Heterochromatin protein 1-1

Overview
NameHeterochromatin protein 1-1
Smed IDSMED30032645
Length (bp)829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterochromatin protein 1-1 (SMED30032645) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterochromatin protein 1-1 (SMED30032645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterochromatin protein 1-1 (SMED30032645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterochromatin protein 1-1 (SMED30032645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30032645SMESG000004606.1 JN216838smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30032645SMESG000004606.1 JN216838smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30032645SMESG000004606.1 JN216838smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30032645SMESG000004606.1 HP1-1smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30032645SMESG000004606.1 SmedASXL_004476SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032645SMESG000004606.1 SmedASXL_004476SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032645SMESG000004606.1 SMED30032645smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30032645SMESG000004606.1 SMED30032645smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30032645SMESG000004606.1 SMED30032645smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30032645SMESG000004606.1 isotig15327be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v6_928_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v6_928_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30032645SMESG000004606.1 SMESG000004604.1 dd_Smed_v4_928_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30032645SMESG000004606.1 NB.15.8csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 1 cellSMED30032645SMESG000004606.1 NB.15.8csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 162.925 bits (411), Expect = 1.282e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 162.925 bits (411), Expect = 2.021e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 162.925 bits (411), Expect = 2.021e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Match: CBX3 (chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553])

HSP 1 Score: 157.532 bits (397), Expect = 2.308e-47
Identity = 83/174 (47.70%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+  ++NTWEPEENLDCPELI+ F +S+K    K   KR      +S    S    +   K                                +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLV A+EAN+KCPQ+VI FYEERLTWH+
Sbjct:   34 KVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK-------------------------------PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS 176          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Match: CBX3 (chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553])

HSP 1 Score: 157.532 bits (397), Expect = 2.308e-47
Identity = 83/174 (47.70%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+  ++NTWEPEENLDCPELI+ F +S+K    K   KR      +S    S    +   K                                +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLV A+EAN+KCPQ+VI FYEERLTWH+
Sbjct:   34 KVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK-------------------------------PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS 176          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Match: hpl-1 (HP1 Like (Heterochromatin protein); Heterochromatin protein 1 homolog [Source:UniProtKB/TrEMBL;Acc:G5EET5])

HSP 1 Score: 88.1965 bits (217), Expect = 4.006e-21
Identity = 57/171 (33.33%), Postives = 84/171 (49.12%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLT 673
            K++  R+  G  EY++KW+G+P SE +WEP ENL C  +I+++E        K   KR+  +   SP  ++  S+E                              +QP+ S  ++ G     IIG T + GEL FL K+ + +   L+P REANV+ P  VIKFYE RL 
Sbjct:   41 KVLNKRLTRGGSEYYIKWQGFPESECSWEPIENLQCDRMIQEYE--------KEAAKRTTRKRRYSPQPSTSSSAE------------------------------LQPSTSDEWA-GKTLKTIIGITKAPGELHFLCKFSD-DSVHLIPLREANVRFPSQVIKFYETRLV 171          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Match: hpl-2 (Chromo-domain protein; HP1 Like (Heterochromatin protein) [Source:UniProtKB/TrEMBL;Acc:G5EFS9])

HSP 1 Score: 78.5666 bits (192), Expect = 1.343e-17
Identity = 51/177 (28.81%), Postives = 87/177 (49.15%), Query Frame = 2
Query:  161 KIIKVRV-RGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFS-RGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTP 685
            K++  R  + G+ E+ ++W+G+P S+++WEP ENL C E++ +FE  R+   R+   ++   +  +     +D   +   KK T                          N++  FS  G +   I+G T   GEL FL K+ + + A L+PA+E N + P  VI++YE +LT   P
Sbjct:   23 KVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFE--REFSKREKPIRKRHSQKPEPSEDQADPEEDKDEKKET--------------------------NQNDKFSLEGKQLKCIVGLTKGPGELHFLCKFSD-DTARLLPAKEVNSRYPSQVIRYYESKLTIQDP 170          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Match: hpl-2 (Chromo-domain protein; HP1 Like (Heterochromatin protein) [Source:UniProtKB/TrEMBL;Acc:G5EFS9])

HSP 1 Score: 60.8474 bits (146), Expect = 1.355e-10
Identity = 43/159 (27.04%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  161 KIIKVRV-RGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFS-RGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVK 631
            K++  R  + G+ E+ ++W+G+P S+++WEP ENL C E++ +FE  R+   R+   ++   +  +     +D   +   KK T                          N++  FS  G +   I+G T   GEL FL K+ + + A L+PA+E N +
Sbjct:   23 KVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFE--REFSKREKPIRKRHSQKPEPSEDQADPEEDKDEKKET--------------------------NQNDKFSLEGKQLKCIVGLTKGPGELHFLCKFSD-DTARLLPAKEVNSR 152          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Match: hpl-2 (Chromo-domain protein; HP1 Like (Heterochromatin protein) [Source:UniProtKB/TrEMBL;Acc:G5EFS9])

HSP 1 Score: 60.8474 bits (146), Expect = 1.444e-10
Identity = 43/159 (27.04%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  161 KIIKVRV-RGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFS-RGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVK 631
            K++  R  + G+ E+ ++W+G+P S+++WEP ENL C E++ +FE  R+   R+   ++   +  +     +D   +   KK T                          N++  FS  G +   I+G T   GEL FL K+ + + A L+PA+E N +
Sbjct:   23 KVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFE--REFSKREKPIRKRHSQKPEPSEDQADPEEDKDEKKET--------------------------NQNDKFSLEGKQLKCIVGLTKGPGELHFLCKFSD-DTARLLPAKEVNSR 152          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Match: cec-1 (Chromo domain-containing protein cec-1 [Source:UniProtKB/Swiss-Prot;Acc:P34618])

HSP 1 Score: 54.299 bits (129), Expect = 2.293e-8
Identity = 24/54 (44.44%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF---EDSRKLETR 316
            I++ R + GK E+++KW GY H+ N+WEP+EN+  P LI+ F   E +RK E +
Sbjct:   13 ILEHRKKKGKSEFYIKWLGYDHTHNSWEPKENIVDPTLIEAFFTREAARKAEIK 66          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0071284)

