Y+  L  +    +  L E+YG  YQVG+ A+L+YEASG S D+A G+L++PY+Y IEL  +     +GFLLP   I   G + F ++    + L
Sbjct:    1 MWIDAGIHAREWIAPATAMYIAHELLLGYENDATVAKLMDHIDFYILPVMNPDGYEYSREKNRMWRKNRSPAKCARQTFSTVCCSGVDLNRNFDWFWASTGSSSDPCHDTYHGSAAFSEPESQAVRDFLEQ--NTPEAFISLHSYSQMWLIPYGHRKQSYPQDYHTGLRPLALRATKALYELYGTKYQVGTGADLMYEASGGSHDWAKGQLKVPYAYLIELRPKNTMMGHGFLLPEREIVPTGLETFESIKVVADEL 255          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: F02D8.4 (pep chromosome:WBcel235:V:14984893:14987571:1 gene:WBGene00008521.1 transcript:F02D8.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F02D8.4)

HSP 1 Score: 222.246 bits (565), Expect = 3.060e-67
Identity = 131/357 (36.69%), Postives = 199/357 (55.74%), Query Frame = 2
Query:  206 RKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY------YMRFVEIKLWLNEKARQV-SFMKLETLGHSEENREIILVKMSKD-DSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PDRGRYGFLLPPTYIQSVGNQFFHTL 1249
            +K   + + K    +VK  L   N+++ +   D++ +I           FK + +R   G++S       Y+ + E   +LN  A+Q  + +KL+ +G+S E R I  V+++ D  SKPI+WIDAGIHAREWIS + A++LI  ++        LL+  Q+ ++P  NPDGYEY+   +RMWRK R   +   C G D NRNYP++WG  G S   CS IF GS P SE E  A+ N +   +  +K +I LHS+GQ I+ P+G+++  +P     L+ +G +++S ++ +    Y V +S + LY A+GASDD+A     I YSYTIEL P     GF LP   I  V  + F  +
Sbjct:   62 QKQAHYFIDKDSVEKVKINLADNNITYHM--RDVNPQI-----------FKVRRRRDLNGAVSIHDVNTRYLSYDEQMKFLNSLAQQYPNDVKLQNIGNSYEGRSITAVRIADDGSSKPIVWIDAGIHAREWISYNVALYLIYTIVSQPA-YRNLLDSVQLVVVPNTNPDGYEYSRTNDRMWRKTRSRFTNSRCAGADANRNYPFYWGTQGVSHSQCSEIFCGSRPQSEPEVLALTNAIIRDEERIKGYIALHSYGQEILYPWGHTQRTYPTDVQDLIQVGRAMASAIRAVNNTDYTVVNSGDGLYPAAGASDDWAKSR-GIKYSYTIELSPIDDFTGFSLPEDRINQVCREAFQAI 403          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: F02D8.4 (pep chromosome:WBcel235:V:14984909:14987571:1 gene:WBGene00008521.1 transcript:F02D8.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F02D8.4)

HSP 1 Score: 222.246 bits (565), Expect = 3.060e-67
Identity = 131/357 (36.69%), Postives = 199/357 (55.74%), Query Frame = 2
Query:  206 RKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY------YMRFVEIKLWLNEKARQV-SFMKLETLGHSEENREIILVKMSKD-DSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PDRGRYGFLLPPTYIQSVGNQFFHTL 1249
            +K   + + K    +VK  L   N+++ +   D++ +I           FK + +R   G++S       Y+ + E   +LN  A+Q  + +KL+ +G+S E R I  V+++ D  SKPI+WIDAGIHAREWIS + A++LI  ++        LL+  Q+ ++P  NPDGYEY+   +RMWRK R   +   C G D NRNYP++WG  G S   CS IF GS P SE E  A+ N +   +  +K +I LHS+GQ I+ P+G+++  +P     L+ +G +++S ++ +    Y V +S + LY A+GASDD+A     I YSYTIEL P     GF LP   I  V  + F  +
Sbjct:   62 QKQAHYFIDKDSVEKVKINLADNNITYHM--RDVNPQI-----------FKVRRRRDLNGAVSIHDVNTRYLSYDEQMKFLNSLAQQYPNDVKLQNIGNSYEGRSITAVRIADDGSSKPIVWIDAGIHAREWISYNVALYLIYTIVSQPA-YRNLLDSVQLVVVPNTNPDGYEYSRTNDRMWRKTRSRFTNSRCAGADANRNYPFYWGTQGVSHSQCSEIFCGSRPQSEPEVLALTNAIIRDEERIKGYIALHSYGQEILYPWGHTQRTYPTDVQDLIQVGRAMASAIRAVNNTDYTVVNSGDGLYPAAGASDDWAKSR-GIKYSYTIELSPIDDFTGFSLPEDRINQVCREAFQAI 403          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Match: T06A4.3 (pep chromosome:WBcel235:I:763625:768917:1 gene:WBGene00020283.1 transcript:T06A4.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T06A4.3)

HSP 1 Score: 201.445 bits (511), Expect = 3.352e-59
Identity = 109/263 (41.44%), Postives = 152/263 (57.79%), Query Frame = 2
Query:  470 TLGHSEENREIILVKMSKDD-SKPILWIDAGIHAREWISPSTAIFLINKLLE--NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVN----RMWRKNRVSTSYED--------CKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKL--TEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PDRGRY-GFLL 1201
            ++G + E R I  V++  D  +K I WID GIHAREW +P TA+F I++L    N+    KLL +    ++P LNPDGYE+T        R+WRKNR               C+GVDLNRN+ +H+ E+G S DPCS I+QG SP SE E KAV + L     K     +ITLH++ Q  + PYG+ K+ +P     L  +G   +  L+ +YG  Y VGS A+ LY ASG S+D+A  E ++ + Y +EL PD   + GF+L
Sbjct:  153 SIGKTTEGRNIDGVEIGGDSRTKKIFWIDGGIHAREWAAPHTALFFIHQLTSRANEPGIKKLLNEITFVVVPCLNPDGYEFTRSSTNPHVRLWRKNRSKMQCRKDIWGRNRCCRGVDLNRNFDFHFRESGTSDDPCSEIYQGPSPFSEPEAKAVRDALLSQRYKGRTDAYITLHTYSQIWIHPYGHKKDAYPGDIKDLYEVGKKAAQALKRVYGTKYVVGSGADTLYPASGGSEDWAKHEAKVKFVYLLELRPDEKNWDGFIL 415          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG18585 (gene:FBgn0031929 transcript:FBtr0335489)

HSP 1 Score: 238.424 bits (607), Expect = 1.308e-73
Identity = 133/382 (34.82%), Postives = 218/382 (57.07%), Query Frame = 2
Query:   92 VVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGL-FLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY--YMRFVEIKLWLNEKARQVSFMKLE-TLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN-DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGEN-GASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEM-YGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            V K+  QN   L+ + ++   G+L  +   ++ + + +R   +  +VS    +  +  LK  N+S E+M  ++  +I  EQ+              D  +  +  Y    EI+ WL+E       +  E  +G S E R I  +K+S     P ++I++ IHAREWI+ ++A + IN+LL + D +   L ++Y  +I+P+ N DG+EY+H+ +RMWRK R   +   C G D NRN+  +W +N GAS +PCS  F G +P SE E KA++  LT+I+  + ++I+ HS+GQY++SPYG++   FP  Y  ++++G + +  ++ + YG  YQ GS+A++LY A+G S D+   EL     YTIE  D+GRYGF+LPP  I
Sbjct:   32 VYKLTIQNKIQLAAIEKI---GELTKK--YNIWKEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVT----------PTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQI 398          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG18585 (gene:FBgn0031929 transcript:FBtr0079516)

HSP 1 Score: 238.424 bits (607), Expect = 1.308e-73
Identity = 133/382 (34.82%), Postives = 218/382 (57.07%), Query Frame = 2
Query:   92 VVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGL-FLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISY--YMRFVEIKLWLNEKARQVSFMKLE-TLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN-DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGEN-GASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEM-YGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            V K+  QN   L+ + ++   G+L  +   ++ + + +R   +  +VS    +  +  LK  N+S E+M  ++  +I  EQ+              D  +  +  Y    EI+ WL+E       +  E  +G S E R I  +K+S     P ++I++ IHAREWI+ ++A + IN+LL + D +   L ++Y  +I+P+ N DG+EY+H+ +RMWRK R   +   C G D NRN+  +W +N GAS +PCS  F G +P SE E KA++  LT+I+  + ++I+ HS+GQY++SPYG++   FP  Y  ++++G + +  ++ + YG  YQ GS+A++LY A+G S D+   EL     YTIE  D+GRYGF+LPP  I
Sbjct:   32 VYKLTIQNKIQLAAIEKI---GELTKK--YNIWKEYDERSRQIDIMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVT----------PTADSATFGWTKYYELEEIEAWLDEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFDSYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNEEFPENYNDILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFILPPVQI 398          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG8563 (gene:FBgn0035777 transcript:FBtr0332724)

HSP 1 Score: 230.72 bits (587), Expect = 1.934e-70
Identity = 120/301 (39.87%), Postives = 179/301 (59.47%), Query Frame = 2
Query:  383 GSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDD---SKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLS 1273
            G  S+Y R+ E+  +++   AR   F + E+LG S E R I  + +S +     + + +I A  H REWI+  T ++L  +LL N +   ++L+D +I+++PL+NPDGYEYTH  +R WRKNR   +   C GVD+NRN+  HW   GAS + CS ++ G++P+SE ET AV+  L   +  VKL + +HSFG++I  PYGY+KN  P     L S+    ++ +    G  Y  G+SA++LYEASG+ DD+A G L IP SYT+ELP      F +P   I  V  + F   I+F  ++S
Sbjct:  141 GFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIPLSYTLELPGD---EFHVPAHDIIHVCKETFAGFIEFIRHVS 438          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG8563 (gene:FBgn0035777 transcript:FBtr0076852)

HSP 1 Score: 230.72 bits (587), Expect = 1.934e-70
Identity = 120/301 (39.87%), Postives = 179/301 (59.47%), Query Frame = 2
Query:  383 GSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDD---SKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLS 1273
            G  S+Y R+ E+  +++   AR   F + E+LG S E R I  + +S +     + + +I A  H REWI+  T ++L  +LL N +   ++L+D +I+++PL+NPDGYEYTH  +R WRKNR   +   C GVD+NRN+  HW   GAS + CS ++ G++P+SE ET AV+  L   +  VKL + +HSFG++I  PYGY+KN  P     L S+    ++ +    G  Y  G+SA++LYEASG+ DD+A G L IP SYT+ELP      F +P   I  V  + F   I+F  ++S
Sbjct:  141 GFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYIQAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIPLSYTLELPGD---EFHVPAHDIIHVCKETFAGFIEFIRHVS 438          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Match: CG7025 (gene:FBgn0031930 transcript:FBtr0079515)

HSP 1 Score: 229.18 bits (583), Expect = 6.079e-70
Identity = 139/405 (34.32%), Postives = 219/405 (54.07%), Query Frame = 2
Query:   26 IIYSLVFSARGKPAKQS----FIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLL-ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGEN-GASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEM-YGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            I+ +LV  A+G    Q     +    V K+K +  +  S LR+++       R++  L    KD      ++S   F E++  ++  NV+ E+  +++      ++LI+  +    K  R      + Y    EI  WL++  A   +  +   +G S E R I  +K+S   + P + I++ IHAREWI+ +TA +LIN+ L   D+    L E++  YI+P+LN DG+ YTHE +RMWRK R  +    C G D NRNY  HW EN GAS +PC+  + G  P SE E +A+   +  IK  + + +  HS+ Q ++SPYG++K  FP  +  +M +  +    ++ + YG  Y+ GS+A +LY ASGA+ D+A  E  +  SYTIE  D GRYGF+LPP +I
Sbjct:    8 IVLALVVLAQGASFGQDERLRYDNYSVYKVKFETQAQRSILRKLA-----EDRENFRLWHEAKDELH--LMLSPGAFGELETEIQKTNVTAELFISNV------QELIDSEEAANLKASRDGTFGWTKYNSLAEIYAWLDDILAAYPTITESFIVGQSYEGRTIRGIKISYKSNNPGVLIESNIHAREWITSATATWLINEFLTSTDELVRDLAENHDWYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGPKPFSEPEIQAMSEFVISIKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDAVESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYGFILPPVHI 399          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpb2 (carboxypeptidase B2 (plasma) [Source:ZFIN;Acc:ZDB-GENE-050522-259])

