Armadillo repeat-containing protein 6

Overview
NameArmadillo repeat-containing protein 6
Smed IDSMED30032655
Length (bp)1558
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat-containing protein 6 (SMED30032655) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 6 (SMED30032655) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat-containing protein 6 (SMED30032655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 6 (SMED30032655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032655SMESG000039967.1 dd_Smed_v4_1357_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 221.861 bits (564), Expect = 8.897e-66
Identity = 151/488 (30.94%), Postives = 245/488 (50.20%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTK---VENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            ++K I+Q+TF+  V+EN+E F M  + A+ EA  QFE+QGV+L NI+        +         Q            L+E++  ++   V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:    2 VSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGS-------QEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 472          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 221.861 bits (564), Expect = 8.897e-66
Identity = 151/488 (30.94%), Postives = 245/488 (50.20%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTK---VENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            ++K I+Q+TF+  V+EN+E F M  + A+ EA  QFE+QGV+L NI+        +         Q            L+E++  ++   V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:    2 VSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGS-------QEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 472          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 222.246 bits (565), Expect = 1.175e-65
Identity = 154/494 (31.17%), Postives = 247/494 (50.00%), Query Frame = 1
Query:   61 SSMAKMIS----QDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTK---VENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            S+ AKM+S    Q+TF+  V+EN+E F M  + A+ EA  QFE+QGV+L NI+        +         Q            L+E++  ++   V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:   21 STQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGS-------QEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 497          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 222.246 bits (565), Expect = 1.175e-65
Identity = 154/494 (31.17%), Postives = 247/494 (50.00%), Query Frame = 1
Query:   61 SSMAKMIS----QDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTK---VENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            S+ AKM+S    Q+TF+  V+EN+E F M  + A+ EA  QFE+QGV+L NI+        +         Q            L+E++  ++   V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:   21 STQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGS-------QEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 497          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 188.734 bits (478), Expect = 5.940e-54
Identity = 125/399 (31.33%), Postives = 202/399 (50.63%), Query Frame = 1
Query:  325 KVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            +V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:   16 EVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 404          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Fly
Match: CG5721 (gene:FBgn0034315 transcript:FBtr0086771)

HSP 1 Score: 199.519 bits (506), Expect = 9.386e-58
Identity = 143/480 (29.79%), Postives = 242/480 (50.42%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFN--NKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKV 1500
            MAK+ISQDTF++VVKEN+  F M    A  E   QFEAQG+NL NII D S+       +I   +++V  +       L+E    T++   L ++    +  +A+R++A KN     L   L+  +S    N+  L   L  I  L   QPD+ + E +  ++ L+      +    +  + L + C+ HE NRQ ++N+    +        L G     L +++    R L+LDDDIRV FG   E+A+ I  E   L  L++L   Y++     V+ +L  T+  L+VR E C  I + GG+  + E + ++++  ++   +  +L++LA  D VK  I ++    ++ + L+ H  N++        ++ ++LR  E+S +    G+ +++ +A++ H   KH  V R      RN+V+R        +  G+E+ LN+ +K     + + KAALRDLGC V L+E WTG    K+
Sbjct:    1 MAKVISQDTFDDVVKENVVEFSMTPSEAKEETIKQFEAQGINLANIIKDLSVNPQTGQPVI---NETVDKIKEHIGQKLEET---TELLEQLATLDAECKKSLAHRVLAGKNGAHDALITLLEETLSAESPNESVLKKSLEAINSLTHKQPDLFDAEAMAVVLKLLALKVESEEVTLLTLQWLQKACIMHEMNRQNIMNTSALKL-----MKPLLGKGKDRLVRELTAVFRFLVLDDDIRVEFGCAHEHARQIAGE--VLITLVELLPAYQD---PNVLADLLLTIGTLAVRQELCTAIDEAGGLKSVFEIMSSNLDEVRLNREALKLLRALAGQDSVKSHIVQQGVAPIIKQLLETHQSNENIVAAALACVTTLTLRVQEHSAAFFDTGIAEVIVEALRAHP--KHKIVQRNGAWAIRNMVSRSRNQCETWISFGVEDLLNMAMKEHPSVEQDIKAALRDLGCSVHLREEWTGTAEKKI 462          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Zebrafish
Match: ARMC6 (armadillo repeat containing 6 [Source:NCBI gene;Acc:555425])

HSP 1 Score: 251.136 bits (640), Expect = 5.682e-77
Identity = 158/484 (32.64%), Postives = 261/484 (53.93%), Query Frame = 1
Query:   67 MAKM-ISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII------TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVY--RILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK  I+QDTF++VV+EN++ FDM+   A+ EA  QFE+QGV+L NI+      + +   + +  E++  +      ++     +L +   FT   N             A R +AA+ +   T+ +  +   S  +K  L+  L  +C L  GQPD+++EE   +++ ++      +    +    R +  CCLKHE NRQ L+ +   ++P+    +  +  +  E+ +D C+ LR +  DDD+RV FG   E+AKMIV E N L V+++    + E  +  V+ EL  TL +L+VRNEFCQ I+DLGG+ ++I  L + ++ Q++V    + LK++A ND VK  I    G  L++  ++ H+ N   C  G  AL  ++LR   N + +++ G      QA++ H  + +    +  C+  RN+VAR  +    +LE G E  ++  L   R+C D  +AALRDLGC+V+L+E WTG  G
Sbjct:   12 MAKRRITQDTFDSVVRENIDDFDMEESEALKEAIEQFESQGVDLSNIVKAVPKVSSEENAQDQTHEVLQALESLKSAVSSSSTSVLDDLRLFTDQCNL----------GFAQRYLAAQKDAYPTILSCCQK--SAGDKEALSVALAALCALTDGQPDLLDEEGKLFLIRVLTEHQHQQDAGVVCLCVRTVRNCCLKHENNRQDLVKAG--VLPLLAGSITRY-LQHPEVVRDACVALRVMTFDDDVRVPFGHAHEHAKMIVLEQNGLKVMVEAAKAHPENTS--VLSELCATLSRLAVRNEFCQDIVDLGGLKFMITLLADSLDCQELVKQVLSALKAIAGNDDVKDAIVNAGGAELIVMAMNRHMANAQVCEQGCAALCVLALRKPNNCKVIMESGGALAALQAMKTHPAEANMQ--KQSCMLLRNLVARSRDFTQPILEMGAEALISQALAAHRDCGDVGRAALRDLGCQVELRELWTGTKG 476          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Xenopus
Match: atf5 (activating transcription factor 5 [Source:Xenbase;Acc:XB-GENE-5808898])