HSP 1 Score: 157.147 bits (396), Expect = 8.482e-47
Identity = 85/171 (49.71%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDS---RKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWH 679
            R   G+ EY+LKWKGYP SENTWEP ENLDCP+LI  FE+S    K ET+K     S  E  +S  ++         KKL G                              F RGLEA KI+GATDS+G LMFL+KWK S+ ADLVPA+ AN +CPQVVI+FYEERLTWH
Sbjct:   13 RTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIG------------------------------FERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWH 153          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0309871)

HSP 1 Score: 157.147 bits (396), Expect = 8.482e-47
Identity = 85/171 (49.71%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDS---RKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWH 679
            R   G+ EY+LKWKGYP SENTWEP ENLDCP+LI  FE+S    K ET+K     S  E  +S  ++         KKL G                              F RGLEA KI+GATDS+G LMFL+KWK S+ ADLVPA+ AN +CPQVVI+FYEERLTWH
Sbjct:   13 RTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIG------------------------------FERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWH 153          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Match: HP1b (gene:FBgn0030082 transcript:FBtr0301805)

HSP 1 Score: 157.147 bits (396), Expect = 8.482e-47
Identity = 85/171 (49.71%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDS---RKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWH 679
            R   G+ EY+LKWKGYP SENTWEP ENLDCP+LI  FE+S    K ET+K     S  E  +S  ++         KKL G                              F RGLEA KI+GATDS+G LMFL+KWK S+ ADLVPA+ AN +CPQVVI+FYEERLTWH
Sbjct:   13 RTVNGRTEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESLKNNKKETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIG------------------------------FERGLEASKILGATDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWH 153          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Match: Su(var)205 (gene:FBgn0003607 transcript:FBtr0079635)

HSP 1 Score: 149.443 bits (376), Expect = 3.494e-44
Identity = 82/178 (46.07%), Postives = 115/178 (64.61%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQP----NRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            KII  RVR GK EY+LKWKGYP +ENTWEPE NLDC +LI+Q+E SRK E + +  K+   +   S  +A +      S   T S +  +  +AP   K++      Q     + S GF RGLEA+KI+GA+D+NG L FLI++K  ++A++VP+  AN K P++VI FYEERL+W++
Sbjct:   28 KIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK---DRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYS 202          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Match: Su(var)205 (gene:FBgn0003607 transcript:FBtr0079636)

HSP 1 Score: 149.443 bits (376), Expect = 3.494e-44
Identity = 82/178 (46.07%), Postives = 115/178 (64.61%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQP----NRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            KII  RVR GK EY+LKWKGYP +ENTWEPE NLDC +LI+Q+E SRK E + +  K+   +   S  +A +      S   T S +  +  +AP   K++      Q     + S GF RGLEA+KI+GA+D+NG L FLI++K  ++A++VP+  AN K P++VI FYEERL+W++
Sbjct:   28 KIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK---DRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYS 202          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Match: cbx1b (chromobox homolog 1b (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040625-68])

HSP 1 Score: 166.007 bits (419), Expect = 1.554e-50
Identity = 90/173 (52.02%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSID-EGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PT 688
            RV  GK EY LKWKG+   +NTWEP+ENLDCP+LI +F  S+K  T +S GKR  + +GD                      ++KK K               +P + +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+ PT
Sbjct:   57 RVVKGKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQK--TAESGGKRRAETDGD--------------------GKETKKRKD--------------EPEKLRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPT 193          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Match: cbx1b (chromobox homolog 1b (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040625-68])

HSP 1 Score: 166.007 bits (419), Expect = 1.554e-50
Identity = 90/173 (52.02%), Postives = 113/173 (65.32%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSID-EGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PT 688
            RV  GK EY LKWKG+   +NTWEP+ENLDCP+LI +F  S+K  T +S GKR  + +GD                      ++KK K               +P + +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+ PT
Sbjct:   57 RVVKGKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQK--TAESGGKRRAETDGD--------------------GKETKKRKD--------------EPEKLRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPT 193          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Match: cbx3a (chromobox homolog 3a (HP1 gamma homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-1158])

HSP 1 Score: 162.54 bits (410), Expect = 1.347e-49
Identity = 85/177 (48.02%), Postives = 110/177 (62.15%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTG---KRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK E+FLKWKG+  ++NTWEPEENLDCPELI  F +S+K    K      K S DE +   ++A                + K++   P                 +GF+R LE ++IIGATDS+GELMFL+KWK+S+EADLVPAREAN +CPQ+VI FYEERLTWH+
Sbjct:   26 KVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPELIAAFLESQKGVVEKPEAVKRKSSTDEPETEESKAK---------------RKKEMSDKP-----------------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTWHS 170          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Match: cbx3a (chromobox homolog 3a (HP1 gamma homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-1158])

HSP 1 Score: 162.155 bits (409), Expect = 1.645e-49
Identity = 85/177 (48.02%), Postives = 110/177 (62.15%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTG---KRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK E+FLKWKG+  ++NTWEPEENLDCPELI  F +S+K    K      K S DE +   ++A                + K++   P                 +GF+R LE ++IIGATDS+GELMFL+KWK+S+EADLVPAREAN +CPQ+VI FYEERLTWH+
Sbjct:   23 KVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPELIAAFLESQKGVVEKPEAVKRKSSTDEPETEESKAK---------------RKKEMSDKP-----------------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTWHS 167          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Match: cbx1a (chromobox homolog 1a (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-4945])

HSP 1 Score: 159.073 bits (401), Expect = 9.881e-48
Identity = 80/169 (47.34%), Postives = 105/169 (62.13%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  G+ EY LKWKG+   +NTWEPE+NLDCP+LI ++    K+              DK  + A    S+         P+ +K                 + ++ +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   59 RVVKGRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEYMTKHKIND------------DKKESSAKRKESDTDGGGEDSRPKKRK----------------DEQDKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 199          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Match: zbtb11 (zinc finger and BTB domain containing 11 [Source:Xenbase;Acc:XB-GENE-988913])

HSP 1 Score: 166.777 bits (421), Expect = 5.337e-51
Identity = 89/169 (52.66%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F     L+++KS  +    E  K   R +D  +E G +     P+ KK                 +  + +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDDDNTWEPEENLDCPDLIAEF-----LQSQKSAYESEKTEAGK---RKADSDTEVGEE---SKPKKKK----------------DEVEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 171          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Match: stab2 (stabilin 2 [Source:Xenbase;Acc:XB-GENE-491156])