HSP 1 Score: 223.402 bits (568), Expect = 9.753e-68
Identity = 127/344 (36.92%), Postives = 192/344 (55.81%), Query Frame = 2
Query:  245 SEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTD-----QGSISY--YMRFVEIKLWLNEKARQVSFM-KLETLGHSEENREIILVKMS---KDDSKPILWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQ 1234
            SEV  ++++ +V F + ++  +  I F  L+           R D      G + Y  Y    +I  W+N+ +R+ S M K+  +G S E R + ++K+S   +++    +W+D GIHAREWI+P+  ++ +N  L     +    ++L    IYIL ++NPDGY+YT   +RMWRKNR       C GVDLNRN+  +W   GAS DPC   + G  P SE ET+AV   L   K  VKL++++HS+ Q ++ PY  S N  P  + +L  +    S+ ++  Y   Y+ GS A  +Y A G SDD+A  +L I YS+T EL DRG+YGFLLPP++I    N+
Sbjct:   67 SEVHLYIQSTSVQF-VKEHLREHAITFRVLVENTAALVAMQIRNDTSDPRSGGVFYERYHSLEDIYYWINKTSREHSDMVKVILIGSSSEKRPLYVLKLSGKREEEVNRAMWMDCGIHAREWIAPAFCMWFVNYALAFYNQNTEITEMLNKMDIYILTVMNPDGYKYTWTTDRMWRKNRSENKDSYCAGVDLNRNFDANWCTKGASDDPCDPTYCGQFPESEPETQAVAKFLRSHKDTVKLYLSIHSYSQMLLFPYSCSYNEIP-NHNELFELVKEASTKIRRYYRNNYKYGSGAKTIYLAPGGSDDWAY-DLGIKYSFTFELQDRGQYGFLLPPSFIPQACNE 407          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpa4 (carboxypeptidase A4 [Source:ZFIN;Acc:ZDB-GENE-040704-61])

HSP 1 Score: 208.379 bits (529), Expect = 5.659e-62
Identity = 137/409 (33.50%), Postives = 209/409 (51.10%), Query Frame = 2
Query:   17 IFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDL-LELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKN---DLDRKIKFEQLINRRQYFKTK-FQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKD-DSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            +FI +++L+ +      K+ F  D V++I  ++  ++  L+E      L     LD     F   +     V       VK FLK  N+ F +M N   DL  + K E + N       K F       +     F++  +     A   + +    +G+S ENR +  +K S   +++P +WIDAGIHAREW++ ++A+++ NK+  +   D +   LL    +Y++ + NPDGY +TH  NRMWRK R       C+G D NRN+   +G  GAS +PCS  + G    SE E K V++ L +   N K FI++HS+ Q +M PYGY+    P Q  +L ++GT+    L  +Y   YQVGS   ++Y+ASG S D+    + I YS+  EL D G YGFLLP   I
Sbjct:    3 LFIAVFALLVAVH---CKELFNGDQVLRIHAESEDHIHILKE------LDEDSGLDFWTHGFSTERPVDVRVPHASLYAVKDFLKENNIPFTVMINNVQDLLDEQKAEMVSNAVTERDAKIFDFAAYHDLDTIYSFMDTLV-----ASHPNLISKINIGNSYENRPMYALKFSTGGENRPAIWIDAGIHAREWVTQASAVWIANKMALDYGVDPSVTSLLGQMDVYLMIVTNPDGYSFTHTDNRMWRKTRSVNPGSSCRGTDPNRNWDAGFGGPGASKNPCSDSYHGPYAHSEVEVKNVVD-LIKGHGNFKSFISIHSYSQLLMYPYGYTCTNIPDQ-SELHAVGTAAIKELMSLYNTKYQVGSICKIIYQASGGSIDWTY-NIGIKYSFAFELRDTGLYGFLLPANQI 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpb1 (carboxypeptidase B1 (tissue) [Source:ZFIN;Acc:ZDB-GENE-030131-1132])

HSP 1 Score: 204.912 bits (520), Expect = 1.081e-60
Identity = 127/388 (32.73%), Postives = 208/388 (53.61%), Query Frame = 2
Query:   74 SFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLW-LNEKARQVSFMKLETLGHSEENREIILVKMSKD--DSKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQ 1219
            +F+ D V+++K  N  +++ +RE      LG +  LD    +K R + L  +   +   V A   A  VS  + ++D++ K+  + L    +        T     + Y  +  I  W ++  +     +  +++G++ E R + L+K+ K+   +KP +++D G HAREWI+ +   + +N+ +    +D +   LL+    ++LP+ N DGYEYT   +RMWRK R   S   C G D NRN+   W   GAS +PCS  + GSSP SE E+K + N +   K+ +K ++T+HS+ Q ++ PY Y K      + +LMS+     + L+ +YG  Y  G  A  +Y A+G SDD+A  +L + YSYT EL D GRYGFLLP + I+
Sbjct:   19 TFVGDKVLQLKPINDEHVTIIRE------LGEKIKLDF---WKPRSADLVSIDMTVDIHVPAAQLAM-VSTILQQSDMEVKVMIDNLQEAVKGQMDNRSPTKGHDYTKYNSWATINDWAISISSANPDLISRQSIGNTYEGRTMHLLKIGKNTGSNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLDRMDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVGASSNPCSDTYCGSSPESEIESKNLANFIRTNKSVIKAYLTVHSYSQLLLFPYSY-KYDLAAHHSELMSVSQGAIAALRSLYGTKYTSGPGAATIYPAAGGSDDWAY-DLGVKYSYTFELRDEGRYGFLLPESQIK 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpb1 (carboxypeptidase B1 (tissue) [Source:ZFIN;Acc:ZDB-GENE-030131-1132])

HSP 1 Score: 204.912 bits (520), Expect = 1.081e-60
Identity = 127/388 (32.73%), Postives = 208/388 (53.61%), Query Frame = 2
Query:   74 SFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLW-LNEKARQVSFMKLETLGHSEENREIILVKMSKD--DSKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQ 1219
            +F+ D V+++K  N  +++ +RE      LG +  LD    +K R + L  +   +   V A   A  VS  + ++D++ K+  + L    +        T     + Y  +  I  W ++  +     +  +++G++ E R + L+K+ K+   +KP +++D G HAREWI+ +   + +N+ +    +D +   LL+    ++LP+ N DGYEYT   +RMWRK R   S   C G D NRN+   W   GAS +PCS  + GSSP SE E+K + N +   K+ +K ++T+HS+ Q ++ PY Y K      + +LMS+     + L+ +YG  Y  G  A  +Y A+G SDD+A  +L + YSYT EL D GRYGFLLP + I+
Sbjct:   19 TFVGDKVLQLKPINDEHVTIIRE------LGEKIKLDF---WKPRSADLVSIDMTVDIHVPAAQLAM-VSTILQQSDMEVKVMIDNLQEAVKGQMDNRSPTKGHDYTKYNSWATINDWAISISSANPDLISRQSIGNTYEGRTMHLLKIGKNTGSNKPAVFMDCGFHAREWITHAFCQWFVNEAVSTYGSDPDMTNLLDRMDFFVLPVFNIDGYEYTWNRDRMWRKTRSKNSGSSCIGTDPNRNFNAGWCTVGASSNPCSDTYCGSSPESEIESKNLANFIRTNKSVIKAYLTVHSYSQLLLFPYSY-KYDLAAHHSELMSVSQGAIAALRSLYGTKYTSGPGAATIYPAAGGSDDWAY-DLGVKYSYTFELRDEGRYGFLLPESQIK 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Match: cpa1 (carboxypeptidase A1 (pancreatic) [Source:ZFIN;Acc:ZDB-GENE-050522-438])

HSP 1 Score: 203.756 bits (517), Expect = 2.754e-60
Identity = 141/426 (33.10%), Postives = 218/426 (51.17%), Query Frame = 2
Query:   65 AKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLG-------HRDSL--DLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTK-FQR-TDQGSISYYMRFVEIKLWLN----EKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL*NP 1288
             K +F  D V++I  +N   +S L+E++    LG        R+SL  DL   F   ++            V+AFL    + + IM  ++   +  EQL    Q  K + F R TD    + Y     I  +++    E    VS  K+E +G S ENR + ++K S   ++P +WID G+H+REWI+ ++ I+   K++ +   D     +L  Y I++  + NPDG  YTH  +RMWRK R       C GVD NRN+   +G  G+S +PCS+ + G S  SE E KA++ +  +   N+K F+++HS+ Q ++ PYGY++     Q  +L  +    +S LQ +Y   Y  GS    +Y+A G + D+A  E  I YSYT EL D GRYGF+LP   I     + +  L+   E++ N  NP
Sbjct:   16 GKVTFEGDQVLRINAKNAEQISLLKELTEADLLGLDFWMTPARESLPVDLHVPFHSLQA------------VRAFLAYNQIPYHIMIENVQDLVDEEQL----QMLKYRGFPRSTDDFVYTTYHDLDSINSFMDMLVAENQNMVS--KIE-IGQSYENRPLNVLKFSTGANRPGIWIDTGLHSREWITHASGIWFAKKIVTDYGRDPVLTDILNSYDIFLEIVANPDGLAYTHSDDRMWRKTRKPNPGSSCVGVDPNRNWETGFGGPGSSSNPCSQTYHGPSIHSEPEVKAIV-EFVKSHGNLKAFLSIHSYSQMLLYPYGYTQTAAKDQ-AELHELARKATSELQSLYNTAYTYGSIITTIYQADGVTTDWAY-EQGIKYSYTFELRDTGRYGFILPADQILPTAEETWLALMVIMEHIKN--NP 417          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:595005])

HSP 1 Score: 206.068 bits (523), Expect = 5.829e-61
Identity = 120/345 (34.78%), Postives = 191/345 (55.36%), Query Frame = 2
Query:  221 FLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVS-FMKLETLGHSEENREIILVKMSKDD--SKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEV-NRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQ 1234
            F V++     VKA L   ++ + ++ N+       ++LI ++ +  T  QR+       Y    +I  W+     + S  ++   +G+S ENR + ++K+S  +  +K  +WID GIHAREWISP+  ++ +   +E    D +  KLL     YILP++N DGY+++    NRMWRKNR   +  +C G DLNRN+   W   GAS DPC  I+ G    SE E  AV++ L + +  VK +IT+HS+ Q ++ PY Y+ N+  + + +L+ +   V+  ++      Y  G+ A  +Y A G SDD+A  +L I YS+T EL D+G YGFLLPP  I+   ++
Sbjct:   69 FYVNESFIDTVKAELNESSILYMVLVNNA------QELIEQQTFNDTSNQRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGYSFENRPLYVLKVSGKEKTAKHAVWIDCGIHAREWISPAFCLWFVGHAVEYYGVDLSMTKLLRYLDFYILPVMNADGYQFSWTAKNRMWRKNRSKYTKSNCIGTDLNRNFDAGWCGPGASSDPCHEIYCGPYAESEPEVSAVVSFLKKHQNVVKGYITVHSYSQMVLFPYSYT-NKKSKDHDELLLLSKKVAEGIRSTSRNKYMYGAGAETIYLAPGGSDDWAY-DLGIKYSFTFELRDKGMYGFLLPPQLIKPTCSE 405          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: pex6 (peroxisomal biogenesis factor 6 [Source:Xenbase;Acc:XB-GENE-6049481])

HSP 1 Score: 204.912 bits (520), Expect = 7.088e-61
Identity = 127/371 (34.23%), Postives = 204/371 (54.99%), Query Frame = 2
Query:  239 IFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFK--TKFQRTDQGSISYYMRFVEIKLWLNEKARQVS-FMKLETLGHSEENREIILVKMS--KDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNS---MKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPP---------------TYIQSVGNQFFHTLIK-FTENLSNL 1279
            +  + K  L   ++ FE+M  D+ + I    + + R+  K   +F  T       Y    EI  W+++     S  + +  LG + E R I   K+    D  K I+W+D GIHAREWI+ +   + + ++LE  K +    K+L +   YI+P+LN DG+ Y+  VNR+WRK+R   +   C GVDLNRN+   WG  GAS +     + G+ P+SE E  AV   L  +K++V  F+T+HS+GQ ++ PYGY+K+     + +++++    ++ LQE +G  Y+VGS+++LLY  SG+S D+A  +L I +SYT EL D G +GF+LP                T ++ V  +FF++ I  F+ NL +L
Sbjct:    9 LLQKFKENLHQYSIPFEVMIKDVQKLIDSSNVGDYRRQKKILAEFDYTT------YHPMDEIYQWMDQVKEAYSDLVSMHYLGSTYELRPIYYFKIGWPSDKQKKIIWMDCGIHAREWIAVAYCQWFVKEILETHKTNPLLQKVLHNIDFYIVPVLNIDGFVYSWNVNRLWRKSRSPHNNGSCYGVDLNRNFNSKWGSIGASNNCRDETYCGTGPASEPEVNAVSKLLGSLKSDVLCFLTIHSYGQLLLLPYGYTKDP-SINHEEMINVAQKAAAKLQEKHGTEYRVGSTSHLLYSNSGSSRDWAT-DLGINFSYTFELRDTGAHGFILPANQIRPTCEETMAGVMTIVEHVDAKFFNSAISIFSSNLVSL 371          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: slco3a1 (solute carrier organic anion transporter family member 3A1 [Source:Xenbase;Acc:XB-GENE-6035424])