HSP 1 Score: 238.039 bits (606), Expect = 5.061e-72
Identity = 149/477 (31.24%), Postives = 254/477 (53.25%), Query Frame = 1
Query:   73 KMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVN 1503
            K ++Q+TF+ +V+ENM  F+M  + A+ EA  QFE+QGV+L NI+      K   DE  +  +  +L         + ++   +++   L       +  +A+R +A +      +    +  +S +++  L N L  +  L  GQPD++     + ++   K+ + D     +  R+    CLKHE NRQ L+ +   I+P+    +   GS + ++ ++ C  LR +  DDDIRV FG   ++AKMIV E   L  L++    + +    GV+ EL  T+ +L VRNEFCQ ++DLGG+++++  L + I+ Q++V    + ++++A ND VK  I    G  L++  +  H+ +   C  G  AL+ ++LR  EN + +++ G      QA++ H   +   V +  C+  RN+V+R  +    +LE G E  +       ++CDD AKAALRDLGCKV+LKE WTG+ G  V+
Sbjct:    6 KWVTQETFDAIVQENMTEFEMDPEEALNEAIQQFESQGVDLTNIV---KAVKKPCDENEVASNHDILQTLESLRKSV-QSSSVSEISELLIKFGDQCKQGLAHRYLAGQKSAYSVILETWR--LSEDDREALLNALYAMSALTEGQPDLLEASGQQLLLQTFKNHAGDAEVILLGTRLTRHVCLKHEQNRQDLVKAG--ILPLLTGAIKTHGSDA-DVVREACSALRIMTFDDDIRVPFGHAHDHAKMIVLENGGLKCLIEAAKAFTD--NPGVLSELCGTVSRLCVRNEFCQDVVDLGGLNFMLALLADCIDHQELVKQVLSAIRAIAGNDDVKDAIVNSGGTDLIVLAMSRHLCSSQICDQGCAALAMLALRKPENCKVIMEGGGALAALQAMKAH--PQDTSVQKQACMVIRNLVSRTRDFSQPILEMGAESLILQARSAHKDCDDVAKAALRDLGCKVELKELWTGQKGSLVH 469          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Xenopus
Match: atf5 (activating transcription factor 5 [Source:Xenbase;Acc:XB-GENE-5808898])

HSP 1 Score: 204.142 bits (518), Expect = 1.941e-59
Identity = 122/377 (32.36%), Postives = 205/377 (54.38%), Query Frame = 1
Query:  373 IAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVN 1503
            +A+R +A +      +    +  +S +++  L N L  +  L  GQPD++     + ++   K+ + D     +  R+    CLKHE NRQ L+ +   I+P+    +   GS + ++ ++ C  LR +  DDDIRV FG   ++AKMIV E   L  L++    + +    GV+ EL  T+ +L VRNEFCQ ++DLGG+++++  L + I+ Q++V    + ++++A ND VK  I    G  L++  +  H+ +   C  G  AL+ ++LR  EN + +++ G      QA++ H   +   V +  C+  RN+V+R  +    +LE G E  +       ++CDD AKAALRDLGCKV+LKE WTG+ G  V+
Sbjct:   71 LAHRYLAGQKSAYSVILETWR--LSEDDREALLNALYAMSALTEGQPDLLEASGQQLLLQTFKNHAGDAEVILLGTRLTRHVCLKHEQNRQDLVKAG--ILPLLTGAIKTHGSDA-DVVREACSALRIMTFDDDIRVPFGHAHDHAKMIVLENGGLKCLIEAAKAFTD--NPGVLSELCGTVSRLCVRNEFCQDVVDLGGLNFMLALLADCIDHQELVKQVLSAIRAIAGNDDVKDAIVNSGGTDLIVLAMSRHLCSSQICDQGCAALAMLALRKPENCKVIMEGGGALAALQAMKAH--PQDTSVQKQACMVIRNLVSRTRDFSQPILEMGAESLILQARSAHKDCDDVAKAALRDLGCKVELKELWTGQKGSLVH 438          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Mouse
Match: Armc6 (armadillo repeat containing 6 [Source:MGI Symbol;Acc:MGI:1924063])

HSP 1 Score: 227.254 bits (578), Expect = 5.878e-68
Identity = 154/474 (32.49%), Postives = 254/474 (53.59%), Query Frame = 1
Query:   70 AKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            +K I+Q+TF+  V+EN+E F+M  + AI EA  QFE+QGV+L NI+  +++ K   D +    H  +  LN L++ L    +   +V  +L       +   A R +AA+ +G   +  A   + + +N+  L   L  +  L  GQPD+++ + L  +V  +  ++ +        R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG   E+AKMIV E   L VL++    + +    GV+ EL  TL +L+VRNEFCQ ++DLGG+  ++  L +  + Q +V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +++ G      QA++ H   +   V +  C+  RN+V+R       +L+ G EE +        +C+D AKAALRDLGC+V+L+E WTGK G
Sbjct:    3 SKRITQETFDAAVRENIEEFEMGTEEAIREAVEQFESQGVDLSNIV--KTIPKVSLDGLQEPTHSVLQALNDLQESLTGSRLQ--EVSAHLVRFCDQCKQQKASRYLAAQ-KGAYPILLAAWQLAATSNQGLLLQALNALAVLTDGQPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHVCLKHEQNRQDLVKAG--VLPLLTAAITQHGQHA-DVVREACWALRVMTFDDDIRVPFGHAHEHAKMIVQENKGLKVLIEAARAFSD--NPGVLSELCSTLSRLAVRNEFCQEVIDLGGLGILVTLLADCNDHQDLVKQVLSALRAIAGNDDVKDAIVRAGGTESIVAAMTRHLASPQVCEQSCAALCVLALRKPDNSRVIIEGGGALAALQAMKAH--PQEAGVQKQACMLIRNLVSRSQVFSKPILDLGAEELILQARAAHPDCEDVAKAALRDLGCRVELRELWTGKKG 464          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Mouse
Match: Armc6 (armadillo repeat containing 6 [Source:MGI Symbol;Acc:MGI:1924063])