HSP 1 Score: 160.999 bits (406), Expect = 1.195e-48
Identity = 87/174 (50.00%), Postives = 113/174 (64.94%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EY+LKWKG+  S+NTWEPEENLDCPELI+ F +S+K       GK   D                           +K  S   ++ ++ K K    ++ +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   38 KVLDRRVVNGKVEYYLKWKGFTDSDNTWEPEENLDCPELIEAFLNSQK------AGKEKPDS------------------------NKRKSVSDSESEDSKSKKKRETVDKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVPAKEANVKCPQVVIAFYEERLTWHS 181          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Match: tnfaip6 (TNF alpha induced protein 6 [Source:Xenbase;Acc:XB-GENE-988687])

HSP 1 Score: 150.599 bits (379), Expect = 1.644e-44
Identity = 81/174 (46.55%), Postives = 107/174 (61.49%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  G+ E+ LKWKG+    NTWEP+ NLDCPELI +F   +K +  K T  ++  E  K    + D+             ++KK + +               + ++GF RGLE +KIIGATDS GELMFL+KWK+S+EADLV A+EANVKCPQ+VI FYEERLTWH 
Sbjct:   41 KVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNLDCPELISEF--MKKYKKVKETDPKAKTESTKRKAGSDDI-------------KAKKRRESN--------------DIARGFERGLEPEKIIGATDSCGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTWHA 185          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Match: suv39h2 (suppressor of variegation 3-9 homolog 2 [Source:NCBI gene;Acc:549262])

HSP 1 Score: 56.9954 bits (136), Expect = 8.763e-9
Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF 289
            +   R+  G +++F+KWKG+P S NTWEP  NL CP L+KQF
Sbjct:   48 LCDYRIEKGVEKFFVKWKGWPESCNTWEPTRNLKCPTLLKQF 89          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Match: suv39h2 (suppressor of variegation 3-9 homolog 2 [Source:NCBI gene;Acc:549262])

HSP 1 Score: 56.9954 bits (136), Expect = 9.534e-9
Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF 289
            +   R+  G +++F+KWKG+P S NTWEP  NL CP L+KQF
Sbjct:   48 LCDYRIEKGVEKFFVKWKGWPESCNTWEPTRNLKCPTLLKQF 89          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Match: Cbx1 (chromobox 1 [Source:MGI Symbol;Acc:MGI:105369])

HSP 1 Score: 162.925 bits (411), Expect = 1.387e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Match: Cbx5 (chromobox 5 [Source:MGI Symbol;Acc:MGI:109372])

HSP 1 Score: 159.073 bits (401), Expect = 5.119e-48
Identity = 88/188 (46.81%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF-EDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTNAATTEKVSS 718
            K++  R+  G+ EY LKWKG+    NTWEPE+NLDCPELI +F +  +K++  ++   R   EG+K  +  S+ + +  SKK     QS  +                    ++GF RGLE +KIIGATDS G+LMFL+KWK+++EADLV A+EANVKCPQ+VI FYEERLTWH  P +A   EK S+
Sbjct:   24 KVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKK--KREQSNDI--------------------ARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESA 189          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Match: Cbx5 (chromobox 5 [Source:MGI Symbol;Acc:MGI:109372])

HSP 1 Score: 159.073 bits (401), Expect = 5.119e-48
Identity = 88/188 (46.81%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF-EDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTNAATTEKVSS 718
            K++  R+  G+ EY LKWKG+    NTWEPE+NLDCPELI +F +  +K++  ++   R   EG+K  +  S+ + +  SKK     QS  +                    ++GF RGLE +KIIGATDS G+LMFL+KWK+++EADLV A+EANVKCPQ+VI FYEERLTWH  P +A   EK S+
Sbjct:   24 KVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKK--KREQSNDI--------------------ARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESA 189          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Match: Cbx5 (chromobox 5 [Source:MGI Symbol;Acc:MGI:109372])

HSP 1 Score: 159.073 bits (401), Expect = 5.119e-48
Identity = 88/188 (46.81%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF-EDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTNAATTEKVSS 718
            K++  R+  G+ EY LKWKG+    NTWEPE+NLDCPELI +F +  +K++  ++   R   EG+K  +  S+ + +  SKK     QS  +                    ++GF RGLE +KIIGATDS G+LMFL+KWK+++EADLV A+EANVKCPQ+VI FYEERLTWH  P +A   EK S+
Sbjct:   24 KVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKK--KREQSNDI--------------------ARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESA 189          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Match: Cbx3 (chromobox 3 [Source:MGI Symbol;Acc:MGI:108515])