HSP 1 Score: 195.667 bits (496), Expect = 1.036e-57
Identity = 112/291 (38.49%), Postives = 174/291 (59.79%), Query Frame = 2
Query:  371 RTDQGSISYYMRFVEIKLWLNEKARQVS-FMKLETLGHSEENREIILVKMSK--DDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSM---KLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSK--NRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQ 1219
            R +  +I YY    +I  W+N  A++ S F+    LG + E+R +  +K+S+  ++ K I+WID GIHAREWI+P+   + + ++++N +N     K+L++  IY+LP+LN DGY Y+    R+WRKNR       C GVDLNRN+   W  + +S +  S  F GSSP SE ET+AV+  +   K ++  F+T+HS+ Q I++ YGYS   +R   + +K+  M  S    +++++G  Y+ G  + LLYEASG S D+   +L I +S+T EL D G + F LP   IQ
Sbjct:   24 RVNNTNICYYF-LSQIYDWINGIAKKHSQFVTQHLLGLTYESRPMQYLKISQPSENHKKIVWIDCGIHAREWIAPAFCQWFVKEIVQNYQNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLNRNFNVSWC-SISSTNCSSNSFCGSSPVSEPETRAVVEFVESRKADIVCFLTMHSYSQLILTAYGYSTGLSRNSNEIFKVAEMAASA---MEKIHGTKYRAGPFSKLLYEASGTSQDWVH-DLGIDFSFTFELRDNGSHKFTLPEDQIQ 308          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: kpna1 (karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-1014184])

HSP 1 Score: 196.052 bits (497), Expect = 1.978e-57
Identity = 109/343 (31.78%), Postives = 185/343 (53.94%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTEN 1267
            VK +L++ ++ + IM +D+   +  EQ   RR       + T+  + + Y  F EI  ++ N  +   + +    +G S E R + ++K S   ++P  WID GIH+REW++ ++A++   K++ +   D +    L    I I  + NPDG+ YTH+ +RMWRK R   S   C G D NRN+   +G  G+S +PC+  ++G +  SE E KA+++   +   N+K F+++HS+ Q ++ PYGY+  R P  + +L ++     + L  +YG  Y  GS  + +Y+ASG + D+   +  I +SY+ EL D GRYGF LP   I     + +  L    E+
Sbjct:   51 VKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQMDILIEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVD-FVKSHGNIKGFVSIHSYSQMLLFPYGYTNTRVP-DHDELNAVSKKAITALASLYGTAYTYGSIISTIYQASGGTIDWTYNQ-GIKHSYSFELRDTGRYGFALPANQIIPTAEETWLALTILIEH 390          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Match: kpna1 (karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-1014184])

HSP 1 Score: 196.052 bits (497), Expect = 3.454e-57
Identity = 109/343 (31.78%), Postives = 185/343 (53.94%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTEN 1267
            VK +L++ ++ + IM +D+   +  EQ   RR       + T+  + + Y  F EI  ++ N  +   + +    +G S E R + ++K S   ++P  WID GIH+REW++ ++A++   K++ +   D +    L    I I  + NPDG+ YTH+ +RMWRK R   S   C G D NRN+   +G  G+S +PC+  ++G +  SE E KA+++   +   N+K F+++HS+ Q ++ PYGY+  R P  + +L ++     + L  +YG  Y  GS  + +Y+ASG + D+   +  I +SY+ EL D GRYGF LP   I     + +  L    E+
Sbjct:   75 VKVYLESNSIQYSIMIHDVQNLLDEEQRDMRRNRASEDGRSTNSFNYAAYHTFDEINAFIDNLVSENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREWVTQASAVWFAKKIVTDFGKDPSLTNTLNQMDILIEIVTNPDGFVYTHKSDRMWRKTRSPNSGSLCVGTDPNRNWDAGFGGPGSSSNPCTETYRGRAAHSEPEVKAIVD-FVKSHGNIKGFVSIHSYSQMLLFPYGYTNTRVP-DHDELNAVSKKAITALASLYGTAYTYGSIISTIYQASGGTIDWTYNQ-GIKHSYSFELRDTGRYGFALPANQIIPTAEETWLALTILIEH 414          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa2 (carboxypeptidase A2, pancreatic [Source:MGI Symbol;Acc:MGI:3617840])

HSP 1 Score: 213.386 bits (542), Expect = 5.967e-64
Identity = 127/351 (36.18%), Postives = 196/351 (55.84%), Query Frame = 2
Query:  248 EVKAFLKAENVSFEIMKND----LDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            +VK FL+++ +++ IM  D    LD++ + E L N+++   T F      +   Y    EI   + N  A     +    +G S ENR + ++K S    KP +W+DAGIHAREW++ +TA++  NK+  +   D     LL    +++LP+ NPDGY ++   NRMWRK R   S   C GVD NRN+  ++G  GAS +PCS  + G SP+SE E K++++   +    VK FITLHS+ Q +M PYGY K   P  + +L  +    +  L+ ++G +Y+VG   +++Y+ASG S D+A  +L I YS+  EL D G YGFLLP   I     + +  L    E++ +
Sbjct:   74 DVKVFLESQGITYSIMIEDVQVLLDQE-REEMLFNQQRERGTNF------NFGAYHTLEEIYQEMDNLVAENPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDVFLLPVTNPDGYVFSQTSNRMWRKTRSKRSGSFCVGVDPNRNWDANFGGPGASSNPCSDSYHGPSPNSEVEVKSIVD-FIKSHGKVKAFITLHSYSQLLMFPYGY-KCAKPDDFNELDEVAQRAAQSLKRLHGTSYKVGPICSVIYQASGGSIDWAY-DLGIKYSFAFELRDTGYYGFLLPAKQILPTAEETWLGLKTIMEHVRD 414          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa5 (carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:1921899])

HSP 1 Score: 206.838 bits (525), Expect = 3.976e-61
Identity = 136/413 (32.93%), Postives = 223/413 (54.00%), Query Frame = 2
Query:   74 SFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSE---VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQR----TDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDD-SKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFF---HTLIKFTEN 1267
            +F  D V+++  +N   LS LR++    +      +D        +  L +  ++ FSE   VKA+LK+  +++ IM  D+      + L++  +    K +R    T+  S S Y    EI  W+ N  A   + +    +G S ENR I+++K S    ++P +WID GIH+REWI+ +T I++  K++     D    ++L    I+I  + NPDG+ +TH +NR+WRKN+ S     C GVDLNRN+   +G NG++ +PCS  ++G +P SE E  A+++ +T    N K  I++HS+ Q +M PYG+S    P  + +L ++       L +++G  Y  GS +  LY ASG S D+A  +  I Y+++ EL D G+YGFLLP + I     + +    T++K T N
Sbjct:   36 NFTGDQVLRVLAKNEKQLSLLRDL----ETQKPQKVDFWR--GPARPSLPVDMRVPFSELPSVKAYLKSHGLAYSIMIKDI------QVLLDEERDAMAKSRRLERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITG-HGNFKAMISIHSYSQMVMYPYGHSLEPVP-NHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAY-DSGIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTIMKHTLN 433          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa5 (carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:1921899])

HSP 1 Score: 206.838 bits (525), Expect = 3.976e-61
Identity = 136/413 (32.93%), Postives = 223/413 (54.00%), Query Frame = 2
Query:   74 SFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSE---VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQR----TDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDD-SKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFF---HTLIKFTEN 1267
            +F  D V+++  +N   LS LR++    +      +D        +  L +  ++ FSE   VKA+LK+  +++ IM  D+      + L++  +    K +R    T+  S S Y    EI  W+ N  A   + +    +G S ENR I+++K S    ++P +WID GIH+REWI+ +T I++  K++     D    ++L    I+I  + NPDG+ +TH +NR+WRKN+ S     C GVDLNRN+   +G NG++ +PCS  ++G +P SE E  A+++ +T    N K  I++HS+ Q +M PYG+S    P  + +L ++       L +++G  Y  GS +  LY ASG S D+A  +  I Y+++ EL D G+YGFLLP + I     + +    T++K T N
Sbjct:   36 NFTGDQVLRVLAKNEKQLSLLRDL----ETQKPQKVDFWR--GPARPSLPVDMRVPFSELPSVKAYLKSHGLAYSIMIKDI------QVLLDEERDAMAKSRRLERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKIHIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILNTMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIFCIGVDLNRNWKAGFGGNGSNKNPCSETYRGPAPESEPEVAAIVDFITG-HGNFKAMISIHSYSQMVMYPYGHSLEPVP-NHEELFNLAKDAVKALNKVHGIQYIFGSISTTLYSASGISVDWAY-DSGIKYAFSFELRDTGQYGFLLPASQIVPTAEETWMALQTIMKHTLN 433          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpb1 (carboxypeptidase B1 (tissue) [Source:MGI Symbol;Acc:MGI:1923953])

HSP 1 Score: 201.06 bits (510), Expect = 3.839e-59
Identity = 123/400 (30.75%), Postives = 212/400 (53.00%), Query Frame = 2
Query:   65 AKQSFIKDFVVKIKCQNLSNLSRLREMSFTG--DLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQ---RTDQGSISYYMRFVEIKLWLNEKAR-QVSFMKLETLGHSEENREIILVKMSKD-DSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSM---KLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQ 1234
            ++++F  + V ++   +  ++S ++E++ T   D    DS   +   K   +  F V      +V+ FL+   V +E++            + N +   +++F    R    S + Y  +  I+ W+ + A      +    +G + E R + ++K+ KD  +KP  +ID G HAREWISP+   + + + +   K  +   +LL++   Y+LP++N DGY YT   +RMWRK R +T+   C GVD NRN+   W E GAS  PCS  + G +P SEKETKA+ + + +  +++K ++T+HS+ Q ++ PY Y   + P  Y +L ++    +  L  ++G  Y  G  A  +Y A+G SDD+A  +  I YS+T EL D+G +GFLLP + I+    +
Sbjct:   16 SEENFDGNRVFRVSVHDEDDVSLIQELANTKQIDFWKPDSATQV---KPLTTVDFHVKAEDVVDVENFLEENEVLYEVL------------ISNVKHILESQFDSHTRASGHSYTKYNNWETIEAWIQQVANDNPDLVSKRVIGTTFEGRNMYVLKIGKDRPNKPAFFIDCGFHAREWISPAFCQWFVREAVRTYKQEIHMKRLLDELDFYVLPVVNIDGYVYTWAKDRMWRKTRSTTAGSSCFGVDPNRNFDAGWCEVGASRSPCSDTYCGPTPESEKETKALADFIRQNLSSIKAYLTVHSYSQMMLYPYSYDY-KLPENYEELNALVKGAAKELSTLHGTKYTYGPGATTIYPAAGGSDDWAYDQ-GIKYSFTFELRDKGFFGFLLPESQIRQTCEE 398          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Match: Cpa1 (carboxypeptidase A1, pancreatic [Source:MGI Symbol;Acc:MGI:88478])