HSP 1 Score: 53.5286 bits (127), Expect = 2.374e-8
Identity = 24/46 (52.17%), Postives = 35/46 (76.09%), Query Frame = 1
Query:   70 AKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII 207
            +K I+Q+TF+  V+EN+E F+M  + AI EA  QFE+QGV+L NI+
Sbjct:    3 SKRITQETFDAAVRENIEEFEMGTEEAIREAVEQFESQGVDLSNIV 48          
BLAST of Armadillo repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q8BNU0|ARMC6_MOUSE (Armadillo repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Armc6 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 4.112e-67
Identity = 154/474 (32.49%), Postives = 254/474 (53.59%), Query Frame = 1
Query:   70 AKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            +K I+Q+TF+  V+EN+E F+M  + AI EA  QFE+QGV+L NI+  +++ K   D +    H  +  LN L++ L    +   +V  +L       +   A R +AA+ +G   +  A   + + +N+  L   L  +  L  GQPD+++ + L  +V  +  ++ +        R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG   E+AKMIV E   L VL++    + +    GV+ EL  TL +L+VRNEFCQ ++DLGG+  ++  L +  + Q +V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +++ G      QA++ H   +   V +  C+  RN+V+R       +L+ G EE +        +C+D AKAALRDLGC+V+L+E WTGK G
Sbjct:    3 SKRITQETFDAAVRENIEEFEMGTEEAIREAVEQFESQGVDLSNIV--KTIPKVSLDGLQEPTHSVLQALNDLQESLTGSRLQ--EVSAHLVRFCDQCKQQKASRYLAAQ-KGAYPILLAAWQLAATSNQGLLLQALNALAVLTDGQPDLLDAQGLHLLVATLAQNAANTELTCCGIRCVRHVCLKHEQNRQDLVKAG--VLPLLTAAITQHGQHA-DVVREACWALRVMTFDDDIRVPFGHAHEHAKMIVQENKGLKVLIEAARAFSD--NPGVLSELCSTLSRLAVRNEFCQEVIDLGGLGILVTLLADCNDHQDLVKQVLSALRAIAGNDDVKDAIVRAGGTESIVAAMTRHLASPQVCEQSCAALCVLALRKPDNSRVIIEGGGALAALQAMKAH--PQEAGVQKQACMLIRNLVSRSQVFSKPILDLGAEELILQARAAHPDCEDVAKAALRDLGCRVELRELWTGKKG 464          
BLAST of Armadillo repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q5RD03|ARMC6_PONAB (Armadillo repeat-containing protein 6 OS=Pongo abelii OX=9601 GN=ARMC6 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.548e-66
Identity = 158/492 (32.11%), Postives = 252/492 (51.22%), Query Frame = 1
Query:   61 SSMAKMIS----QDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII-TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALEN--------HINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            S+ AKM+S    Q+TF+  V+EN+E F M  D A+ EA  QFE+QGV+L NI+ T   +    + E    I Q++ DL         +     +V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L +          + Q++V    ++L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:   21 STQAKMVSKRIAQETFDAAVRENIEEFAMGPDEAVKEAVEQFESQGVDLSNIVKTAPKVSADGSQEPTHDILQTLSDLQESVASSRPQ-----EVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDTQGLQLLVATLTRNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHA-DVVREACCALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMGDQSSVQELVKQVLSILRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHSQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 497          
BLAST of Armadillo repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q6NXE6|ARMC6_HUMAN (Armadillo repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=ARMC6 PE=1 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 5.644e-65
Identity = 154/494 (31.17%), Postives = 247/494 (50.00%), Query Frame = 1
Query:   61 SSMAKMIS----QDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTK---VENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK--SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEAL--------ENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            S+ AKM+S    Q+TF+  V+EN+E F M  + A+ EA  QFE+QGV+L NI+        +         Q            L+E++  ++   V  YL       + D A R +AA+      +  A K + +  ++  L   L  +  L  GQPD+++ + L+ +V  +   +D  D     I  R +   CLKHE NRQ L+ +   ++P+    +   G  + ++ ++ C  LR +  DDDIRV FG    +AKMIV E   L VL++    +   +  G++ EL  TL +L++RNEFCQ ++DLGG+  ++  L         +    Q++V    + L+++A ND VK  I +  G   ++  +  H+ +   C     AL  ++LR  +NSR +V+ G      QA++ H  K    V +  C+  RN+VA        +L+ G E  +       R+C+D AKAALRDLGC V+L+E WTG+ G
Sbjct:   21 STQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGS-------QEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWK-LATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGI--RCVRHACLKHEQNRQDLVKAG--VLPLLTGAITHHGHHT-DVVREACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAF--LDNPGILSELCGTLSRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQAMKAHPQKA--GVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALRDLGCHVELRELWTGQRG 497          
BLAST of Armadillo repeat-containing protein 6 vs. UniProt/SwissProt
Match: sp|Q7K486|ARMC6_DROME (Armadillo repeat-containing protein 6 homolog OS=Drosophila melanogaster OX=7227 GN=CG5721 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 9.409e-57
Identity = 143/480 (29.79%), Postives = 242/480 (50.42%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFN--NKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKV 1500
            MAK+ISQDTF++VVKEN+  F M    A  E   QFEAQG+NL NII D S+       +I   +++V  +       L+E    T++   L ++    +  +A+R++A KN     L   L+  +S    N+  L   L  I  L   QPD+ + E +  ++ L+      +    +  + L + C+ HE NRQ ++N+    +        L G     L +++    R L+LDDDIRV FG   E+A+ I  E   L  L++L   Y++     V+ +L  T+  L+VR E C  I + GG+  + E + ++++  ++   +  +L++LA  D VK  I ++    ++ + L+ H  N++        ++ ++LR  E+S +    G+ +++ +A++ H   KH  V R      RN+V+R        +  G+E+ LN+ +K     + + KAALRDLGC V L+E WTG    K+
Sbjct:    1 MAKVISQDTFDDVVKENVVEFSMTPSEAKEETIKQFEAQGINLANIIKDLSVNPQTGQPVI---NETVDKIKEHIGQKLEET---TELLEQLATLDAECKKSLAHRVLAGKNGAHDALITLLEETLSAESPNESVLKKSLEAINSLTHKQPDLFDAEAMAVVLKLLALKVESEEVTLLTLQWLQKACIMHEMNRQNIMNTSALKL-----MKPLLGKGKDRLVRELTAVFRFLVLDDDIRVEFGCAHEHARQIAGE--VLITLVELLPAYQD---PNVLADLLLTIGTLAVRQELCTAIDEAGGLKSVFEIMSSNLDEVRLNREALKLLRALAGQDSVKSHIVQQGVAPIIKQLLETHQSNENIVAAALACVTTLTLRVQEHSAAFFDTGIAEVIVEALRAHP--KHKIVQRNGAWAIRNMVSRSRNQCETWISFGVEDLLNMAMKEHPSVEQDIKAALRDLGCSVHLREEWTGTAEKKI 462          
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Match: A0A433T4L6 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_015760 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.888e-90
Identity = 184/473 (38.90%), Postives = 271/473 (57.29%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLT-ICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTG 1482
            MAK ISQ TF+ VV+ENM  FDM  + A+ +A  QFE+QGVNL  I+ D +++    D   +  H  +  +  +   L    +  T + +YL +IQK    D+A R +A  N     L   LK ++S+     +  C+L+  C LV GQPD++N E +  +++L+K    +     ++ R +   C+KHE NRQ  I   N II +T N L    S+S  L K+IC+ LR+L LDDD+RV FG+  ENAK IVTE + L  +L++C E++   +  V+ E+F TL  L+VR+EFC+  +D GGV   ++A    I  + IV  +  VLK+LA ND+VKVEI K  G+ L+   LDIH  N   C      L+AV+LR L NS+ ++     Q + QA+++H   K  +V +  C+  RN+V R  +    +L  G E+ +N  L   ++ +DEAKA LRDLGCKV+ KE W G
Sbjct:    1 MAKQISQQTFDEVVQENMSEFDMDAEEAVNDAVQQFESQGVNLSIIVKDPTLYG-SGDSGDLQEHPVIAAIKNISSSLENPEVSLTSLTDYLGAIQKECNIDLARRCLAGSNGAYPVL---LKVMVSYQENTDMLKCVLSSFCALVNGQPDLINVEGVDLLISLLKRYKDNPEPLVLIVRAIRLNCIKHESNRQAFIQQ-NLIILLTDN-LKQHKSESS-LIKEICMCLRALTLDDDVRVPFGKAHENAKTIVTEGDALKAILQICEEHENNIS--VLAEMFLTLACLAVRDEFCKETMDRGGVKLTMKAFNGGIKDKGIVRQALIVLKALAGNDEVKVEIAKLGGIELIALALDIHQSNAQICEAACRVLTAVTLRNLNNSKLVMDCYGHQHIVQAMKLHP--KEANVQKYACMALRNLVTRNQQNSTAILSLGAEDIINDALNTHKDVEDEAKAVLRDLGCKVEFKELWKG 462          
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Match: A0A2T7PWP5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00412 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.137e-85
Identity = 177/480 (36.88%), Postives = 268/480 (55.83%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEI----IIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLL-TICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK I+Q TF+NVVKEN+E FDM  + A+ +A  QFE QG+NL NI+ D +++   N       I  +H  +     L   L +   DF  + + L  I+     D+A+R +A  ++   +L   +K +  F+   ++   +L + C L+ GQPD++ E+   + V L+ S   D     +V +++  CC+KHE NRQ  +   N I+ +T  +L         L K+IC  LR    DDD+RV FG+  E+AKMIVTE   L  +LK+C  Y       V+ ELF TL  L+VR+EFC+ +L+LGGV+ I++A E++I  + IV  +  VLKSLA +D VK+   K N + L++  +  H +N +    G G L A++LR  E+   +++    + + Q ++IHA +    V +  C+  RN+V R  E    +LE G E  LN  +   + C+DEAKAALRDL C V LKE WTG+ G
Sbjct:    1 MAKQITQQTFDNVVKENIEEFDMTPEEAVQDAVQQFEIQGINLDNIVKDPTLYGQGNGIGGSGDITSVHPVLEAFQKLNLQLERGQPDFKIISSSLEKIRDECNIDLAHRCLAGNHQAYSSL---MKTLHMFSTDISITKAVLQSFCALLNGQPDLLEEDGSSHFVKLLDSFKSDCEILELVVKVIRLCCVKHEINRQTFVGK-NVIVLLT--ELLTLHQSVPSLVKEICFTLRVFTFDDDVRVPFGKAHEHAKMIVTEGCALKAILKICEVYAH--NVNVLGELFLTLGSLAVRDEFCKEVLNLGGVNLILQAFEHNIGDKAIVRQALVVLKSLAGSDDVKLAAVKLNAVELVVAAMTKHANNAAIAEVGCGVLVALTLRNPEHCARVIECKGHETVVQVMKIHAQEA--GVQKQCCMALRNLVVRTREYNPLILELGAESLLNKAIANHKSCEDEAKAALRDLDCAVQLKELWTGQKG 470          
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Match: A0A1S3H4X2 (armadillo repeat-containing protein 6 OS=Lingula unguis OX=7574 GN=LOC106152074 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.962e-84
Identity = 174/476 (36.55%), Postives = 265/476 (55.67%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVK-SDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK I+Q TF++VV ENM+ FDM  + A+ EA+ QF AQG++L NI+ D S    E        H  V  +  L  +L   +ID T V+  L  I+     D+ +R +A  N+    L    + + S  +K  L  C+  +  L+ GQPD+V++  ++Y  NL+K S+  ++L +A+V R++   C+ HE NRQ  +     +I + ++ L     KS  + K++C  LR L  DDD RV FG+  E+AKMIV E N L V+L+ C  +       V+ ELF TL KL+VRNEFCQ I D GG+  ++  L  +++ Q +   S  +++++A ND VK  I    G+ L++  +  H      C NG  AL  ++LR   +   +V+ G  +++ Q ++IH D     V +  C+  RN+VAR  E    +LE G E  +N+  +  ++C DEAK+ALRDLGCKVDL E W G+ G
Sbjct:    1 MAKRITQKTFDDVVCENMQEFDMSAEEALQEAEQQFLAQGIDLSNIVKDISSHTGEGT-----THPVVAAVQNLSGVLDSGDIDPTTVKAALAQIKTECDIDLPHRCLAGSNKAYPVLFKLCQKLSS--DKELLKCCVDALSSLLNGQPDLVDQTGIEYFTNLLKDSEESEELCEALV-RMIRLTCVMHEKNRQAYVEQN--LISVLISVLTAH-QKSAGIVKEVCFALRVLTFDDDPRVPFGKAHEHAKMIVAEANALKVILETCNGFTG--DVAVLGELFATLSKLAVRNEFCQEIADRGGLQLLMTTLTENMHHQGLAKHSIGLMRTIAGNDNVKAAIVNAGGVELIVGAMGTHQAQPQICENGCAALGTLALRLPPHCAKIVKCGGHEVIIQGMKIHKDVS--AVQKQACMALRNLVARTREYCDPILELGAEGLINLAYQQHKDCTDEAKSALRDLGCKVDLIERWKGERG 461          
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Match: R7UFP9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_184330 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 4.758e-84
Identity = 174/476 (36.55%), Postives = 273/476 (57.35%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYEND---EIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGK 1485
            MAK+ISQ+TF+ VV+EN+E F+M ++ A+ EA +QFEAQGVNL NI+ D S F    D    +I+ + +           +L    DF  V   L  I++    D+A+R +AAK+   I+L   LK       K  L   L  +  L  GQPD++ +E +  +++L++S   + +  A+V +++   C KHE NRQ L++    +I + V+ L+   +  + + K IC  LR+L LDDD+RV FG+  ++AK+IVTE   L  LL L  +Y     + V+ ELF T+  L VRNEFCQ I+DLGG+ +++  LE+ ++ Q +V     VLK+++ ND+VKV I  +NG  L++   D HI   S       A++++ LR   + +  ++  +  ++ +A+Q+HADK    V +  C+  RN+VAR  E     L  G+E+ +   ++   +C DE KAALRDL  KV+L E WTG+
Sbjct:    1 MAKVISQETFDGVVQENVEEFEMSLEDALSEAISQFEAQGVNLANIVKDVSHFSATGDNKHAVIMAVEK---------INILIRGDDFDGVSAELRVIKEECDRDLAHRCLAAKHGAYISLIQCLKG-----QKQILLVTLDALASLTNGQPDVLTDEGVDLLLDLLQSSDPEII--AMVTKVIIHVCTKHETNRQTLVSKD--LITLLVSALERNKTDGRNV-KLICCALRTLTLDDDVRVPFGKSHDHAKLIVTEAGALKKLLNLSADYSA--DKAVLSELFGTISCLVVRNEFCQEIMDLGGLHFVLSTLESSMSHQGLVKQILGVLKAISGNDQVKVAIVAQNGAPLIVTATDKHIKQASVAEMSCSAVASIVLRNPAHCKVFMECQVADVIVKAMQLHADKS--GVQKKACMAVRNLVARSREYSDAFLVLGVEDLIREAIRRHEDCQDEGKAALRDLDLKVNLIERWTGQ 453          
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Match: V3ZPB5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_189885 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.707e-83
Identity = 178/476 (37.39%), Postives = 273/476 (57.35%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPT-LNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK+ISQ+TF++VV+EN+  FDM ++ AI +A +QFE+QGVNL NII + S+F    D+     H+ V+ +  + + L  +  D  K  + L  ++    +D+A R +A KN     L  AL     +  +P  L + L T C LV GQPD+++EE +  +V+ V    +    K +V +++   C+KHE NRQ+ +   N II      L  + S+  +L K+IC+  R L LDDDIRV FG+  E+AKMIVTE + L  ++ +C +Y E     V+ EL+ TL  L+VR+EFC+ +LD+GG+  I+ + E++IN + +     +V+K+LA ND VKV I K  G+ L++  +  H  N      G   L  V+LR   N   +++    Q + QA++IH       V +  C+  RN+VAR  +    + E G+E+ +N         +DEAKAALRDLGCKV+L+E W G+ G
Sbjct:    1 MAKVISQETFDDVVRENISDFDMSVEDAIDDAVSQFESQGVNLLNIIKEPSLFTSGGDQTT---HEVVVAIEKITNCLEGKTTDGLK--DSLQKLKSECDTDLARRCLAGKNGAYPVLMKALD---IYKEEPVWLTDILNTFCSLVNGQPDLLDEEGVTKLVSYVTIFPVSL--KPLVIKLIGFLCVKHEQNRQLFV--LNDIINSLSELLAEYKSQP-DLVKEICVGFRVLTLDDDIRVPFGKAHEHAKMIVTEGDALKRIIDVCKDYCEDSV--VLGELWSTLGCLAVRDEFCREVLDMGGLSLILNSFESNINDKNLTRKCLSVMKALAGNDTVKVSIVKSGGIELIVAAMTKHQTNAFIAEAGCATLMTVALRNPGNCEKIMECNGHQAIVQAMKIHPTSS--GVQKQGCMALRNIVARSRQHCDAITELGVEDVINKARTRHNNLEDEAKAALRDLGCKVELREQWKGEHG 459          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Cavefish
Match: ARMC6 (armadillo repeat containing 6 [Source:NCBI gene;Acc:103032088])