HSP 1 Score: 157.532 bits (397), Expect = 1.585e-47
Identity = 83/174 (47.70%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+  ++NTWEPEENLDCPELI+ F +S+K    K   KR      +S    S    +   K                                +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLV A+EAN+KCPQ+VI FYEERLTWH+
Sbjct:   34 KVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK-------------------------------PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS 176          
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Match: sp|P83917|CBX1_MOUSE (Chromobox protein homolog 1 OS=Mus musculus OX=10090 GN=Cbx1 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.705e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Match: sp|P83916|CBX1_HUMAN (Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.705e-49
Identity = 88/171 (51.46%), Postives = 111/171 (64.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL--ETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEPEENLDCP+LI +F  S+K   ET KS G +          R +D  SE+  ++     + ++ +                    +GF+RGLE ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   30 RVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGK----------RKADSDSEDKGEESKPKKKKEESEK------------------PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 172          
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Match: sp|Q61686|CBX5_MOUSE (Chromobox protein homolog 5 OS=Mus musculus OX=10090 GN=Cbx5 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.581e-47
Identity = 88/188 (46.81%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF-EDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTNAATTEKVSS 718
            K++  R+  G+ EY LKWKG+    NTWEPE+NLDCPELI +F +  +K++  ++   R   EG+K  +  S+ + +  SKK     QS  +                    ++GF RGLE +KIIGATDS G+LMFL+KWK+++EADLV A+EANVKCPQ+VI FYEERLTWH  P +A   EK S+
Sbjct:   24 KVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKK--KREQSNDI--------------------ARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESA 189          
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Match: sp|P23198|CBX3_MOUSE (Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 1.017e-46
Identity = 83/174 (47.70%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+  ++NTWEPEENLDCPELI+ F +S+K    K   KR      +S    S    +   K                                +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLV A+EAN+KCPQ+VI FYEERLTWH+
Sbjct:   34 KVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK-------------------------------PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS 176          
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Match: sp|Q5R6X7|CBX3_PONAB (Chromobox protein homolog 3 OS=Pongo abelii OX=9601 GN=CBX3 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.108e-46
Identity = 83/174 (47.70%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+  ++NTWEPEENLDCPELI+ F +S+K    K   KR      +S    S    +   K                                +GF+RGL+ ++IIGATDS+GELMFL+KWK+S+EADLV A+EAN+KCPQ+VI FYEERLTWH+
Sbjct:   34 KVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK-------------------------------PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS 176          
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Match: I1ZI80 (Heterochromatin protein 1-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 4.661e-133
Identity = 229/244 (93.85%), Postives = 229/244 (93.85%), Query Frame = 2
Query:    2 FFDKAQVLYIDKXXXXXXXSRKMSETNKEVESANXXXXXXXXXXXXXXXXXXXKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 733
            FFDKA               RKMSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN
Sbjct:   11 FFDKA---------------RKMSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 239          
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Match: M9NKU4 (Heterochromatin protein 1-like protein 1 OS=Schmidtea mediterranea OX=79327 GN=HP1-1 PE=2 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 8.386e-132
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 2
Query:   68 MSETNKEVESANXXXXXXXXXXXXXXXXXXXKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 733
            MSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN
Sbjct:    1 MSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 222          
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Match: A0A5J4NFN9 (Uncharacterized protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0012515 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.946e-60
Identity = 107/219 (48.86%), Postives = 136/219 (62.10%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGK---RSIDEGDKSPTRASDVSSENGSKKLTGSPQS-----------KKLKSAPXXXXXXXXXXXXQPNRS-----------------KGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTG 724
            KI+K R+RGG+KEYFLKWKGYP  +NTWEPEENLDCPELIK FED R  E  KS G    RS    D +  R+   S+ +  +  + SP+            K+  + P       +    +  +S                 +GF RGL+A++IIGATDS+GELMFL+KWK+S+EADLVPAREAN+KCPQVVI+FYEERLTWHTP + AT+   +  G
Sbjct:   33 KILKSRIRGGRKEYFLKWKGYPEEDNTWEPEENLDCPELIKDFEDRRARE--KSVGASPARSSSSTDTAKPRSRPKSTPSTPQNSSTSPKQSVEESLEPPKKKRASAVPTDHGDTTEAVAEESQKSTQEDESKTKTPKSAGKLRGFGRGLKAERIIGATDSSGELMFLMKWKDSDEADLVPAREANIKCPQVVIRFYEERLTWHTPESRATSGGTARAG 249          
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Match: G7YNK4 (Chromobox protein 1 OS=Clonorchis sinensis OX=79923 GN=Cbx5 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.640e-59
Identity = 104/201 (51.74%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLE-------TRKSTG-----KRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXX--------------XXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTP 685
            KI+KVR+RGG+KEYFLKWKGYP  +NTWEPEENLDCPELIK+FE+ R  E        R S+G      RS  +G  S  +++   +E+ S+     P  KK  + P                    +        +++GF RGL+A++IIGATDS+GELMFL+KWK+S+EADLVPAREAN+KCPQVVI+FYEERLTWHTP
Sbjct:   23 KILKVRIRGGRKEYFLKWKGYPDEDNTWEPEENLDCPELIKEFEEKRAREKPVGASPARSSSGGDTGRPRSRPKGAPSTPQSAQKQNEDVSE-----PPKKKRAAVPSDADAAADAAGDDGKPDDDSKTKTPKSAGKTRGFGRGLKAERIIGATDSSGELMFLMKWKDSDEADLVPAREANIKCPQVVIRFYEERLTWHTP 218          
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Match: A0A4E0RWP3 (Chromobox protein 1 (Heterochromatin protein 1 beta) OS=Fasciola hepatica OX=6192 GN=D915_003214 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.706e-59
Identity = 105/206 (50.97%), Postives = 135/206 (65.53%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETR-----------------KSTGKRSIDEGDKSPTRASDVSSENGSKKL-------TGSPQSKKLKSAPXXXXXXXXXXXXQP-NRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATT 703
            KI+KVR++GGKKEYFLKWKGYP  +NTWEPEENLDCPELIK+FED R  E                   ++  K S  +G       S+ ++E   KK         G   ++ +   P   + + K K  +   +++GF RGL+A++IIGATDS+GELMFL+KWK+S+EADLVPAREAN+KCPQVVI+FYEERLTWHTP N  +T
Sbjct:   23 KILKVRIKGGKKEYFLKWKGYPDEDNTWEPEENLDCPELIKEFEDKRAREKTVSASPARSSSSTETSRVRARSKGSTPQGSSPKHSVSEEAAEPPKKKRHSVAPTDNGDAVAENIAEIPKQAEDDTKAKTPKSITKARGFGRGLKAERIIGATDSSGELMFLMKWKDSDEADLVPAREANIKCPQVVIRFYEERLTWHTPENRTST 228          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Match: cbx3a (chromobox protein homolog 3-like [Source:NCBI gene;Acc:103046426])

HSP 1 Score: 165.236 bits (417), Expect = 1.295e-50
Identity = 90/175 (51.43%), Postives = 113/175 (64.57%), Query Frame = 2
Query:  167 IKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRK--LETRKSTGKRS-IDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            I  RV  GK E+FLKWKG+P ++NTWEPEENLDCPELI  F  S+K  +E   S  ++S  DE +         + EN +K+       K+L   P                 +GF+R LE ++IIGATDS+GELMFL+KWK+S+EADLVPAREAN +CPQVVI FYEERLTWH+
Sbjct:   29 IDQRVVNGKVEFFLKWKGFPDTDNTWEPEENLDCPELISAFLTSQKGVVENPDSNKRKSSTDEPE---------TDENSAKR------KKELSEKP-----------------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVIAFYEERLTWHS 171          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Match: cbx3a (chromobox protein homolog 3-like [Source:NCBI gene;Acc:103046426])

HSP 1 Score: 165.236 bits (417), Expect = 1.624e-50
Identity = 90/175 (51.43%), Postives = 113/175 (64.57%), Query Frame = 2
Query:  167 IKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRK--LETRKSTGKRS-IDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            I  RV  GK E+FLKWKG+P ++NTWEPEENLDCPELI  F  S+K  +E   S  ++S  DE +         + EN +K+       K+L   P                 +GF+R LE ++IIGATDS+GELMFL+KWK+S+EADLVPAREAN +CPQVVI FYEERLTWH+
Sbjct:   36 IDQRVVNGKVEFFLKWKGFPDTDNTWEPEENLDCPELISAFLTSQKGVVENPDSNKRKSSTDEPE---------TDENSAKR------KKELSEKP-----------------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVIAFYEERLTWHS 178          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Match: cbx1b (chromobox homolog 1b (HP1 beta homolog Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040625-68])