HSP 1 Score: 197.978 bits (502), Expect = 5.283e-58
Identity = 117/364 (32.14%), Postives = 204/364 (56.04%), Query Frame = 2
Query:  209 KSGLFLVSKIIF---SEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEI----KLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDS-KPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTEN 1267
            ++GL +  ++ F     VKAFL+  ++S+EIM  D+   +  E+   +   F+ +   TD  + + Y    EI     L + E  + VS +++   G + E R I ++K S   + +P +WID GIH+REW++ ++ ++   K+ ++   +     +L++  I++  + NPDG+ YTH+ NRMWRK R  T    C GVD NRN+   +G  GAS +PCS  ++G  P+SE E K++++ +T    N+K FI++HS+ Q ++ PYGY+    P +  +L  +  S  + L  ++G  ++ GS  + +Y+ASG++ D+   +  I YS+T EL D G  GFLLP + I     + +  L+   ++
Sbjct:   58 RAGLPIDVRVPFPTIQSVKAFLEYHDISYEIMIEDVQSLLDEEK--QQMSAFQARALSTDAFNYATYHTLDEIYEFMDLLVTEHPQLVSKIQI---GSTFEGRPINVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLTAILDNMDIFLEIVTNPDGFVYTHKTNRMWRKTRSHTEGSLCVGVDPNRNWDAAFGMPGASSNPCSETYRGKFPNSEVEVKSIVDFVTS-HGNIKAFISIHSYSQLLLYPYGYTSEPAPDK-EELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQ-GIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDH 413          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|P04069|CBPB_ASTAS (Carboxypeptidase B OS=Astacus astacus OX=6715 PE=1 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 6.838e-75
Identity = 118/287 (41.11%), Postives = 172/287 (59.93%), Query Frame = 2
Query:  398 YMRFVEIKLWLNEKARQV-SFMKLETLGHSEENREIILVKMSKDDS-KPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVST-SYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTL 1249
            Y  + EI  WL+  A        +E +G S E R + L+K+ K  + KPI++ID GIHAREWI+PST  +++N+ + N      +L +   Y++P +NPDGY YT   +R+WRK R  T S   CKG D NRN+ +HW E GAS  PCS I+ G  P SE E + V +++ E   N+K+++T HS+ Q  M P+G++ +  P  +  L ++ T+    L  ++G  Y++GSS N +Y A+G SDD+A GE  + Y+YTIEL D G YGFLLP   I   G + F  +
Sbjct:    6 YHDYDEINAWLDSLATDYPELASVEDVGLSYEGRTMKLLKLGKGGADKPIIFIDGGIHAREWIAPSTVTYIVNEFVSNSATYDDILSNVNFYVMPTINPDGYAYTFTDDRLWRKTRSETGSVLGCKGADPNRNWSFHWDEVGASDSPCSDIYAGPEPFSEVEMRNVRDQILEYAANIKVYLTFHSYSQLWMYPWGFTSD-LPDDWQDLDTLATNAVDALTAVHGTRYEIGSSTNTIYAAAGGSDDWAKGEGGVKYAYTIELRDTGNYGFLLPENQIIPTGEETFEGV 291          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0II73|CBPO_BOVIN (Carboxypeptidase O OS=Bos taurus OX=9913 GN=CPO PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.604e-66
Identity = 118/297 (39.73%), Postives = 184/297 (61.95%), Query Frame = 2
Query:  398 YMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDDSKP--ILWIDAGIHAREWISPSTAIFLINKLLEN-DKNSM--KLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            Y    EI  W++E + +    +    LG + E+R +  +K+S+  S P  I+W+D GIHAREWI+P+   + + ++L+N + NS   +LL++   Y+LP+LN DGY YT   +R+WRK+R S +   C G DLNRN+   W   GAS +  S  F G+ P SE ETKAV + +   K N+  F+T+HS+GQ I+ PYGY+KN+    + +L+ +G   ++ L+  +G  Y+VGSSA++LY  SG+S D+A  ++ IP+SYT EL D G YGF+LP T IQ+   +    ++   +++
Sbjct:   51 YHPMGEIYQWMSEIREKYTEVVTQHFLGMTYESRPMYYLKISQPSSNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNYEDNSRIRRLLKNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSSHNNGTCFGTDLNRNFDASWCSIGASHNCESLTFCGTGPMSEPETKAVSSFIESKKENIACFLTMHSYGQLILVPYGYTKNK-SNNHEELIQVGQKAANALKAKHGTNYRVGSSADILYATSGSSRDWAR-DIGIPFSYTFELRDNGTYGFVLPETQIQATCEETMEAVLSVLDDV 345          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q504N0|CBPA2_MOUSE (Carboxypeptidase A2 OS=Mus musculus OX=10090 GN=Cpa2 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 4.174e-63
Identity = 127/351 (36.18%), Postives = 196/351 (55.84%), Query Frame = 2
Query:  248 EVKAFLKAENVSFEIMKND----LDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            +VK FL+++ +++ IM  D    LD++ + E L N+++   T F      +   Y    EI   + N  A     +    +G S ENR + ++K S    KP +W+DAGIHAREW++ +TA++  NK+  +   D     LL    +++LP+ NPDGY ++   NRMWRK R   S   C GVD NRN+  ++G  GAS +PCS  + G SP+SE E K++++   +    VK FITLHS+ Q +M PYGY K   P  + +L  +    +  L+ ++G +Y+VG   +++Y+ASG S D+A  +L I YS+  EL D G YGFLLP   I     + +  L    E++ +
Sbjct:   74 DVKVFLESQGITYSIMIEDVQVLLDQE-REEMLFNQQRERGTNF------NFGAYHTLEEIYQEMDNLVAENPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIASDYGTDPAITSLLNTLDVFLLPVTNPDGYVFSQTSNRMWRKTRSKRSGSFCVGVDPNRNWDANFGGPGASSNPCSDSYHGPSPNSEVEVKSIVD-FIKSHGKVKAFITLHSYSQLLMFPYGY-KCAKPDDFNELDEVAQRAAQSLKRLHGTSYKVGPICSVIYQASGGSIDWAY-DLGIKYSFAFELRDTGYYGFLLPAKQILPTAEETWLGLKTIMEHVRD 414          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IVL8|CBPO_HUMAN (Carboxypeptidase O OS=Homo sapiens OX=9606 GN=CPO PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 4.890e-63
Identity = 115/303 (37.95%), Postives = 182/303 (60.07%), Query Frame = 2
Query:  386 SISYYMRFVEIKLWL---NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKP--ILWIDAGIHAREWISPSTAIFLINKLLENDKNSM---KLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            S + Y    EI  W+   +EK ++V       LG + E   +  +K+S+    P  I+W+D GIHAREWI+P+   + + ++L+N K++    KLL +   Y+LP+LN DGY YT   +R+WRK+R   +   C G DLNRN+   W   GAS +   + F G+ P SE ETKAV + +   K ++  F+T+HS+GQ I++PYGY+KN+    + +++ +G   ++ L+  YG  Y+VGSSA++LY +SG+S D+A  ++ IP+SYT EL D G YGF+LP   IQ    +    ++   +++
Sbjct:   46 SYNIYHPMGEIYEWMREISEKYKEVVTQHF--LGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNK-SSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGSSRDWAR-DIGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDV 344          
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Match: sp|P48052|CBPA2_HUMAN (Carboxypeptidase A2 OS=Homo sapiens OX=9606 GN=CPA2 PE=1 SV=3)

HSP 1 Score: 212.616 bits (540), Expect = 1.114e-62
Identity = 124/350 (35.43%), Postives = 195/350 (55.71%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKND----LDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWL-NEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            VK FL+++ +++ IM  D    LD++ + E L NRR+      +R+   +   Y    EI   + N  A     +    +G S ENR + ++K S    KP +W+DAGIHAREW++ +TA++  NK++ +   D +   +L+   I++LP+ NPDGY ++   NRMWRK R   S   C GVD NRN+   +G  GAS +PCS  + G S +SE E K++++   +    VK FITLHS+ Q +M PYGY   +    + +L  +    +  L+ ++G  Y+VG   +++Y+ASG S D++  +  I YS+  EL D GRYGFLLP   I     + +  L    E++ +
Sbjct:   77 VKVFLESQGIAYSIMIEDVQVLLDKENE-EMLFNRRR------ERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVD-FIKSHGKVKAFITLHSYSQLLMFPYGYKCTKL-DDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSY-DYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRD 416          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A2H1CMC6 (Zinc carboxypeptidase OS=Fasciola hepatica OX=6192 GN=D915_03942 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 3.414e-112
Identity = 159/347 (45.82%), Postives = 248/347 (71.47%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQG----SISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL 1279
            +K  +   N+S+ I+++DL ++I  +   ++R+Y  T+ +RT +         Y    EI   ++   RQ SF+ +ETLG++EE R +  + +SKD SKPI+WIDAGIHAREWI+P+ A++ +++LL   +    LL DYQ +ILPL+NPDGY +TH V+R+WRKNR  ++ E C GVDLNRN+P  WG +G+SP  C+ +++G  P+SE ET+ +I++LTE++  + L+++LHSFGQYI++PYG+++ ++P+ Y  +++MG  +   ++E +G  YQVGSS++LLYEA+G SDD+ AGEL + Y+YTIEL D GRYGFLLPP+YI+SVG Q +  + +F E++++ 
Sbjct:   65 LKNLIGRYNLSYTILQDDLSKEIARQ---SQRRYV-TQLRRTRRSLWRTEHDAYRTVEEIYEAIDRHGRQHSFVNIETLGYTEEGRPLKSLFISKDKSKPIIWIDAGIHAREWIAPAAALYFVDRLL--TRTGQALLRDYQFHILPLVNPDGYAHTHRVDRLWRKNRSHSAGERCLGVDLNRNFPLKWGRDGSSPQACTEVYRGIKPASELETQGIIHRLTELRGKLILYLSLHSFGQYILTPYGFARYQYPKNYKNMINMGHRIRKAIRERHGFVYQVGSSSDLLYEAAGGSDDFVAGELGVQYAYTIELCDEGRYGFLLPPSYIRSVGRQLWTAVQQFVEHINSF 405          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A4E0RXH6 (Subfamily M14A unassigned peptidase OS=Fasciola hepatica OX=6192 GN=D915_002241 PE=4 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.882e-110
Identity = 159/345 (46.09%), Postives = 246/345 (71.30%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQG----SISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGE-NGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            +K  +   N+S+ I+++DL ++I  +   ++R+Y  T+ +RT +         Y    EI   ++   RQ SF+ +ETLG++EE R +  + +SKD SKPI+WIDAGIHAREWI+P+ A++ +++LL   +    LL DYQ +ILPL+NPDGY +TH V+R+WRKNR  ++ E C GVDLNRN+P  WG  +G+SP  C+ +++G  P+SE ET+ +I++LTE++  + L+++LHSFGQYI++PYG+++ ++P+ Y  +++MG  +   ++E +G  YQVGSS++LLYEA+G SDD+ AGEL + Y+YTIEL D GRYGFLLPP+YI+SVG Q +  + +F E++
Sbjct:   83 LKNLIGRYNLSYTILQDDLSKEIARQ---SQRRYV-TQLRRTRRSLWRTEHDAYRTVEEIYEAIDRHGRQHSFVNIETLGYTEEGRPLKSLFISKDKSKPIIWIDAGIHAREWIAPAAALYFVDRLL--TRTGQALLRDYQFHILPLVNPDGYAHTHRVDRLWRKNRSHSAGERCLGVDLNRNFPLKWGTGDGSSPQACTEVYRGIKPASELETQGIIHRLTELRGKLILYLSLHSFGQYILTPYGFARYQYPKNYKNMINMGHRIRKAIRERHGFVYQVGSSSDLLYEAAGGSDDFVAGELGVQYAYTIELCDEGRYGFLLPPSYIRSVGRQLWTAVQQFVEHM 421          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: Q86FI7 (Clone ZZD489 mRNA sequence OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 1.085e-109
Identity = 172/369 (46.61%), Postives = 245/369 (66.40%), Query Frame = 2
Query:  182 DLLELFKDRKSGLFL-VSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLIN--RR--QYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWG-ENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            D+  L + + + +++ VS   F  +  +LK+ N+SFEI  N+L + I  E+  N  RR   Y +T  Q+       YY  F EI  +L++ ++  S + +E  G + E R++  VK+S D +KPI+WIDAGIHAREWI+P+TA+ +INKL+    +   LL+ +Q +I+P++NPDGYEYT    R+WRKNR  T  E C G DLNRN+P+ WG  NGASP  CS  ++GS  +SE ET+++I KL  ++  + L+++LHSFGQYI++P+G+S+  +P  Y KLMSMG  V   +Q  +G  YQVGSS+ LLYEA+GA+DDY  GEL+IPY+YTIEL D GRYGFLLPP+YI  VG Q +  L     ++
Sbjct:   74 DIWMLPRHQNTSMYISVSPAGFQNLTNYLKSLNISFEITINNLQKAILDEKRENHLRRMSSYLRTGRQK------PYYKSFNEIIQYLDQLSQMHSHLTVENFGFTAEGRQMKGVKISTDSTKPIIWIDAGIHAREWIAPATALSIINKLMR--PSGQALLKHFQFFIVPVVNPDGYEYTRSKYRLWRKNRAQTEGEVCIGTDLNRNFPFKWGVGNGASPHSCSETYRGSVAASELETQSIIKKLNILQKQIILYLSLHSFGQYILTPFGFSRYNYPPYYQKLMSMGKKVKQMIQNRHGYVYQVGSSSELLYEAAGATDDYVTGELKIPYAYTIELCDEGRYGFLLPPSYIGQVGRQLWTALTVLANDI 434          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A4Z2DPZ0 (Carboxypeptidase A2 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010186 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.122e-109
Identity = 172/369 (46.61%), Postives = 244/369 (66.12%), Query Frame = 2
Query:  182 DLLELFKDRKSGLFL-VSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLIN--RR--QYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWG-ENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            D+  L + + + +++ VS   F  +  +LK+ N+SFEI  N+L + I  E+  N  RR   Y +T  Q+       YY  F EI  +L++ ++  S + +E  G + E R +  VK+S D +KPI+WIDAGIHAREWI+P+TA+ +INKL+    +   LL+ +Q +I+P++NPDGYEYT    R+WRKNR  T  E C G DLNRN+P+ WG  NGASP  CS  ++GS  +SE ET+++I KL  ++  + L+++LHSFGQYI++P+G+S+  +P  Y KLMSMG  V   +Q  +G  YQVGSS+ LLYEA+GA+DDY  GEL+IPY+YTIEL D GRYGFLLPP+YI  VG Q +  L     ++
Sbjct:   40 DIWMLPRHQNTSMYISVSPAGFQNLTNYLKSLNISFEITINNLQKAILDEKRENHLRRMSSYLRTGRQK------PYYKSFNEIIQYLDQLSQMHSHLTVENFGFTAEGRPMKGVKISTDSTKPIIWIDAGIHAREWIAPATALSIINKLMR--PSGQALLKHFQFFIVPVVNPDGYEYTRSKYRLWRKNRAQTEGEVCIGTDLNRNFPFKWGVGNGASPHSCSETYRGSVAASELETQSIIKKLNILQKQIILYLSLHSFGQYILTPFGFSRYNYPPYYQKLMSMGKKVKQMIQNRHGYVYQVGSSSELLYEAAGATDDYVTGELKIPYAYTIELCDEGRYGFLLPPSYIGQVGRQLWTALTVLANDI 400          
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Match: A0A4Z2DQU2 (Carboxypeptidase A2 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010186 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.728e-109
Identity = 172/369 (46.61%), Postives = 244/369 (66.12%), Query Frame = 2
Query:  182 DLLELFKDRKSGLFL-VSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLIN--RR--QYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWG-ENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            D+  L + + + +++ VS   F  +  +LK+ N+SFEI  N+L + I  E+  N  RR   Y +T  Q+       YY  F EI  +L++ ++  S + +E  G + E R +  VK+S D +KPI+WIDAGIHAREWI+P+TA+ +INKL+    +   LL+ +Q +I+P++NPDGYEYT    R+WRKNR  T  E C G DLNRN+P+ WG  NGASP  CS  ++GS  +SE ET+++I KL  ++  + L+++LHSFGQYI++P+G+S+  +P  Y KLMSMG  V   +Q  +G  YQVGSS+ LLYEA+GA+DDY  GEL+IPY+YTIEL D GRYGFLLPP+YI  VG Q +  L     ++
Sbjct:   72 DIWMLPRHQNTSMYISVSPAGFQNLTNYLKSLNISFEITINNLQKAILDEKRENHLRRMSSYLRTGRQK------PYYKSFNEIIQYLDQLSQMHSHLTVENFGFTAEGRPMKGVKISTDSTKPIIWIDAGIHAREWIAPATALSIINKLMR--PSGQALLKHFQFFIVPVVNPDGYEYTRSKYRLWRKNRAQTEGEVCIGTDLNRNFPFKWGVGNGASPHSCSETYRGSVAASELETQSIIKKLNILQKQIILYLSLHSFGQYILTPFGFSRYNYPPYYQKLMSMGKKVKQMIQNRHGYVYQVGSSSELLYEAAGATDDYVTGELKIPYAYTIELCDEGRYGFLLPPSYIGQVGRQLWTALTVLANDI 432          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:103039184])