HSP 1 Score: 231.491 bits (589), Expect = 8.209e-70
Identity = 152/486 (31.28%), Postives = 257/486 (52.88%), Query Frame = 1
Query:   67 MAKM-ISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII------TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVN 1503
            MAK  I+Q+TF+ VV+EN++ F+M    A+ EA  QFE+QGV+L +I+      + +   + +  E++  + +S+          +  ++     +  L   Q+Y         +AA+ E   T+ +  ++  +  +K  L+  L  +  L  GQPD+++ E   +++  +++   D     +  + +  CCLKHE NRQ L+ +   ++ +    +     K  E+ K+ C+ LR +  DDD+RV FG   E+AKMIV E N L V+++    + E     V+ EL  TL +L+VRNEFCQ I+DLGG+ +++  L N ++ Q +V    + L+++A ND VK  I    G  L++  ++ H+ N   C  G  AL  ++LR   N + +++ G      QA++ H  +   +V +  C+  RN+VAR  +    +LE G E  +   L   R+C D  +AALRDLGC+V+L+E WTG  G   N
Sbjct:    1 MAKRRITQETFDAVVRENIDEFEMDESEALREAIEQFESQGVDLSSIVKAVPKASSEETTEDQTHEVLQAL-ESLRTALESSSTSMLADLKLFTEQCSLGFAQRY---------LAAQKEAYPTILSCCQS--ADEDKQKLSAALAALSALTDGQPDLLDAEGQGFLIGTLRTHQEDPALTCLAVQTVRHCCLKHEQNRQDLVKAG--VLRLLAGAITKH-VKRPEVVKEACIALRVMTFDDDVRVPFGHAHEHAKMIVLEQNGLKVIVEAAKAHPENMP--VLSELCATLSRLAVRNEFCQDIVDLGGLKFMMTLLANSLDCQDLVKQVLSALRAIAGNDDVKDAIVNAGGTELIVMAINRHLGNGQVCEQGCAALCVLALRKPNNCKVIMESGGALAALQAMKTHPSE--VNVQKQSCMLLRNLVARTRDFSQSILEMGAEALIGQALASHRDCGDVGRAALRDLGCQVELRELWTGNKGSLAN 467          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Cavefish
Match: ARMC6 (armadillo repeat containing 6 [Source:NCBI gene;Acc:103032088])