HSP 1 Score: 165.622 bits (418), Expect = 1.771e-50
Identity = 84/169 (49.70%), Postives = 108/169 (63.91%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            R+  G+ EY LKWKG+   +NTWEPEENLDCP+LI ++  S++  +     +RS  +GD                      QSKK K               +P + +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:   52 RIVKGRVEYLLKWKGFTDEDNTWEPEENLDCPDLIAEYLQSQRNASESGFKRRSDADGD------------------VKESQSKKRKD--------------EPEKLRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 188          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Match: cbx1a (chromobox protein homolog 1-like [Source:NCBI gene;Acc:103037352])

HSP 1 Score: 158.303 bits (399), Expect = 1.582e-47
Identity = 87/175 (49.71%), Postives = 112/175 (64.00%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRK--LETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTN 691
            RV  G+ E+ LKWKG+   +NTWEPE+NLDCP+LI +F  + K   E  K  GKR   E D      +D  +E+  KK                       +  +  + +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+ PT+
Sbjct:   59 RVVKGRTEFLLKWKGFTDEDNTWEPEDNLDCPDLIAEFMQNYKKPREGEKKDGKRK-GESD------NDTGAEDRPKK-----------------------RREEQEKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPTD 203          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Match: cbx1a (chromobox protein homolog 1-like [Source:NCBI gene;Acc:103037352])

HSP 1 Score: 158.303 bits (399), Expect = 1.582e-47
Identity = 87/175 (49.71%), Postives = 112/175 (64.00%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRK--LETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PTN 691
            RV  G+ E+ LKWKG+   +NTWEPE+NLDCP+LI +F  + K   E  K  GKR   E D      +D  +E+  KK                       +  +  + +GF+RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+ PT+
Sbjct:   59 RVVKGRTEFLLKWKGFTDEDNTWEPEDNLDCPDLIAEFMQNYKKPREGEKKDGKRK-GESD------NDTGAEDRPKK-----------------------RREEQEKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPTD 203          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 171.785 bits (434), Expect = 1.262e-53
Identity = 90/169 (53.25%), Postives = 112/169 (66.27%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+ H +NTWEPEENLDCPELI Q+ DS+K   + S       EG K        SS NGS       + ++ K+                +R +GF+RGLE ++IIGATDS+GELMFL+KW++S+EADLVPA+EAN+KCPQVVI FYEERLTWH+
Sbjct:   31 RVVKGKVEYLLKWKGFSHDDNTWEPEENLDCPELITQYLDSQKSTPKHSGASEERGEGQKRK-----ASSLNGSDDGRSKKKKEERKA---------------DDRIRGFTRGLEPERIIGATDSSGELMFLMKWRDSDEADLVPAKEANLKCPQVVISFYEERLTWHS 179          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009664.1 (pep scaffold:Pmarinus_7.0:GL477881:602658:605312:-1 gene:ENSPMAG00000008728.1 transcript:ENSPMAT00000009664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 1.692e-52
Identity = 92/177 (51.98%), Postives = 115/177 (64.97%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTN 691
            K++  RV  GK EY LKWKG+   ENTWEPE+NLDCPELI QF     LE ++   + S  EG+    +A+       S++  G  Q+KK ++                N++KGF RGLE +KIIGATDS+GELMFL+KWK  EEADLVPA+EAN+KCPQVVI FYEERLTW +  N
Sbjct:   52 KVLDRRVMKGKVEYLLKWKGFTDEENTWEPEDNLDCPELINQF-----LERQRQACEVSA-EGNNGKRKAA-------SREDDGDVQAKKHQA--------------DDNKTKGFVRGLEPEKIIGATDSSGELMFLMKWKGCEEADLVPAKEANLKCPQVVISFYEERLTWSSVGN 201          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 159.458 bits (402), Expect = 9.493e-49
Identity = 85/172 (49.42%), Postives = 112/172 (65.12%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKK---LTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  GK EY LKWKG+   +NTWEP+ENLDCP+LI +F     LE  K+ G            R ++  SE+G +K   L G+ ++ + K            +  +  + +GF+RGL+ ++IIGATDS+GELMFL+KWK S+EADLVPA+EANVKCPQ+VI FYEERLTWH 
Sbjct:   51 RVVKGKVEYLLKWKGFGDEDNTWEPDENLDCPDLISEF-----LENYKNKG------------RLAEEKSESGKRKGSSLNGTEEAARTKKK---------KEETKAEQLRGFARGLDPERIIGATDSSGELMFLMKWKGSDEADLVPAKEANVKCPQIVISFYEERLTWHA 196          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 158.688 bits (400), Expect = 2.546e-48
Identity = 84/183 (45.90%), Postives = 111/183 (60.66%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETR---------KSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EY LKWKG+ H +NTWEPE++LDCPELI  + DS KL+ R             +  ++   + P  A +  SE+G  K     ++ +                    R +GF+ GLEA++I+GATD +GELMFL+KWK  +E DLVPA+EANVKCPQVVIKFYEER+TWH 
Sbjct:   33 KVLDRRVVKGKVEYLLKWKGFSHGDNTWEPEDHLDCPELINHYLDSLKLKPRDGGGFGGEVAGGSEERVEAYKRKPAVAFN-GSEDGRAKKKKDDKADE--------------------RIRGFAGGLEAERIVGATDCSGELMFLMKWKGLDETDLVPAKEANVKCPQVVIKFYEERVTWHM 194          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Match: CBX1 (chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551])

HSP 1 Score: 156.377 bits (394), Expect = 8.460e-48
Identity = 91/174 (52.30%), Postives = 112/174 (64.37%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  RV  GK EYFLKWKG+   +NTWEPEENLDCP+LI ++     L T K  GK+ + E DK+       +S NG    TG  ++KK K A                +  GFSRGLE ++IIGATDS+GELMFL+KW  S+EADLVPA+EAN  CPQ+VI FYEERLTWH 
Sbjct:   25 KVMDRRVVKGKVEYFLKWKGFTEEDNTWEPEENLDCPDLISEY-----LGTSK--GKQQVSE-DKAEGTKRKSASLNG----TGDNKAKKKKEAGKV------------GQEIGFSRGLEPERIIGATDSSGELMFLMKWYGSDEADLVPAKEANTSCPQIVISFYEERLTWHA 174          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Match: EDO48908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT1])