HSP 1 Score: 232.646 bits (592), Expect = 3.291e-71
Identity = 133/346 (38.44%), Postives = 192/346 (55.49%), Query Frame = 2
Query:  239 IFSEVKAFLKAENVSFEIMKNDLD-RKIKFEQLINRRQYF---KTKFQRTDQGSISY----YMRFVEIKLWLNEKARQVSFM-KLETLGHSEENREIILVKMS--KDDSKPILWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQ 1234
            I +     L   + S   + + LD  KI +  L+   Q+    +TK + TD  S       Y+   +I  W+N+ +++   M ++  +G S E R I ++K+S  +      +W+D GIHAREWISP+  ++ I   L       +  K+L    IY+LP+LNPDGY+YT   NRMWRKNR      DC GVDLNRN+   W   GAS  PCS I+ GS P SE E +AV   L   K  VKL++++HS+ Q ++ PY Y+     R + +L+ +    ++ ++  YG  YQ G+ A  +Y A G SDD+A  +  IPYS+T EL DRG+YGFLLPP  I S  N+
Sbjct:   66 ITTRTDVHLYVHSGSVHHVTHQLDAHKITYSVLLENAQHLIEKQTKNETTDPRSGGMNKDRYLSLEDIYYWINKTSQEYPDMAEMMLIGSSFEKRPIYVLKLSGKRPAVDKAMWMDCGIHAREWISPAFCLYFIKYALTYYNQYSDITKMLNKMDIYVLPVLNPDGYKYTWTTNRMWRKNRSVKEGSDCVGVDLNRNFDAKWCTEGASSFPCSEIYCGSYPESEPEVEAVAKFLRSKKEVVKLYLSIHSYSQMLLFPYSYTY-ELARNHAELLDLAQDAATKIRRFYGNIYQYGAGAKTIYLAPGGSDDWAYNQ-GIPYSFTFELQDRGKYGFLLPPELISSACNE 409          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpa2 (carboxypeptidase A1 [Source:NCBI gene;Acc:103026101])

HSP 1 Score: 231.106 bits (588), Expect = 8.930e-71
Identity = 139/405 (34.32%), Postives = 222/405 (54.81%), Query Frame = 2
Query:   17 IFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDDSK-PILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            +++ +++L+ +A+     + FI D V++I  ++   +  L+E+    D G         +  D    + + S  + +  K+FL   N+SF +M N++   +  EQ     +    + +  +  +   Y     I  W++   A   + +    +G S ENR + ++K S   +K P +WIDAGIHAREW+S ++A+++ NK+  +   D +   LL    +Y++ + NPDGY YTH  NRMWRK R   +   C+GVD NRN+   +G  GAS +PCS  + G S  SE E K V++ L +   N K FI++HS+ Q +M PYGYS N  P Q  +L ++G S    L  +YG +Y+VGS   ++Y+ASG S D++  ++ I YS+  EL D GRYGFLLP   I
Sbjct:    3 LYLAVFALLVAAQ---CHKLFIGDQVLRINAESEEQIQLLKELE--DDEGWELDFWTHPVSTDLPVDIHVPSASLHA-AKSFLHLHNISFTVMINNVQELLDEEQ--ESMEVNAMQERSVNSFNFGAYHTLDTIYSWMDTLVAAHANLVSKVHIGFSYENRPMYVLKFSTGGNKRPAIWIDAGIHAREWVSTASAVWMANKMATDYGVDPSVTSLLGRMDVYLMVVTNPDGYAYTHTSNRMWRKTRSINAGSVCRGVDPNRNWDAGFGGPGASKNPCSDSYHGPSAQSEIEVKNVVD-LVKNHGNFKAFISIHSYSQLLMYPYGYSCNNIPDQ-AELGTVGRSAVQALSSLYGTSYRVGSICRIIYQASGGSIDWSY-DIGIKYSFAFELRDTGRYGFLLPANQI 396          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpa2 (carboxypeptidase A1 [Source:NCBI gene;Acc:103026101])

HSP 1 Score: 231.106 bits (588), Expect = 8.930e-71
Identity = 139/405 (34.32%), Postives = 222/405 (54.81%), Query Frame = 2
Query:   17 IFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDDSK-PILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
            +++ +++L+ +A+     + FI D V++I  ++   +  L+E+    D G         +  D    + + S  + +  K+FL   N+SF +M N++   +  EQ     +    + +  +  +   Y     I  W++   A   + +    +G S ENR + ++K S   +K P +WIDAGIHAREW+S ++A+++ NK+  +   D +   LL    +Y++ + NPDGY YTH  NRMWRK R   +   C+GVD NRN+   +G  GAS +PCS  + G S  SE E K V++ L +   N K FI++HS+ Q +M PYGYS N  P Q  +L ++G S    L  +YG +Y+VGS   ++Y+ASG S D++  ++ I YS+  EL D GRYGFLLP   I
Sbjct:    3 LYLAVFALLVAAQ---CHKLFIGDQVLRINAESEEQIQLLKELE--DDEGWELDFWTHPVSTDLPVDIHVPSASLHA-AKSFLHLHNISFTVMINNVQELLDEEQ--ESMEVNAMQERSVNSFNFGAYHTLDTIYSWMDTLVAAHANLVSKVHIGFSYENRPMYVLKFSTGGNKRPAIWIDAGIHAREWVSTASAVWMANKMATDYGVDPSVTSLLGRMDVYLMVVTNPDGYAYTHTSNRMWRKTRSINAGSVCRGVDPNRNWDAGFGGPGASKNPCSDSYHGPSAQSEIEVKNVVD-LVKNHGNFKAFISIHSYSQLLMYPYGYSCNNIPDQ-AELGTVGRSAVQALSSLYGTSYRVGSICRIIYQASGGSIDWSY-DIGIKYSFAFELRDTGRYGFLLPANQI 396          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: cpb1 (carboxypeptidase B1 [Source:NCBI gene;Acc:103027518])

HSP 1 Score: 206.068 bits (523), Expect = 3.459e-61
Identity = 117/325 (36.00%), Postives = 179/325 (55.08%), Query Frame = 2
Query:  263 LKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNE-KARQVSFMKLETLGHSEENREIILVKMSKDD--SKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQ 1219
            L    + +E++ +DL   +   Q+ +R Q        T     + Y  +  I+ W+    +   + +   T+G+S E R + L+K+ K +  +KP ++ID GIHAREWISP+   + + + +    +D     LL    +++LP+ N DGYE+T   +RMWRK R   S   C G D NRN+   W   GAS  PCS  + GS+P SE E K V N +   K+ +K ++T+HS+ Q ++ PY Y K      + +L+S+  + S+ L+ +YG  Y  G  A  +Y A+G SDD+A  +L I YSYT EL D GRYGFLLP + I+
Sbjct:   81 LDQSGMDYEVLIHDLQDALN-GQMDSRIQ--------TKSHDYTKYNSWSTIQGWITSITSANPTLISRTTIGNSYEGRPMHLLKIGKSNGSTKPAIFIDCGIHAREWISPAFCQWFVKEAVSTYGSDAQMTSLLNQMDVFVLPVFNMDGYEHTWSSDRMWRKTRSKRSGSSCIGADPNRNFDAGWCTLGASSTPCSDTYCGSTPESEIEVKNVANFIRNNKSIIKAYLTIHSYSQLLLFPYSY-KYGLAADHAELLSVAEAASTALRSLYGTKYTSGPGATTIYPAAGGSDDWAY-DLGIKYSYTFELRDTGRYGFLLPESQIK 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Match: CPA1 (carboxypeptidase A1-like [Source:NCBI gene;Acc:103029000])

HSP 1 Score: 201.06 bits (510), Expect = 3.627e-59
Identity = 131/413 (31.72%), Postives = 216/413 (52.30%), Query Frame = 2
Query:   65 AKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSE---VKAFLKAENVSFEIMKNDLDRKIKFEQ--LINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQ-VSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            AK+SF+ D V++I  ++ + L  L+E+S        + L L    +  +  L +  ++ F     V+AFL    + + IM  DL   +  EQ  +IN R     + + TD    + Y    EI  ++    R+  + +    +G S E R + ++K S   ++P LWID GIH+REW++ ++  +   K++     D     +L+ + I++  + NPDG++YTH  NRMWRK R   S   C GVD NRN+   +G +G+S  PCS  ++G    SE E KA+++   +   N+K F+++HS+ Q ++ PYGY++     Q  +L  +     + L+ +YG +Y+ GS    +Y+ASG + D+   +  I YSYT EL D G YGFLLP   I     + +  L+   E+  N
Sbjct:   24 AKESFVGDQVLRITAKSETELVLLKELS------QLEHLKLDFWTEPVEESLPVDIRVPFHSLQPVRAFLAYHEIHYNIMIEDLQALVDMEQREMINTR---APEPRSTDDFDYANYHTLSEINSFIELLVRENPNLVSKVVIGQSYEGRALNVLKFSTGANRPGLWIDTGIHSREWVTQASGTWFAKKIVTGYGTDAALTAILDKFDIFLEIVTNPDGFQYTHSSNRMWRKTRKPNSGSSCVGVDPNRNWDAGFGGSGSSNSPCSETYRGPYAHSEPEVKAIVD-FVKSHGNLKAFVSIHSYSQMLLYPYGYTRTPCKDQ-AELHELAKKAVTDLKSLYGTSYKYGSIITTIYQASGGTIDWTYDQ-GIKYSYTFELRDTGLYGFLLPARQIIPTAEETWLALMAIMEHTKN 424          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: cpa5 (carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-020514-1])

HSP 1 Score: 133.265 bits (334), Expect = 8.811e-35
Identity = 82/251 (32.67%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  533 KPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSN 1276
            +P  W     H R  +   T I++  KL+     D     LL     Y   + NPDGY YTHE +RMWRK R   S   C G D NRN+   +G  G+S   C+  ++G S  SE E +A++N   +    +K F+ +HS+ Q ++ P+GY KN     + +L++   S  + L  +Y   Y  G     +Y+ASG S D+     ++ YSY  EL D GRYGF+LP   I     + +  +    E++ +
Sbjct:  177 RPWRWFATKNHHRRRVLRXTGIWIAKKLVSEYGQDSAITSLLNTMDWYFEIVANPDGYVYTHERDRMWRKTRSQYSGNSCVGTDPNRNFAAGFGGPGSSSSSCTETYRGPSVHSESEVQAIVN-FVQAHPEIKSFLDIHSYSQMLIFPFGY-KNELAPDHTELLAK--SAVTALTSLYNTKYTYGPIITTIYQASGGSIDWTYEAAKVRYSYCFELRDTGRYGFILPANQILPTAQETWLAIKVIAEHVRD 423          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: cpz (carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-090313-267])