HSP 1 Score: 191.43 bits (485), Expect = 4.908e-55
Identity = 141/488 (28.89%), Postives = 241/488 (49.39%), Query Frame = 1
Query:   67 MAKM-ISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII------TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHN--QSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVN 1503
            MAK  I+Q+TF+ VV+EN++ F+M    A+ EA  QFE+QGV+L +I+      + +   + +  E++  + +S+          +  ++     +  L   Q+Y         +AA+ E   T+ +  ++  +  +K  L+  L  +  L  GQPD+++ E   +++  +++   D     +  + +  CCLKHE NRQ L+ +   ++ +    +     K  E+ K+ C+ LR +  DDD+RV FG   E+AKMIV E N L V+++    + E     V+ EL  TL +L+VRNEFCQ I+DLGG+ +++  L N ++ Q +V    + L+++A ND VK  I    G  L++  ++ H+ N  + +C+     L  +  RT + S+S+++MG   L+ QA+  H                                              R+C D  +AALRDLGC+V+L+E WTG  G   N
Sbjct:    1 MAKRRITQETFDAVVRENIDEFEMDESEALREAIEQFESQGVDLSSIVKAVPKASSEETTEDQTHEVLQAL-ESLRTALESSSTSMLADLKLFTEQCSLGFAQRY---------LAAQKEAYPTILSCCQS--ADEDKQKLSAALAALSALTDGQPDLLDAEGQGFLIGTLRTHQEDPALTCLAVQTVRHCCLKHEQNRQDLVKAG--VLRLLAGAITKH-VKRPEVVKEACIALRVMTFDDDVRVPFGHAHEHAKMIVLEQNGLKVIVEAAKAHPENMP--VLSELCATLSRLAVRNEFCQDIVDLGGLKFMMTLLANSLDCQDLVKQVLSALRAIAGNDDVKDAIVNAGGTELIVMAINRHLGNGQKQSCM----LLRNLVARTRDFSQSILEMGAEALIGQALASH----------------------------------------------RDCGDVGRAALRDLGCQVELRELWTGNKGSLAN 421          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Sea Lamprey
Match: ARMC6 (armadillo repeat containing 6 [Source:HGNC Symbol;Acc:HGNC:25049])