HSP 1 Score: 126.331 bits (316), Expect = 1.230e-35
Identity = 70/167 (41.92%), Postives = 101/167 (60.48%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            RV  G  EY LKWKGYP SENTWE EE L CPELI+++E  +K  ++ S         DKS    S  S  +  +K    P+ +K+ +         + +    +     + G EAD I+GAT+ +G++ FLI+WK+++ ADL+P++ AN+K PQ+VIKFYEER+TW
Sbjct:   37 RVINGGIEYLLKWKGYPDSENTWESEEGLQCPELIEEYEKKKKASSKPSNIL------DKSALFISSFS--HSVEKGESKPKKRKVNAYEELGMKAVEVEDASKDDVDPIAEGWEADTILGATEVDGQIHFLIQWKSTDRADLIPSKVANLKWPQIVIKFYEERVTW 195          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Match: EDO27150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA22])

HSP 1 Score: 58.151 bits (139), Expect = 1.755e-11
Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL 307
            I+K RVR GK  YF+KWKGY    NTWEPEEN+  P L+K +++   L
Sbjct:   16 ILKERVRDGKVWYFIKWKGYSQRYNTWEPEENVLDPRLLKAYQERLAL 63          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Match: EDO26587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBM0])

HSP 1 Score: 52.7582 bits (125), Expect = 1.096e-9
Identity = 22/39 (56.41%), Postives = 33/39 (84.62%), Query Frame = 2
Query:  560 LMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            L +L + K+++ ADL+P++ AN+K PQ+VIKFYEER+TW
Sbjct:    1 LFWLFR-KSTDRADLIPSKVANLKWPQIVIKFYEERVTW 38          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Match: EDO40283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7R4])

HSP 1 Score: 56.9954 bits (136), Expect = 1.585e-9
Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKL 307
            I+K RVR GK  YF+KWKGY    NTWEPEEN+  P L+K +++   L
Sbjct:   16 ILKERVRDGKVWYFIKWKGYSQRYNTWEPEENVLDPRLLKAYQERLAL 63          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Match: EDO48308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJQ9])

HSP 1 Score: 53.9138 bits (128), Expect = 2.608e-8
Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  164 IIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDK 355
            I+K R R G+ EY +KW+G+    NTWEP EN+    L+  FE+SR+   +K   +R I E  K
Sbjct:   30 ILKKRTRKGQIEYLVKWRGWSAKYNTWEPAENILDGRLLLAFENSRRRRGKKPRWQRGISETAK 93          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Match: cbx3a (chromobox protein homolog 3 [Source:NCBI gene;Acc:100049459])

HSP 1 Score: 160.229 bits (404), Expect = 9.400e-49
Identity = 84/177 (47.46%), Postives = 111/177 (62.71%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRK-LETRKSTGKR--SIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            K++  R+  GK E++LKWKG+  ++NTWEPEENLDCPELI  F +S+K ++ + +  KR  S DE +  P +          K +   P                          +GF+R LE ++IIGATDS+GELMFL+KWK+S+EADLVPAREAN +CPQVVI FYEERLTWH+
Sbjct:   27 KVLDQRLVNGKVEFYLKWKGFTDADNTWEPEENLDCPELISAFLESQKNIKEKPAAVKRKASTDEPETEPKK----------KDMAEKP--------------------------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQVVISFYEERLTWHS 167          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Match: CBX1 (chromobox protein homolog 1 [Source:NCBI gene;Acc:101170765])

HSP 1 Score: 157.147 bits (396), Expect = 1.951e-47
Identity = 84/172 (48.84%), Postives = 111/172 (64.53%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT-PT 688
            RV  GK E+ LKWKG+   +NTWEPEENLDCP+LI ++     ++  K   ++  +   K+ +  S  + E GSK+                       K  +  +++GF RGL+ ++IIGATDS+GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+ PT
Sbjct:   27 RVVKGKVEFLLKWKGFSEEDNTWEPEENLDCPDLIAEY-----MQKHKEKEEKKKEGKRKAASEGSGEAEERGSKR-----------------------KKEEGEKARGFGRGLQPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPT 170          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Match: CBX1 (chromobox 1 [Source:NCBI gene;Acc:101155967])

HSP 1 Score: 158.688 bits (400), Expect = 4.717e-47
Identity = 83/169 (49.11%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  176 RVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHT 682
            RV  G+ EY LKWKG+   +NTWEPE+NLDCP+LI +F  S+K                         ++ +G +K  G  +    KS           K     + +GF+RGLE ++IIGATDS GELMFL+KWKNS+EADLVPA+EANVKCPQVVI FYEERLTWH+
Sbjct:  118 RVVKGRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEFLQSQK-------------------------AAHDGKRKAAGDAEGDDSKSK---------KKKDDTEKLRGFARGLEPERIIGATDSTGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHS 252          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Match: cbx5 (chromobox 5 [Source:NCBI gene;Acc:101174667])

HSP 1 Score: 155.221 bits (391), Expect = 1.906e-46
Identity = 87/192 (45.31%), Postives = 115/192 (59.90%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDV--SSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNR----SKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSS 718
            K++  RV  G+ E+FLKWKGY    NTWEPE+NLDCPELI +F     ++T K  G      G  +P+  S    +  +G  K +GS + K         +        +       ++GF RGLE +KIIGATDS G+LMFL+KWK+S+EADLV A+EAN KCPQ+VI FYEERLTWH   +    + VS+
Sbjct:   22 KVLDRRVVKGRVEFFLKWKGYSEKHNTWEPEKNLDCPELIAEF-----MKTYKKPG-----SGSATPSTGSSKVNTGSSGRSKESGSLKKKGSDDEEEEDEEGGSKPKKKKEEEILVARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYEERLTWHEDGDKKEKDAVSA 203          
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Match: cbx3b (chromobox protein homolog 3 [Source:NCBI gene;Acc:101159942])

HSP 1 Score: 140.969 bits (354), Expect = 5.552e-41
Identity = 76/176 (43.18%), Postives = 106/176 (60.23%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF---EDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWH 679
            KII+ RV  G+ EYFLKWKG+  +ENTWEPE+NLDCPELI++F     +   E  +   ++++   ++   + +++ SE              L SA        +    Q +     S  LE + IIG+TD  GELMFL+KWKNSE+  L+PAREA+ +CPQVVI FYE++LTWH
Sbjct:   26 KIIRRRVFNGRVEYFLKWKGFTDAENTWEPEDNLDCPELIEEFLRNAPAFPEENEEEQSEQTLVPKEEMTEQETEIFSE--------------LASASHGDGYVLQSDDEQSDAPTDLSNYLEPECIIGSTDRKGELMFLVKWKNSEDVALLPAREASTRCPQVVIDFYEQKLTWH 187          
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Match: SMESG000004606.1 (SMESG000004606.1)