HSP 1 Score: 57.3806 bits (137), Expect = 4.507e-9
Identity = 39/149 (26.17%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  380 QGSISYYMRFVEIKLWLNEKARQVS-FMKLETLGHSEENREIILVKMSKDDSK-----PILWIDAGIHAREWISP----STAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHE-VNRMWRKNRVSTSYEDCKGVDLNRNYP 793
            +G++  + R  E+   L    +      +L ++G S ENR+++++++S++  K     P + +   IH  E +      + A  L  +L + D+   +LL   +++ILP +NPDGYE   + V+        S+   + + +DLNRN+P
Sbjct:  174 RGAVLRHRRHAEMTRALRRAEKSCGGAARLYSIGKSFENRDLLVIELSENPGKHELLVPEVRLVGNIHGNEVLGRELLVALAQHLCARLEDGDERVRRLLNTTRLHILPSMNPDGYELAADSVSGSVANAADSSGRNNMQNIDLNRNFP 322          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Match: CPXM2 (carboxypeptidase X, M14 family member 2 [Source:HGNC Symbol;Acc:HGNC:26977])

HSP 1 Score: 50.0618 bits (118), Expect = 7.782e-7
Identity = 62/247 (25.10%), Postives = 109/247 (44.13%), Query Frame = 2
Query:  428 LNEKARQVSFMKLETLGHSEENREIILVKMSKDDSK-----PILWIDAGIHAREWISPSTAIFLINKLLE--NDKNSM--KLLEDYQIYILPLLNPDGYEYTHEVN---RMWRKNRVSTSYEDCKGVDLNRNYP----YHW-GENGAS-----PD---PCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFP-RQYYKLMSMGTSVSSFLQEMYGRTYQVGSSAN 1090
            +NEK   V+  ++  +G S E  ++  +++S +  +     P     AG+H  E +     +FL+  L    N  N    +L+E+ +I++LP +NPDGYE  +E       W   R + +     G+DLN N+P      W  EN        P+   P    F   + +   ET+AV++ + +I     L   LH  G  ++  Y +   R P R +    +    +  +L  +Y  T++  + AN
Sbjct:  196 VNEKCPNVT--RIYNIGKSHEGLKLYAMEISDNPGEHEIGEPEFRYVAGVHGNEALGRELTLFLMEFLCHEYNRGNPRIRRLVEETRIHLLPSVNPDGYEKAYEAGSELSGWTFGRWTRN-----GIDLNHNFPDLNSVLWDAENRGHVSHGVPNHHLPLPDWFHSRNATVAVETRAVVSWMEKIP--FVLGGNLH--GGELVVTYPFDAAREPWRAHEPSATPDEQIFRWLAFLYASTHRTMTDAN 431          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Yeast
Match: ECM14 (Putative metalloprotease with similarity to zinc carboxypeptidases; required for normal cell wall assembly [Source:SGD;Acc:S000001174])

HSP 1 Score: 156.377 bits (394), Expect = 2.694e-43
Identity = 98/302 (32.45%), Postives = 155/302 (51.32%), Query Frame = 2
Query:  416 IKLWLNEKARQV-SFMKLETLGHSEENREIILVKMS--KDDSKP---ILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKL--FITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSAN------LLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            I +WL+   R   S + +E LG + E RE+  + +S  K +S P    + I  GIHAREWIS ST  + + +LL    + K   K L+D    ++P+ NPDGY YT   +R+WRKNR  T    C G+D++ ++ + W +  A    CS  + G +P    E  A    + E K + K+  +I +HS+ Q I+ PY YS +  PR    L+ +   +S  ++   GR Y V S+             +G++ D+     R  +++ ++L D G +GFLLPP  I+ VG + +  L  F + L
Sbjct:  127 IYMWLDLLERSFPSLVAVEHLGRTFEGRELKALHISGNKPESNPEKKTIVITGGIHAREWISVSTVCWALYQLLNRYGSSKKETKYLDDLDFLVIPVFNPDGYAYTWSHDRLWRKNRQRTHVPQCLGIDIDHSFGFQWEK--AHTHACSEEYSGETPFEAWEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSKSGRNYDVISACKDRGSDIFPGLGAGSALDFMYHH-RAHWAFQLKLRDTGNHGFLLPPENIKPVGKETYAALKYFCDFL 425          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO43305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY0])

HSP 1 Score: 201.83 bits (512), Expect = 3.068e-60
Identity = 113/353 (32.01%), Postives = 190/353 (53.82%), Query Frame = 2
Query:  242 FSEVKAFLKAENVSFEIMKNDLDRKIKFEQL-INRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIIL-VKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVST-----SYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            + +V   L    + F I   DL  ++  E+L + R + F + ++  D+         +E ++      + ++ + + T+G + E   ++  +K      KP+ +++ GIHAREWI+P+T +++I + +    +DK+  ++L+     I+P+LN DGY YT   NRMWRK R          + C G D NRN+ Y WG  GAS +PCS  F+G +  SE E   V   L  +   VK ++ +H++ Q+ M P+GY+     + + +LM +       +++ YG  Y+ GSS+N++Y+ SG+S DY  G L I YS+ +EL D GRYGFLLPP  I     + F+ +I   + +
Sbjct:   52 YGDVARHLDKNGLKFAIQIIDLQSEVDNEKLTLGRSEGFFSGYKPLDK---------IEDEMRRLAGVQTLAQVTMNTVGSTYEGPNLVFQIKGRSLPEKPVFFMNCGIHAREWITPATCMYIITQFITKYRSDKSVTEVLDKMDFIIMPVLNADGYVYTWTGNRMWRKTRKPNIQSWWGQKTCYGTDPNRNWGYKWGLPGASSNPCSDTFRGKTAQSEVEVDNVAKFLKGLGPRVKGYMDIHAYSQFWMIPWGYTTAN-AKDHKELMRVSKIGVDAIRQTYGTAYRYGSSSNIIYKNSGSSKDYTYGHLNIKYSFALELRDTGRYGFLLPPGQILPTALETFNGIIAMAKAM 394          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH7])

HSP 1 Score: 189.119 bits (479), Expect = 9.535e-57
Identity = 104/278 (37.41%), Postives = 165/278 (59.35%), Query Frame = 2
Query:  452 SFMKLETLGHSEENREIILVKMSKD-DSKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPD-PCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PDRGR-YGFLLPPTYIQSVGNQFFHTLIKFTE 1264
            S + L   G + E R+I  +K+     +KPI +I+ GIH+REWIS ST +++  KL++   N+    +++E ++  ILP+ N DGY YT+  +RMWRKN+ +     C G DLNRN+ YHWG  G++P+ PCS I+ GS P SE ET+ V   L + +  ++ ++  HS+GQ  MSP+G++K +FP  Y +      +V   ++ ++G  +  G S+ ++Y  SG + D+  G L + +SY +EL P     YGF LPP+ I  VG +    L + +E
Sbjct:   10 STVSLVDFGKTYEGRKIYGLKVGTIYANKPIFFINCGIHSREWISISTCMYVARKLVQTYPNNSRVQQMVEKFEWIILPVFNVDGYIYTNNRDRMWRKNK-NPGVGGCMGTDLNRNFNYHWGGIGSAPNKPCSPIYPGSRPFSEVETRNVARYLYKKRKRLRAYVDFHSYGQLWMSPWGFTK-KFPPNYRRHARAMNAVVKAIKRVHGTEFTYGPSSIMIYPTSGDATDWTFGVLGVTHSYGVELRPGLSDLYGFFLPPSSIIPVGKETLQGLKRLSE 285          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO45321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT36])

HSP 1 Score: 189.119 bits (479), Expect = 1.066e-56
Identity = 98/285 (34.39%), Postives = 157/285 (55.09%), Query Frame = 2
Query:  428 LNEKARQVS-FMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLL---ENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            ++   RQ S    ++ LG++ E R +  VK+S    K   +++ GIHAREWI+ +T ++++N++L     D+    +L+     I+P+LN DGY YTH  NRMWRK R    Y  C G D NRN+ + WG  G S DPC   ++G  P SE E   V   L   + ++  ++ +H++ Q  M+ +G+++   P    K+   G      L+++YG  Y++G S+ ++Y  SG + D+A G L I YSY +EL D G+YGF+LP   I   G + F  +    + +
Sbjct:    1 MDNLVRQHSQLATMQNLGNTYEGRPMKAVKISSGRGKKTFFMNCGIHAREWITQATCMYMLNQILYKYGKDQTVTAMLDKMDFVIMPILNVDGYVYTHTHNRMWRKTR--KPYGGCYGADPNRNWSFKWGGVGTSSDPCRDTYRGPRPFSEVEALNVARYLYRNRKSLIGYMDIHAYSQLWMTSWGFNRAYPPAYNTKVKPAGQKAVEALRKVYGTHYRLGPSSIIIYATSGGTMDWATGVLGIEYSYGLELRDEGKYGFVLPANQILPTGVETFAAIKAMVQEM 283          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46954 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM7])

HSP 1 Score: 181.415 bits (459), Expect = 1.520e-52
Identity = 111/361 (30.75%), Postives = 188/361 (52.08%), Query Frame = 2
Query:  227 VSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRF-------VEIKLWLNEKARQVSFMKLETLGHS--EENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRT-YQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            V+   +  +   L A  + F +   D+ R      L++++     K     + S S+Y  +        E+K   N   R  + +++ T+G S   ++++ I +K  +  +KP+ +++ GIHAREW+SP+T +++  +LL     D N   +L+     I+P+LNPDGY +T E  R WRK     S   C G D NRN+ Y WG  GAS DPC+  ++G    SE E   V   L ++   +K ++ +H++ Q+ M P+G+++    + Y +LM +  + +  ++     T Y+VG S+ ++Y  SG S DY  G L I YS+ +EL D G+ GFLLPP  I     + F+ +I   + +
Sbjct:   45 VTAHAYKRLARHLSANRIPFTLQIPDVQR------LVDQQ-----KMATAGRASASWYSTYHTLDQIYAELKNLYNTYYRNGN-VRVFTVGKSYNGKDQKAIEIKGKRARNKPVFFMNCGIHAREWVSPATCMYIAKQLLSRYGKDANVTSVLDKMDFVIMPVLNPDGYVFTWERQRFWRKTLKPNSGTFCVGTDPNRNWDYKWGAEGASTDPCADDYRGPHAFSEIEIVNVAKYLKKLGDRIKGYMDIHAYSQFWMIPWGHTQTP-SKDYQELMRVSKAGAEAIRSSGDNTVYKVGPSSTVIYVNSGGSKDYTYGALGIKYSFALELRDTGKEGFLLPPEQIIPTALETFNGVIAAAKEM 392          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Match: EDO46924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH8])

HSP 1 Score: 147.517 bits (371), Expect = 3.978e-40
Identity = 101/339 (29.79%), Postives = 160/339 (47.20%), Query Frame = 2
Query:  260 FLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLE-TLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
             L+A ++ F+I+  D    +  E++  R   F +            Y    EI   +   A+  S +    +LG S ENR+ + +K+          ++ G                    ++D +   +L++Y+  ILP+LN DGYEYT   +RMWRK R  T    C GVD NRN+ Y +G  G S + CS+I++G    SEK T  V   L E +  +K +I  H++ Q  +SP+GY+  + P  Y + M   T+  + LQ ++G  Y  G ++  +Y  +G + D+  G L   +SY +EL P     GF+LPP  I   G + F  L     N+
Sbjct:   79 LLEASDMEFKIVVQDFSSMLAQEKVSARSGGFDSD-----------YHSLSEIHAEILALAKAYSSVASNFSLGKSYENRDQLAIKI----------LETG--------------------DSDSDVTDMLDNYEWVILPVLNVDGYEYTRTKDRMWRKTR--TPGTKCVGVDPNRNFNYRFGVTGTSNNECSQIYRGKQAFSEKVTYNVAKFLYENRHRLKGYIDFHAYSQMFLSPWGYTDAK-PSNYTEHMKAMTAAVNALQAVHGTRYVFGPASTTIYPTAGDTTDWTYGVLGCVHSYCVELRPTGNPPGFILPPAQIIPTGQETFAALKALVRNM 373          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpb2 (carboxypeptidase B2 [Source:NCBI gene;Acc:101175299])

HSP 1 Score: 218.779 bits (556), Expect = 2.975e-66
Identity = 113/282 (40.07%), Postives = 167/282 (59.22%), Query Frame = 2
Query:  398 YMRFVEIKLWLNEKAR-QVSFMKLETLGHSEENREIILVKMSKDD--SKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQ 1234
            Y R  +I  WLN  A      +K   +G S E R +  +K+S  D  ++  +WID GIHAREWISP+  ++ ++ +         +L +  +Y+LP++NPDGY+YT   NRMWRKNR  +    C GVDLNRN+  +W   GA P PCS I+ G+ P SE E++AV + L E K +++L+I++HS+ Q ++ PY  +       +  L+ M    +  ++  Y  TY+ G+ A  +Y A G SDD+A  +L I YS+T EL DRG YGFLLPP+ I +  N+
Sbjct:   98 YHRLEDIYDWLNRTAHDNPRTVKTILVGSSHEKRPLYALKLSFSDRPNRKAMWIDCGIHAREWISPAFCLWFVHHVSTVKVEITDILNNMDVYVLPVMNPDGYKYTWTTNRMWRKNRAPSHNPKCVGVDLNRNFDANWCTEGALPYPCSEIYCGAFPESEPESRAVADFLREHKDSIQLYISIHSYSQMLLFPYSCTVEE-AGNHNDLLEMVQEAARKIRTFYRSTYKYGAGAKTIYLAPGGSDDWAY-DLGIKYSFTFELQDRGEYGFLLPPSRIGNACNE 377          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpb1 (carboxypeptidase B1 [Source:NCBI gene;Acc:101169819])