HSP 1 Score: 228.409 bits (581), Expect = 3.320e-69
Identity = 151/486 (31.07%), Postives = 260/486 (53.50%), Query Frame = 1
Query:   70 AKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVN-LVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQK-----------IVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            +K ISQ+TF+ VV+EN+  F M+ + A+ EA  QFE QGVNL NI+ +  + K  ++E     H+ +  L  +++ L   ++    V   L  +  + + + + R + A +     L +  K  ++  +   L   +L +   + GQPDI++ +  + ++  L +  ++  +  A   R +   C+KHE NRQ L+     ++P+    + + G+ +    ++ C  LR +  DDDIRV FG+  ++AKMIV E + L VL++    Y    +  V+ EL  T+ KL+VRNEFCQ I++LGG+++ +  L ++++ Q            +V +  + L+++AAND VK  +    G  +++  ++ H+ N   C     ALS ++LR  +N R++++ G    + QA++ H ++   +V R  C+  RN+V+R  EL   +LE G E  +         C D AKAALRDLGC V L E WTG+ G
Sbjct:    3 SKRISQETFDGVVRENIAEFSMEPEEALQEAVEQFELQGVNLINIVKE--VPKVASEESADEEHEVLKVLRSVEEALRTTSLAGVTVP--LELLTAHCRKEFSQRHLIALHGAYAVLVSICKEALAQEDTNILTKAVLALAAFLDGQPDILDTDGQELLIKVLSRGPNVSTMEAA--ARAVRASCVKHEANRQALVKLG--VLPLLTGAVAVVGAPNT--VREACAALRVMTFDDDIRVPFGQAHDHAKMIVLENSGLKVLVEASKAYPN--SLPVLSELCATIAKLAVRNEFCQDIVELGGLNFTLALLADYLDHQSYTQDQITGLQDLVKNVLSTLRAIAANDDVKEAVVAAGGTNVIVMAMNHHLGNPQLCEQACAALSVIALRNTQNCRAIIECGGALAILQAMKNHPNEA--NVQRQACMVLRNLVSRTQELCKPLLELGAEPLILQARANHSSCHDAAKAALRDLGCSVKLTELWTGEKG 474          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Nematostella
Match: EDO37627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF56])

HSP 1 Score: 213.386 bits (542), Expect = 2.625e-63
Identity = 156/474 (32.91%), Postives = 242/474 (51.05%), Query Frame = 1
Query:   73 KMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIG--IHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTET--NCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTG 1482
            K ISQ+TF+ VV+EN+E F+M +D A+ +A  QF +QGV+L N+IT      Y  DE   G   H + +     +      N +   +     S Q    S+   R  AA +  I  L ++ K I    +K TL   L      V GQ +I++ E ++++   +K  +  +    +V   +   C+K E NRQ  +      IPI ++ L +    S  + K+ C  LR L  DDD+ V FG+  E+AK IV +   + L  ++++C E  E     VV EL  TL +L VR+EFC+  +D+GG+  +++ LE  I+ Q +V     VL++LA ND VK  I    G+ L++  +  H         G  AL++++LR  +N  +++  G  +++ +A+Q+H       V +  CL  RN+VAR PE    +L AG E  +        E  D AKAALRDL C V+L+E WTG
Sbjct:    5 KKISQETFDAVVRENIEEFEMDLDEAVSDAMEQFVSQGVDLSNLIT-----SYVRDESCEGGLRHSNPVKDALSEIQASSSNDNKDHLIKAFASFQAECNSE-NNRKFAASHNAIPILLSSFKAIKG--DKETLCRGLEAFGTFVNGQANIIDRETIEFLCECLKDSTKQEGLLEVVLICVNHSCIKSESNRQTFVELGT--IPILIDVLGIHKQNSS-VIKETCFVLRVLTFDDDMSVPFGKAHEHAKQIVADNGISALMDVMEVCGENVE-----VVGELCATLGRLFVRDEFCKEFIDIGGLTVMLKILEEKIDHQAVVKQVCFVLRALAGNDDVKKAIVATQGMALIVASMTKHAKQAFVAEQGCAALASIALRMPDNCAAIINAGGHEVILKAMQMHPGV--VGVQKQGCLAIRNLVARNPENCEPILGAGGEAQIRYAYNTYPESHDLAKAALRDLQCDVELRELWTG 460          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Medaka
Match: ARMC6 (armadillo repeat containing 6 [Source:NCBI gene;Acc:101165506])