HSP 1 Score: 381.719 bits (979), Expect = 2.332e-135
Identity = 222/222 (100.00%), Postives = 222/222 (100.00%), Query Frame = 2
Query:   68 MSETNKEVESANXXXXXXXXXXXXXXXXXXXKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 733
            MSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN
Sbjct:    1 MSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTWHTPTNAATTEKVSSTGDAN 222          
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Match: SMESG000039690.1 (SMESG000039690.1)

HSP 1 Score: 131.724 bits (330), Expect = 3.066e-34
Identity = 72/172 (41.86%), Postives = 97/172 (56.40%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            KI+K+++  G +++FLKW+G+P SENTWEPEENL+CPELIK+F      E R++   R                     +K   S  S  L+  PV  + +E        + KGF R  E D I+ A   N +LMFL+KWKN + A+LV AR AN++CPQ VI FYE  L W
Sbjct:  599 KILKMKIMNGVRKFFLKWEGFPDSENTWEPEENLECPELIKEF----LAEQRRNKNAR--------------------KRKRLSSADSLALEELPVEVQIKEPVI-----KPKGFPRSREPDCILAAGMMNDQLMFLVKWKNVDMANLVSARRANIECPQTVISFYESHLNW 741          

HSP 2 Score: 57.7658 bits (138), Expect = 3.647e-9
Identity = 20/43 (46.51%), Postives = 34/43 (79.07%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQF 289
            KI+ +++  GK+ +FLKW+G+P SEN+WEPEEN++   ++ +F
Sbjct:  170 KILDMKIENGKRIFFLKWEGFPDSENSWEPEENIESNAMVLEF 212          
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Match: SMESG000055314.1 (SMESG000055314.1)

HSP 1 Score: 105.531 bits (262), Expect = 3.353e-28
Identity = 63/172 (36.63%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            KII V  R GK+ Y LKWK Y  S N+WEPEE+L+C  LIK F  + KL                              K+ T + Q       P+ K           + + GF RGL+   I G T  N  + F+IKW   +E D+VPA +ANVKCPQ+VI+FYE   ++
Sbjct:    9 KIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKL------------------------------KEFTQNFQLPMTIKVPIIK-----------DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 139          
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Match: SMESG000054375.1 (SMESG000054375.1)