HSP 1 Score: 215.312 bits (547), Expect = 1.015e-64
Identity = 111/271 (40.96%), Postives = 163/271 (60.15%), Query Frame = 2
Query:  425 WLNEKAR-QVSFMKLETLGHSEENREIILVKMSKDD--SKPILWIDAGIHAREWISPSTAIFLINKLLE---NDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQ 1219
            W+N  A    S +  + +G++ E R + L+K+ K    +KP +++D GIHAREWISP+   + + + LE   +D     LL+   +Y+LP+ N DGYEY+H  NRMWRK R   S   C G D NRN+   W   GAS +PCS  F GS+P SE E K V + + + K+++K ++T+HS+ Q ++ PY YS N     + +LMS+    S+ L  +YG  Y  G  A+ +Y A+G SDD+A  +L + YSYT EL D G +GFLLP + I+
Sbjct:  127 WINSIASSNPSLVSKQVIGNTFEGRPMTLLKLGKSSGTTKPSIFLDCGIHAREWISPAFCQWFVKEALETYGSDSQMTSLLDQMDVYVLPVFNIDGYEYSHTTNRMWRKTRSKLSGSSCLGTDPNRNFDAGWCTVGASSNPCSETFCGSTPESEIEVKNVADFIRKNKSSIKAYLTIHSYSQLLLFPYSYSYN-LAADHSELMSVAQGASAALTSLYGTRYTSGPGASTIYLAAGGSDDWAY-DLGVKYSYTFELRDTGYHGFLLPESQIK 395          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpa4 (carboxypeptidase A2 [Source:NCBI gene;Acc:101159188])

HSP 1 Score: 198.749 bits (504), Expect = 1.025e-58
Identity = 125/346 (36.13%), Postives = 184/346 (53.18%), Query Frame = 2
Query:  242 FSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQV-SFMKLETLGHSEENREIILVKMSKDDS-KPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTE 1264
             S VK F    N+ F I+  +L   I+ E++       + K + T   +   Y     I  W++    Q  + +  E +G S ENR + ++K S   + +P +WID GIH+REW+SP+T ++  NK+  +   D +   LL    IY+L L NPDGY YTH  +RMWRK R   S   C+GVD NRN+   +G  GAS  PCS  + G    SE E K V++ L +   N K FI++H++ Q +M PYGY+      +  +L S+G   +  L  +YG  Y+VG+  N++Y ASG S D++  +  I YS+  EL D G YGFLLP   I    ++ +  L    E
Sbjct:   39 LSSVKDFFLTHNIPFTIIIQNLQGLIEMEKIEMEEN--QKKERSTKNINFGAYHTLETIYSWMDTLVAQYPNLVTKEEIGKSYENRPMYVLKFSTGGANRPAIWIDTGIHSREWVSPATGLWTANKIASDFGSDTSLTSLLNTMDIYMLILANPDGYVYTHTNDRMWRKTRSINSGSSCRGVDPNRNWDAGFGGPGASTSPCSDSYHGPFAHSEIEVKNVVD-LIKSHGNFKSFISVHAYSQLLMYPYGYTCADVADK-AELDSIGREAAQKLTSLYGTYYKVGNICNIIYPASGGSIDWSY-DSGIKYSFAFELRDTGYYGFLLPANQIIPTASETWLALKHILE 379          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: cpa6 (carboxypeptidase A6 [Source:NCBI gene;Acc:101171451])

HSP 1 Score: 196.823 bits (499), Expect = 5.347e-57
Identity = 113/351 (32.19%), Postives = 176/351 (50.14%), Query Frame = 2
Query:  263 LKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKAR-QVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL*NPMDTNF 1303
            L  E + ++++ ++L ++I  E+    R  F  K +   Q     Y    EI+ W+ E  R Q   + L ++G S E R + ++++ K + K  +WID G+HAREWI P+   + + + + +   D    KLL     YI+P+ N DGY Y+   +R WRK R       C+GVD NRN+   W + GAS  PC   + G  P SE E KAV   L + K  +K +I++H++ Q ++ PY Y     P  +  + S  +S    L   YG  Y+ G ++  LY +SG+S D+A     IPY++  EL D G +GFLLP + I+    +    +      L    NP    F
Sbjct:  133 LTDEKIQYQVLISNLQKEI--EKQTGHR--FSRKRRAESQYDYEVYHSLEEIQSWMFEMNRTQPDLVALFSIGKSYEGRPLYVLQLGKGNQKKAVWIDCGVHAREWIGPAFCQWFVKEAINSYQYDSAMTKLLNQLSFYIMPVFNVDGYHYSWNTDRFWRKTRSKIRKFHCRGVDANRNWKVKWCDEGASSHPCDDTYCGPFPESEPEVKAVAKFLRKNKKRIKAYISIHAYAQMLLYPYSYKYAMIP-NFNCVESAASSAVKALYSAYGVRYRYGPASTTLYVSSGSSIDWAYKN-GIPYAFAFELRDTGYFGFLLPESLIKPTCTETTRAVKAIASGLLKKCNPDKDRF 477          
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Match: CPA1 (carboxypeptidase A1 [Source:NCBI gene;Acc:101163471])

HSP 1 Score: 194.897 bits (494), Expect = 7.137e-57
Identity = 132/400 (33.00%), Postives = 207/400 (51.75%), Query Frame = 2
Query:   65 AKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKII--------FSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEI----KLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDS-KPILWIDAGIHAREWISPSTAIFLINKLLEN---DKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYI 1216
             K+ F    V++I  +N + L+ L+++            D+LE   D   G+  VS  +           +K  LK +++S+  M +DL   +  EQ          K + TD  + S Y +  EI     + + E    VS +    +G S E R + ++K S   + +  +WID GIHAREWI+ ++ I+   K++ +   D     +L    I +  + NPDGYEYTH  NR+WRK+R      +C GVDLNRN+   +G  GAS +PCS  + G    SE E K++++   +   N+K FI++H++ Q ++ PYG+++N    Q  +L S+       L  +YG  Y+ GS  + +Y+ASG S D+A  +  I YSYT EL D GR+GFLLP + I
Sbjct:   16 CKELFKGHQVLQIIPKNDAQLAFLKDLE-----------DVLEFELDFWKGVTAVSCPVHVRAPFQFLQLLKRMLKRKDISYVTMIDDLQAVLDEEQKEIELFARSLKPKNTDSFNYSRYHKLSEIYSFQDMLVAENPNLVSKI---VIGQSYEARPLSVLKFSTGGTNRRAIWIDTGIHAREWITQASGIWFAKKIVTDYGRDPILTDILNGMDILLEIVTNPDGYEYTHSTNRLWRKSRKPNPRSNCIGVDLNRNWDSGFGGPGASSNPCSETYHGPRAHSESEVKSIVD-FVKTHGNIKAFISIHAYSQLLLYPYGHTRNPAKDQ-TELDSLAQKAVKDLASLYGTRYRYGSIISTIYQASGGSIDWAYDQ-GIKYSYTFELRDTGRHGFLLPSSQI 398          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000056472.1 (SMESG000056472.1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 422/426 (99.06%), Postives = 422/426 (99.06%), Query Frame = 2
Query:    2 MVNSFIFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL 1279
            MVNSFIFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSK IFSEVKAFLK ENV FEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIK WLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL
Sbjct:    1 MVNSFIFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKNIFSEVKAFLKVENVPFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKQWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENLSNL 426          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000048042.1 (SMESG000048042.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.605e-108
Identity = 152/393 (38.68%), Postives = 247/393 (62.85%), Query Frame = 2
Query:   92 VVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            V+ I  Q   ++S++R+ S   +        +   ++   +   +VS     ++   L  E++S+     +    I  E   NR+  F++ F+         Y+R+ +I+ W+ EK + V++ K    G + ENR++ +VK+SK+DS PI+W+D GIHAREWI+ S+A+F+I+KLL N   + ++L  YQ Y++PL+NPDGYEY+HE +R+WRKNR   ++  C GVD+NRN+P+ WG   +SP+PC   ++G +  SEKE +++I++LT+ K  +KL ++LH+FGQYI+ P+G+S   +P  Y  + S+  S +  LQ  +   Y VG   ++LY ASG+SDD+  G L+IP+S+T+ELPD+G +GF LPP YI+SVG+Q +  +I  T  +
Sbjct:   31 VIDIVPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAREKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSSSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 423          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000048042.1 (SMESG000048042.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.663e-108
Identity = 152/393 (38.68%), Postives = 247/393 (62.85%), Query Frame = 2
Query:   92 VVKIKCQNLSNLSRLREMSFTGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLLPPTYIQSVGNQFFHTLIKFTENL 1270
            V+ I  Q   ++S++R+ S   +        +   ++   +   +VS     ++   L  E++S+     +    I  E   NR+  F++ F+         Y+R+ +I+ W+ EK + V++ K    G + ENR++ +VK+SK+DS PI+W+D GIHAREWI+ S+A+F+I+KLL N   + ++L  YQ Y++PL+NPDGYEY+HE +R+WRKNR   ++  C GVD+NRN+P+ WG   +SP+PC   ++G +  SEKE +++I++LT+ K  +KL ++LH+FGQYI+ P+G+S   +P  Y  + S+  S +  LQ  +   Y VG   ++LY ASG+SDD+  G L+IP+S+T+ELPD+G +GF LPP YI+SVG+Q +  +I  T  +
Sbjct:   28 VIDIVPQRFQDVSKIRKFSKIFENDEISFQFIRPPYRPNSNISVIVSPWAREKLLTLLNEESISYITTIGNYQNLIDREFAENRQAIFQSLFRTGSSSDHIAYLRYQQIEEWIKEKVQGVNYAKFVKFGETYENRKLFMVKLSKNDSLPIVWLDGGIHAREWIATSSALFIIDKLLRNSSETWEILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFPFEWGGASSSPNPCDDQYRGPNAGSEKEIQSIISELTKYKDRIKLVVSLHAFGQYILQPFGFSNEHYPLNYLDMTSVAISAAFDLQTKHDALYLVGRPPDILYPASGSSDDFVVGTLKIPFSFTVELPDQGMHGFTLPPKYIKSVGSQLWDIIITLTSEI 420          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000063633.1 (SMESG000063633.1)

HSP 1 Score: 193.356 bits (490), Expect = 1.919e-56
Identity = 111/344 (32.27%), Postives = 191/344 (55.52%), Query Frame = 2
Query:  251 VKAFLKAENVSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSI-SYYMRFVEIKLWLNEKARQVS-FMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKLLE----NDKNSMKLLEDYQIYILPLLNPDGYEYTHE--VNRMWRKNRVSTSYEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PD-RGRYGFLLPPTYIQSVGNQFFHTLI 1252
            +++ L   N+   I+  +LD  I  E   N  +   ++F+      I +Y+    E   WL   + Q S F+ +  +G S E +++ ++K+S    K  ++ID GIHAREW+  S+ ++++NKL+     N+ +   +L  ++IYILP+ NPDGYE T +   +R+WRKN +      C GVDLNRN+   +G  G S DPC+ ++ GS      ET    + +  IK  +KLF++ H++ Q +++P+ Y++   P    ++M +   ++  + +  G+ Y VGS AN+LY ASG   D+   ++ + YSYT E+ PD + R GF+ P  +I   G++ +  +I
Sbjct:   71 IRSHLAELNLDLRIVNENLDDTISKEIKDNEVKRIHSQFKAAGAAGIETYFAPHKEYNNWLQSLSDQNSKFISVVNIGKSYEGKDMNVIKLSTGPKKETIFIDGGIHAREWLGVSSVVWILNKLVSGFKTNNADVKDILNRFEIYILPITNPDGYEKTRKGGKDRLWRKNTMPVE-NGCLGVDLNRNFDADFGRTGVSSDPCNIVYPGSRAFIAPETINFRDFVLSIKDKLKLFVSFHAYSQLLLTPWAYTQTP-PSDNDEMMRVANLMADSIYKKSGKRYIVGSPANILYAASGGCYDWVK-KIGVKYSYTFEVRPDNQDRSGFVAPVEWISPAGDELYEAII 411          
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Match: SMESG000066311.1 (SMESG000066311.1)