HSP 1 Score: 214.927 bits (546), Expect = 1.670e-63
Identity = 147/477 (30.82%), Postives = 241/477 (50.52%), Query Frame = 1
Query:   67 MAKM-ISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII-TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK  I+Q+TF+  V+EN+E  +M  D A+ EA  QFE+QGV+L  I+    S F     E    I +++  L   +     E++   ++   L    +      A R +AA+ +    + +  K  +    +  +   L     L  GQPD++  E  + +++ +K    D L       ++  CCLKHE NRQ L+     ++P+    +    ++  EL K+    LR +  DDD+RVTFG   ++AKMIV E N L VL++    Y +     ++ EL   L +L+VRNEFCQ I DLGG+  ++  L ++  S  +     + ++++A ND VK  +    G+ L++  ++ H  N + C  G   LS ++LR  +N   +++ G      QA++ H  +   +V +  C+  RN+VA        +L+ G E  +   ++   +C D  KAALRDLGCKV+L+E WTG  G
Sbjct:    1 MAKRRITQETFDAAVRENVEDLEMDPDEAVREAVEQFESQGVDLSCIVKAGPSEFSDGQGEPTHTILKALDSLRKGR-----ESVSLPEMAEELKCFTEQCSLGFAQRYLAAQKDAYPIILSYCKKSME-EEEEGVATTLSAFAALTDGQPDLLEAEGRQILLDALKKYQGDPLVTRAAVSVVRNCCLKHEQNRQDLVKEG--VLPLLTGAITRH-TRRAELVKEASAALRVMTFDDDVRVTFGHAHDHAKMIVLEHNGLKVLIEAAKAYHDNPP--LLSELCAALSRLAVRNEFCQDICDLGGLKLMMTLLADNYESADLSRQVLSAMRAIAGNDDVKDAVVAAGGVQLIVIVMNKHARNPAVCEQGCACLSVLALRKPKNCTVIMEDGGALAALQAMKDH--QLALNVQKQACMLLRNLVAHMQNYCQPILDMGAETLIGKAVQKHPDCADVGKAALRDLGCKVELRELWTGTHG 464          
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Medaka
Match: ARMC6 (armadillo repeat containing 6 [Source:NCBI gene;Acc:101165506])

HSP 1 Score: 214.927 bits (546), Expect = 1.670e-63
Identity = 147/477 (30.82%), Postives = 241/477 (50.52%), Query Frame = 1
Query:   67 MAKM-ISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNII-TDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMG 1491
            MAK  I+Q+TF+  V+EN+E  +M  D A+ EA  QFE+QGV+L  I+    S F     E    I +++  L   +     E++   ++   L    +      A R +AA+ +    + +  K  +    +  +   L     L  GQPD++  E  + +++ +K    D L       ++  CCLKHE NRQ L+     ++P+    +    ++  EL K+    LR +  DDD+RVTFG   ++AKMIV E N L VL++    Y +     ++ EL   L +L+VRNEFCQ I DLGG+  ++  L ++  S  +     + ++++A ND VK  +    G+ L++  ++ H  N + C  G   LS ++LR  +N   +++ G      QA++ H  +   +V +  C+  RN+VA        +L+ G E  +   ++   +C D  KAALRDLGCKV+L+E WTG  G
Sbjct:    1 MAKRRITQETFDAAVRENVEDLEMDPDEAVREAVEQFESQGVDLSCIVKAGPSEFSDGQGEPTHTILKALDSLRKGR-----ESVSLPEMAEELKCFTEQCSLGFAQRYLAAQKDAYPIILSYCKKSME-EEEEGVATTLSAFAALTDGQPDLLEAEGRQILLDALKKYQGDPLVTRAAVSVVRNCCLKHEQNRQDLVKEG--VLPLLTGAITRH-TRRAELVKEASAALRVMTFDDDVRVTFGHAHDHAKMIVLEHNGLKVLIEAAKAYHDNPP--LLSELCAALSRLAVRNEFCQDICDLGGLKLMMTLLADNYESADLSRQVLSAMRAIAGNDDVKDAVVAAGGVQLIVIVMNKHARNPAVCEQGCACLSVLALRKPKNCTVIMEDGGALAALQAMKDH--QLALNVQKQACMLLRNLVAHMQNYCQPILDMGAETLIGKAVQKHPDCADVGKAALRDLGCKVELRELWTGTHG 464          
BLAST of Armadillo repeat-containing protein 6 vs. Planmine SMEST
Match: SMESG000039967.1 (SMESG000039967.1)