HSP 1 Score: 183.726 bits (465), Expect = 8.630e-53
Identity = 109/344 (31.69%), Postives = 181/344 (52.62%), Query Frame = 2
Query:  278 VSFEIMKNDLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQVSFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIFLINKL----LENDKNSMKLLEDYQIYILPLLNPDGYEYTH-EVNRMWRKNRVSTSYED--CKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLTEIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQEMYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIEL-PD----RGRYGFLLPPTYIQSVGNQFFHTLIKFTENLS 1273
            + ++IM N++ + I  E  +N    F   F  T      ++  + EI  W+N    + SF+   + G S E R++  VK+S   ++  + ++ GIH+REW++ ST  ++I K+    L N+   + LL  + +Y +P+ NPDG  Y+H   NR+WRKNR     +   C GVDLNRN+   +G  G S +PC  +++G +  SE ETK     + ++  N+ LF +LH++ Q+   PYG+  +R P    +L  +    +  L E+    + +GS   LLY A+G S D+   + R+ Y+YT+EL P     RG  GF+ P + I   G + +   I   + +S
Sbjct:   82 IQYKIMINNVQKIIDEETGMNENVKFMKSFSATRPTINDHFADYEEIMDWINYLTVKYSFVSSGSYGKSYEGRDLRYVKISTGQNRKAVLVEGGIHSREWLATSTVTYIIEKMISNILTNNSRIVSLLSKFDVYFIPVFNPDGNVYSHLHGNRLWRKNRRPFPLDGRTCFGVDLNRNFDAQFGVAGTSSNPCDDLYRGPNAFSEPETKHFSIFVKKLGLNLSLFFSLHAYAQFWFVPYGFGFSR-PVDDLELRRVANIGNQALYEVNHERFYIGSPPELLYAAAGGSFDWVKMKARVKYAYTLELRPSRYNVRGSSGFIAPISDISKSGEEVYAGFIATIQAIS 424          
The following BLAST results are available for this feature:
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPO1.018e-6337.95carboxypeptidase O [Source:HGNC Symbol;Acc:HGNC:21... [more]
CPA22.320e-6335.43carboxypeptidase A2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
CPA19.257e-6231.33carboxypeptidase A1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
CPA59.079e-5831.79carboxypeptidase A5 [Source:HGNC Symbol;Acc:HGNC:1... [more]
CPA59.079e-5831.79carboxypeptidase A5 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T06A4.14.573e-7138.20pep chromosome:WBcel235:I:770892:776369:1 gene:WBG... [more]
T06A4.17.459e-6843.97pep chromosome:WBcel235:I:773162:776369:1 gene:WBG... [more]
F02D8.43.060e-6736.69pep chromosome:WBcel235:V:14984893:14987571:1 gene... [more]
F02D8.43.060e-6736.69pep chromosome:WBcel235:V:14984909:14987571:1 gene... [more]
T06A4.33.352e-5941.44pep chromosome:WBcel235:I:763625:768917:1 gene:WBG... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG185851.308e-7334.82gene:FBgn0031929 transcript:FBtr0335489[more]
CG185851.308e-7334.82gene:FBgn0031929 transcript:FBtr0079516[more]
CG85631.934e-7039.87gene:FBgn0035777 transcript:FBtr0332724[more]
CG85631.934e-7039.87gene:FBgn0035777 transcript:FBtr0076852[more]
CG70256.079e-7034.32gene:FBgn0031930 transcript:FBtr0079515[more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb29.753e-6836.92carboxypeptidase B2 (plasma) [Source:ZFIN;Acc:ZDB-... [more]
cpa45.659e-6233.50carboxypeptidase A4 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
cpb11.081e-6032.73carboxypeptidase B1 (tissue) [Source:ZFIN;Acc:ZDB-... [more]
cpb11.081e-6032.73carboxypeptidase B1 (tissue) [Source:ZFIN;Acc:ZDB-... [more]
cpa12.754e-6033.10carboxypeptidase A1 (pancreatic) [Source:ZFIN;Acc:... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb25.829e-6134.78carboxypeptidase B2 [Source:NCBI gene;Acc:595005][more]
pex67.088e-6134.23peroxisomal biogenesis factor 6 [Source:Xenbase;Ac... [more]
slco3a11.036e-5738.49solute carrier organic anion transporter family me... [more]
kpna11.978e-5731.78karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
kpna13.454e-5731.78karyopherin alpha 1 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpa25.967e-6436.18carboxypeptidase A2, pancreatic [Source:MGI Symbol... [more]
Cpa53.976e-6132.93carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:192... [more]
Cpa53.976e-6132.93carboxypeptidase A5 [Source:MGI Symbol;Acc:MGI:192... [more]
Cpb13.839e-5930.75carboxypeptidase B1 (tissue) [Source:MGI Symbol;Ac... [more]
Cpa15.283e-5832.14carboxypeptidase A1, pancreatic [Source:MGI Symbol... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04069|CBPB_ASTAS6.838e-7541.11Carboxypeptidase B OS=Astacus astacus OX=6715 PE=1... [more]
sp|Q0II73|CBPO_BOVIN2.604e-6639.73Carboxypeptidase O OS=Bos taurus OX=9913 GN=CPO PE... [more]
sp|Q504N0|CBPA2_MOUSE4.174e-6336.18Carboxypeptidase A2 OS=Mus musculus OX=10090 GN=Cp... [more]
sp|Q8IVL8|CBPO_HUMAN4.890e-6337.95Carboxypeptidase O OS=Homo sapiens OX=9606 GN=CPO ... [more]
sp|P48052|CBPA2_HUMAN1.114e-6235.43Carboxypeptidase A2 OS=Homo sapiens OX=9606 GN=CPA... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CMC63.414e-11245.82Zinc carboxypeptidase OS=Fasciola hepatica OX=6192... [more]
A0A4E0RXH61.882e-11046.09Subfamily M14A unassigned peptidase OS=Fasciola he... [more]
Q86FI71.085e-10946.61Clone ZZD489 mRNA sequence OS=Schistosoma japonicu... [more]
A0A4Z2DPZ01.122e-10946.61Carboxypeptidase A2 isoform 2 OS=Schistosoma japon... [more]
A0A4Z2DQU22.728e-10946.61Carboxypeptidase A2 isoform 1 OS=Schistosoma japon... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb23.291e-7138.44carboxypeptidase B2 [Source:NCBI gene;Acc:10303918... [more]
cpa28.930e-7134.32carboxypeptidase A1 [Source:NCBI gene;Acc:10302610... [more]
cpa28.930e-7134.32carboxypeptidase A1 [Source:NCBI gene;Acc:10302610... [more]
cpb13.459e-6136.00carboxypeptidase B1 [Source:NCBI gene;Acc:10302751... [more]
CPA13.627e-5931.72carboxypeptidase A1-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cpa58.811e-3532.67carboxypeptidase A5 [Source:ZFIN;Acc:ZDB-GENE-0205... [more]
cpz4.507e-926.17carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
CPXM27.782e-725.10carboxypeptidase X, M14 family member 2 [Source:HG... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ECM142.694e-4332.45Putative metalloprotease with similarity to zinc c... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433053.068e-6032.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468639.535e-5737.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453211.066e-5634.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469541.520e-5230.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469243.978e-4029.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpb22.975e-6640.07carboxypeptidase B2 [Source:NCBI gene;Acc:10117529... [more]
cpb11.015e-6440.96carboxypeptidase B1 [Source:NCBI gene;Acc:10116981... [more]
cpa41.025e-5836.13carboxypeptidase A2 [Source:NCBI gene;Acc:10115918... [more]
cpa65.347e-5732.19carboxypeptidase A6 [Source:NCBI gene;Acc:10117145... [more]
CPA17.137e-5733.00carboxypeptidase A1 [Source:NCBI gene;Acc:10116347... [more]
back to top
BLAST of Peptidase_M14 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056472.10.000e+099.06SMESG000056472.1[more]
SMESG000048042.11.605e-10838.68SMESG000048042.1[more]
SMESG000048042.11.663e-10838.68SMESG000048042.1[more]
SMESG000063633.11.919e-5632.27SMESG000063633.1[more]
SMESG000066311.18.630e-5331.69SMESG000066311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032659 ID=SMED30032659|Name=Peptidase_M14 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1401bp
CATGGTCAATTCCTTTATATTTATAATAATTTATTCATTAGTTTTTTCTG
CTCGCGGGAAACCCGCTAAACAGTCCTTTATAAAAGATTTCGTTGTGAAA
ATTAAATGCCAAAATCTGTCAAATCTCAGTAGGCTAAGGGAAATGAGTTT
CACTGGTGATCTAGGACATAGAGATTCCTTGGATTTATTGGAACTATTTA
AAGACAGAAAATCCGGATTATTTCTTGTCAGTAAGATTATATTCAGTGAA
GTTAAAGCATTTTTAAAGGCTGAAAATGTTTCTTTTGAAATCATGAAAAA
TGATTTAGACAGGAAAATTAAGTTTGAACAGTTGATTAATAGAAGGCAAT
ATTTTAAAACAAAATTTCAAAGAACTGACCAAGGAAGCATTTCTTATTAC
ATGAGATTTGTAGAAATCAAACTATGGTTGAATGAAAAGGCAAGGCAAGT
GAGTTTTATGAAACTAGAAACACTGGGACATTCGGAGGAGAATCGGGAAA
TCATTTTAGTTAAAATGTCAAAAGACGACAGCAAACCAATCTTGTGGATT
GATGCGGGAATTCATGCGAGAGAATGGATTAGCCCATCCACCGCTATATT
TTTAATTAATAAATTATTGGAAAATGATAAAAATTCGATGAAATTGCTTG
AAGATTATCAAATCTATATACTTCCTCTTTTGAATCCGGATGGTTATGAA
TATACGCATGAAGTGAACAGGATGTGGCGAAAAAATAGAGTGTCGACTTC
GTATGAAGATTGTAAAGGAGTTGATTTGAATAGAAACTATCCTTATCATT
GGGGAGAAAATGGTGCTTCCCCTGATCCGTGCTCAAGAATATTTCAAGGA
TCTTCACCTTCATCAGAAAAAGAAACCAAGGCGGTAATTAACAAACTAAC
AGAAATAAAGACAAATGTCAAACTGTTCATCACATTACATTCATTCGGAC
AATACATAATGTCTCCCTATGGGTATTCAAAAAATAGATTCCCAAGACAA
TATTACAAATTGATGTCAATGGGTACAAGCGTCTCTTCTTTCCTCCAAGA
GATGTACGGACGGACATATCAAGTTGGCAGTTCAGCAAATCTTTTATATG
AAGCGTCTGGTGCTTCTGATGACTATGCAGCTGGAGAATTAAGAATCCCG
TATTCTTACACAATCGAATTACCTGATAGAGGAAGATACGGATTTCTGTT
ACCTCCTACGTATATCCAATCCGTTGGCAATCAATTCTTTCATACTTTAA
TTAAGTTCACTGAAAACCTTTCAAATTTATAAAATCCTATGGATACAAAC
TTTTACAAAAAGTAAAATCTATGACAAAATAGTTTTTTACAAATTTCTAA
TGAAAAAACATCAACTCACATTTTTTCTATAATTACCTTTTTAATACGTT
C
back to top

protein sequence of SMED30032659-orf-1

>SMED30032659-orf-1 ID=SMED30032659-orf-1|Name=SMED30032659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=427bp
MVNSFIFIIIYSLVFSARGKPAKQSFIKDFVVKIKCQNLSNLSRLREMSF
TGDLGHRDSLDLLELFKDRKSGLFLVSKIIFSEVKAFLKAENVSFEIMKN
DLDRKIKFEQLINRRQYFKTKFQRTDQGSISYYMRFVEIKLWLNEKARQV
SFMKLETLGHSEENREIILVKMSKDDSKPILWIDAGIHAREWISPSTAIF
LINKLLENDKNSMKLLEDYQIYILPLLNPDGYEYTHEVNRMWRKNRVSTS
YEDCKGVDLNRNYPYHWGENGASPDPCSRIFQGSSPSSEKETKAVINKLT
EIKTNVKLFITLHSFGQYIMSPYGYSKNRFPRQYYKLMSMGTSVSSFLQE
MYGRTYQVGSSANLLYEASGASDDYAAGELRIPYSYTIELPDRGRYGFLL
PPTYIQSVGNQFFHTLIKFTENLSNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000834Peptidase_M14
IPR003146M14A_act_pep
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000834Peptidase M14, carboxypeptidase APRINTSPR00765CRBOXYPTASEAcoord: 158..170
score: 29.73
coord: 310..323
score: 34.34
coord: 179..193
score: 42.31
coord: 256..264
score: 70.3
IPR000834Peptidase M14, carboxypeptidase ASMARTSM00631zn_carbcoord: 133..411
e-value: 2.1E-107
score: 372.8
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 139..411
e-value: 3.2E-82
score: 276.6
IPR000834Peptidase M14, carboxypeptidase APROSITEPS00132CARBOXYPEPT_ZN_1coord: 179..201
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 120..425
e-value: 3.8E-100
score: 337.1
NoneNo IPR availablePANTHERPTHR11705:SF86coord: 73..421
NoneNo IPR availablePANTHERPTHR11705PROTEASE FAMILY M14 CARBOXYPEPTIDASE A,Bcoord: 73..421
NoneNo IPR availableCDDcd03860M14_CP_A-B_likecoord: 133..423
e-value: 2.05136E-123
score: 357.993
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.669
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 131..421