HSP 1 Score: 944.11 bits (2439), Expect = 0.000e+0
Identity = 478/480 (99.58%), Postives = 479/480 (99.79%), Query Frame = 1
Query:   67 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN 1506
            MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVLDLNGLKDLLLKENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNK TLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAI+YRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN
Sbjct:    1 MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVLDLNGLKDLLLKENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKSTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIIYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN 480          
BLAST of Armadillo repeat-containing protein 6 vs. Planmine SMEST
Match: SMESG000039967.1 (SMESG000039967.1)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 475/477 (99.58%), Postives = 476/477 (99.79%), Query Frame = 1
Query:   76 MISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVXXXXXXXXXXXXENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN 1506
            MISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVLDLNGLKDLLLKENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNK TLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAI+YRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN
Sbjct:    1 MISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQSMFKYENDEIIIGIHQSVLDLNGLKDLLLKENIDFTKVENYLNSIQKYYQSDIAYRIMAAKNEGIITLENALKNIISFNNKSTLNNCLLTICYLVTGQPDIVNEEFLKYIVNLVKSDSLDKLGKAIIYRILFQCCLKHEGNRQILINSPNCIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKMIVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDLGGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMIRGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIHADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECDDEAKAALRDLGCKVDLKEPWTGKMGVKVNN 477          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMC68.897e-6630.94armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
ARMC68.897e-6630.94armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
ARMC61.175e-6531.17armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
ARMC61.175e-6531.17armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
ARMC65.940e-5431.33armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG57219.386e-5829.79gene:FBgn0034315 transcript:FBtr0086771[more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ARMC65.682e-7732.64armadillo repeat containing 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atf55.061e-7231.24activating transcription factor 5 [Source:Xenbase;... [more]
atf51.941e-5932.36activating transcription factor 5 [Source:Xenbase;... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Armc65.878e-6832.49armadillo repeat containing 6 [Source:MGI Symbol;A... [more]
Armc62.374e-852.17armadillo repeat containing 6 [Source:MGI Symbol;A... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8BNU0|ARMC6_MOUSE4.112e-6732.49Armadillo repeat-containing protein 6 OS=Mus muscu... [more]
sp|Q5RD03|ARMC6_PONAB1.548e-6632.11Armadillo repeat-containing protein 6 OS=Pongo abe... [more]
sp|Q6NXE6|ARMC6_HUMAN5.644e-6531.17Armadillo repeat-containing protein 6 OS=Homo sapi... [more]
sp|Q7K486|ARMC6_DROME9.409e-5729.79Armadillo repeat-containing protein 6 homolog OS=D... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433T4L62.888e-9038.90Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2T7PWP51.137e-8536.88Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3H4X23.962e-8436.55armadillo repeat-containing protein 6 OS=Lingula u... [more]
R7UFP94.758e-8436.55Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3ZPB51.707e-8337.39Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ARMC68.209e-7031.28armadillo repeat containing 6 [Source:NCBI gene;Ac... [more]
ARMC64.908e-5528.89armadillo repeat containing 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ARMC63.320e-6931.07armadillo repeat containing 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376272.625e-6332.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ARMC61.670e-6330.82armadillo repeat containing 6 [Source:NCBI gene;Ac... [more]
ARMC61.670e-6330.82armadillo repeat containing 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039967.10.000e+099.58SMESG000039967.1[more]
SMESG000039967.10.000e+099.58SMESG000039967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032655 ID=SMED30032655|Name=Armadillo repeat-containing protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1558bp
TTTCAAAGTGATAAGCTTTCTAACCATTAGTTACTAATAAATTGTCGTTA
TTAATAGTGAAGTTCAATGGCTAAAATGATATCTCAAGACACATTTAATA
ATGTGGTTAAAGAAAATATGGAATTATTTGACATGAAAATAGATTCAGCA
ATTATCGAAGCAAAAAATCAATTTGAAGCACAGGGAGTTAATTTATTTAA
TATTATCACTGATCAATCAATGTTTAAATATGAAAATGATGAAATTATTA
TTGGTATACATCAATCAGTTTTAGATTTGAATGGACTGAAAGATTTATTA
TTAAAAGAAAACATTGATTTTACTAAAGTGGAAAATTATTTGAATTCAAT
TCAGAAGTATTATCAATCCGATATTGCATACAGAATAATGGCAGCAAAAA
ATGAAGGGATCATTACCTTAGAAAATGCACTTAAAAACATTATTTCTTTT
AATAATAAGCCGACACTTAATAATTGTTTATTGACAATTTGCTATCTCGT
TACTGGCCAGCCGGATATTGTAAACGAAGAATTTTTAAAATACATTGTAA
ATTTAGTTAAATCTGATTCACTCGACAAGCTCGGTAAAGCAATAGTCTAT
CGAATTCTATTTCAATGCTGTTTGAAACACGAAGGAAATAGGCAAATTTT
AATCAATTCACCGAATTGTATTATTCCCATTACTGTCAATCAGCTTGATT
TGTTTGGTTCTAAATCAAAAGAACTTGCCAAAGATATTTGCTTATTCCTC
CGTAGTTTGATTCTAGATGACGACATCAGAGTGACGTTTGGACGAGGCAC
TGAAAATGCTAAAATGATTGTCACAGAAACTAATTGTCTAGATGTGCTTC
TCAAATTATGCATCGAATACAAGGAAAGAGAAACAGAAGGAGTTGTTGTT
GAGTTGTTCTATACATTGGATAAGTTGTCTGTGAGAAATGAATTCTGTCA
ACGGATTTTGGATTTAGGAGGTGTTGATTATATAATTGAGGCGCTAGAAA
ATCATATCAACTCACAAAAGATTGTCACTTCCTCTTTTGCCGTGTTAAAG
TCTTTAGCAGCGAATGATAAAGTAAAAGTTGAGATTGGCAAGAAAAATGG
TCTCGGTCTAATGATAAGGGGATTGGATATCCATATTCACAACCAAAGCA
CTTGCGTTAATGGGTTTGGAGCACTGTCGGCTGTGTCATTGAGAACCCTG
GAAAACTCCCGCAGTCTAGTGCAAATGGGATTGCCGCAGCTGTTGAAACA
AGCTATTCAAATTCACGCAGACAAAAAGCATTTTGATGTTTTACGACCTG
TTTGTTTAACGACGAGAAATGTTGTTGCAAGATGTCCAGAATTGGTGGCG
GATATGTTGGAGGCAGGCTTGGAGGAATGGTTAAATGTGGTTTTGAAATT
GGGTCGTGAATGTGATGATGAGGCTAAGGCAGCTCTAAGAGATCTTGGTT
GTAAAGTCGATTTGAAGGAACCCTGGACAGGTAAAATGGGAGTGAAAGTA
AATAACTAAATTTTGTTTCTAAAAATAAATGATTTTGTATTAATTCTGAT
GTTTGCAC
back to top

protein sequence of SMED30032655-orf-1

>SMED30032655-orf-1 ID=SMED30032655-orf-1|Name=SMED30032655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=481bp
MAKMISQDTFNNVVKENMELFDMKIDSAIIEAKNQFEAQGVNLFNIITDQ
SMFKYENDEIIIGIHQSVLDLNGLKDLLLKENIDFTKVENYLNSIQKYYQ
SDIAYRIMAAKNEGIITLENALKNIISFNNKPTLNNCLLTICYLVTGQPD
IVNEEFLKYIVNLVKSDSLDKLGKAIVYRILFQCCLKHEGNRQILINSPN
CIIPITVNQLDLFGSKSKELAKDICLFLRSLILDDDIRVTFGRGTENAKM
IVTETNCLDVLLKLCIEYKERETEGVVVELFYTLDKLSVRNEFCQRILDL
GGVDYIIEALENHINSQKIVTSSFAVLKSLAANDKVKVEIGKKNGLGLMI
RGLDIHIHNQSTCVNGFGALSAVSLRTLENSRSLVQMGLPQLLKQAIQIH
ADKKHFDVLRPVCLTTRNVVARCPELVADMLEAGLEEWLNVVLKLGRECD
DEAKAALRDLGCKVDLKEPWTGKMGVKVNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040104ARMC6
IPR011989ARM-like
IPR000225Armadillo
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0002244hematopoietic progenitor cell differentiation
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 79..464
e-value: 9.4E-21
score: 75.9
NoneNo IPR availablePANTHERPTHR22895UNCHARACTERIZEDcoord: 106..473
IPR040104Armadillo repeat-containing protein 6PANTHERPTHR22895:SF0ARMADILLO REPEAT-CONTAINING PROTEIN 6coord: 106..473
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 301..345
score: 9.362
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 88..470