HSP 1 Score: 105.531 bits (262), Expect = 3.353e-28
Identity = 63/172 (36.63%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  161 KIIKVRVRGGKKEYFLKWKGYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            KII V  R GK+ Y LKWK Y  S N+WEPEE+L+C  LIK F  + KL                              K+ T + Q       P+ K           + + GF RGL+   I G T  N  + F+IKW   +E D+VPA +ANVKCPQ+VI+FYE   ++
Sbjct:    9 KIIAVSNRNGKRCYLLKWKNYDSSLNSWEPEEHLNCGALIKNFHKNLKL------------------------------KEFTQNFQLPMTIKVPIIK-----------DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 139          
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Match: SMESG000055314.1 (SMESG000055314.1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.308e-19
Identity = 50/149 (33.56%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  230 SENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTRASDVSSENGSKKLTGSPQSKKLKSAPXXXXXXXXXXXXQPNRSKGFSRGLEADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEERLTW 676
            S N+WEPEE+L+C  LIK F  + KL                              K+ T + Q       P+ K           + + GF RGL+   I G T  N  + F+IKW   +E D+VPA +ANVKCPQ+VI+FYE   ++
Sbjct:   11 SLNSWEPEEHLNCGALIKNFHKNLKL------------------------------KEFTQNFQLPMTIKVPIIK-----------DHAYGFDRGLKPQIICGVTKKNDAIYFMIKWDGCDEIDVVPAVQANVKCPQLVIRFYENNFSF 118          
The following BLAST results are available for this feature:
BLAST of Heterochromatin protein 1-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBX11.282e-4951.46chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX12.021e-4951.46chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX12.021e-4951.46chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX32.308e-4747.70chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553][more]
CBX32.308e-4747.70chromobox 3 [Source:HGNC Symbol;Acc:HGNC:1553][more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpl-14.006e-2133.33HP1 Like (Heterochromatin protein); Heterochromati... [more]
hpl-21.343e-1728.81Chromo-domain protein; HP1 Like (Heterochromatin p... [more]
hpl-21.355e-1027.04Chromo-domain protein; HP1 Like (Heterochromatin p... [more]
hpl-21.444e-1027.04Chromo-domain protein; HP1 Like (Heterochromatin p... [more]
cec-12.293e-844.44Chromo domain-containing protein cec-1 [Source:Un... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HP1b8.482e-4749.71gene:FBgn0030082 transcript:FBtr0071284[more]
HP1b8.482e-4749.71gene:FBgn0030082 transcript:FBtr0309871[more]
HP1b8.482e-4749.71gene:FBgn0030082 transcript:FBtr0301805[more]
Su(var)2053.494e-4446.07gene:FBgn0003607 transcript:FBtr0079635[more]
Su(var)2053.494e-4446.07gene:FBgn0003607 transcript:FBtr0079636[more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx1b1.554e-5052.02chromobox homolog 1b (HP1 beta homolog Drosophila)... [more]
cbx1b1.554e-5052.02chromobox homolog 1b (HP1 beta homolog Drosophila)... [more]
cbx3a1.347e-4948.02chromobox homolog 3a (HP1 gamma homolog, Drosophil... [more]
cbx3a1.645e-4948.02chromobox homolog 3a (HP1 gamma homolog, Drosophil... [more]
cbx1a9.881e-4847.34chromobox homolog 1a (HP1 beta homolog Drosophila)... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb115.337e-5152.66zinc finger and BTB domain containing 11 [Source:X... [more]
stab21.195e-4850.00stabilin 2 [Source:Xenbase;Acc:XB-GENE-491156][more]
tnfaip61.644e-4446.55TNF alpha induced protein 6 [Source:Xenbase;Acc:XB... [more]
suv39h28.763e-952.38suppressor of variegation 3-9 homolog 2 [Source:NC... [more]
suv39h29.534e-952.38suppressor of variegation 3-9 homolog 2 [Source:NC... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cbx11.387e-4951.46chromobox 1 [Source:MGI Symbol;Acc:MGI:105369][more]
Cbx55.119e-4846.81chromobox 5 [Source:MGI Symbol;Acc:MGI:109372][more]
Cbx55.119e-4846.81chromobox 5 [Source:MGI Symbol;Acc:MGI:109372][more]
Cbx55.119e-4846.81chromobox 5 [Source:MGI Symbol;Acc:MGI:109372][more]
Cbx31.585e-4747.70chromobox 3 [Source:MGI Symbol;Acc:MGI:108515][more]
back to top
BLAST of Heterochromatin protein 1-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P83917|CBX1_MOUSE9.705e-4951.46Chromobox protein homolog 1 OS=Mus musculus OX=100... [more]
sp|P83916|CBX1_HUMAN9.705e-4951.46Chromobox protein homolog 1 OS=Homo sapiens OX=960... [more]
sp|Q61686|CBX5_MOUSE3.581e-4746.81Chromobox protein homolog 5 OS=Mus musculus OX=100... [more]
sp|P23198|CBX3_MOUSE1.017e-4647.70Chromobox protein homolog 3 OS=Mus musculus OX=100... [more]
sp|Q5R6X7|CBX3_PONAB1.108e-4647.70Chromobox protein homolog 3 OS=Pongo abelii OX=960... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI804.661e-13393.85Heterochromatin protein 1-1 (Fragment) OS=Schmidte... [more]
M9NKU48.386e-132100.00Heterochromatin protein 1-like protein 1 OS=Schmid... [more]
A0A5J4NFN91.946e-6048.86Uncharacterized protein (Fragment) OS=Paragonimus ... [more]
G7YNK42.640e-5951.74Chromobox protein 1 OS=Clonorchis sinensis OX=7992... [more]
A0A4E0RWP33.706e-5950.97Chromobox protein 1 (Heterochromatin protein 1 bet... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx3a1.295e-5051.43chromobox protein homolog 3-like [Source:NCBI gene... [more]
cbx3a1.624e-5051.43chromobox protein homolog 3-like [Source:NCBI gene... [more]
cbx1b1.771e-5049.70chromobox homolog 1b (HP1 beta homolog Drosophila)... [more]
cbx1a1.582e-4749.71chromobox protein homolog 1-like [Source:NCBI gene... [more]
cbx1a1.582e-4749.71chromobox protein homolog 1-like [Source:NCBI gene... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBX11.262e-5353.25chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
ENSPMAT00000009664.11.692e-5251.98pep scaffold:Pmarinus_7.0:GL477881:602658:605312:-... [more]
CBX19.493e-4949.42chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX12.546e-4845.90chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
CBX18.460e-4852.30chromobox 1 [Source:HGNC Symbol;Acc:HGNC:1551][more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489081.230e-3541.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271501.755e-1154.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265871.096e-956.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402831.585e-954.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483082.608e-842.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx3a9.400e-4947.46chromobox protein homolog 3 [Source:NCBI gene;Acc:... [more]
CBX11.951e-4748.84chromobox protein homolog 1 [Source:NCBI gene;Acc:... [more]
CBX14.717e-4749.11chromobox 1 [Source:NCBI gene;Acc:101155967][more]
cbx51.906e-4645.31chromobox 5 [Source:NCBI gene;Acc:101174667][more]
cbx3b5.552e-4143.18chromobox protein homolog 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Heterochromatin protein 1-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004606.12.332e-135100.00SMESG000004606.1[more]
SMESG000039690.13.066e-3441.86SMESG000039690.1[more]
SMESG000055314.13.353e-2836.63SMESG000055314.1[more]
SMESG000054375.13.353e-2836.63SMESG000054375.1[more]
SMESG000055314.11.308e-1933.56SMESG000055314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032645 ID=SMED30032645|Name=Heterochromatin protein 1-1|organism=Schmidtea mediterranea sexual|type=transcript|length=829bp
ATTTTTTGATAAAGCGCAAGTTCTTTATATTGATAAGTTAATTTAACTAT
TAATTTAAAGTAGGAAAATGTCTGAAACAAACAAAGAGGTTGAATCCGCA
AATGTTGAAGAAGGAGAAGGTGATGTTAATGAAGAAGTGGAAGAAGAATT
TCAAGTTGAAAAAATTATTAAAGTAAGAGTCAGAGGTGGAAAGAAAGAAT
ATTTCCTTAAATGGAAAGGTTATCCACATTCTGAAAATACATGGGAACCT
GAAGAAAATTTAGATTGTCCTGAACTAATTAAGCAATTCGAAGATTCCAG
AAAATTAGAAACTAGAAAATCCACAGGAAAGCGATCAATTGATGAAGGTG
ATAAGTCACCAACTAGAGCGTCTGATGTAAGTAGCGAAAATGGTTCTAAA
AAGTTGACTGGTAGTCCCCAATCAAAGAAATTAAAGTCAGCTCCTGTGAC
AAAGAAAACTGAAGAAAAGGGGAAGGTAGTTCAACCTAACCGATCTAAAG
GTTTTTCCAGGGGACTTGAAGCTGACAAAATTATTGGTGCGACTGACTCT
AATGGTGAATTAATGTTTCTAATCAAATGGAAAAATAGTGAAGAAGCCGA
TTTAGTACCTGCCAGAGAAGCTAATGTCAAATGTCCTCAAGTAGTTATAA
AGTTTTACGAAGAGCGTTTAACGTGGCATACTCCTACTAATGCGGCAACA
ACTGAAAAAGTTTCATCTACTGGTGATGCTAATTAGTCAAGAATTTCAAG
ATTAATATAAATAACAATTGTATTTATTAAATGTTTTATGTCTGCAATAT
TAAACGAATATTATTTACTTAAAAAAAAA
back to top

protein sequence of SMED30032645-orf-1

>SMED30032645-orf-1 ID=SMED30032645-orf-1|Name=SMED30032645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MSETNKEVESANVEEGEGDVNEEVEEEFQVEKIIKVRVRGGKKEYFLKWK
GYPHSENTWEPEENLDCPELIKQFEDSRKLETRKSTGKRSIDEGDKSPTR
ASDVSSENGSKKLTGSPQSKKLKSAPVTKKTEEKGKVVQPNRSKGFSRGL
EADKIIGATDSNGELMFLIKWKNSEEADLVPAREANVKCPQVVIKFYEER
LTWHTPTNAATTEKVSSTGDAN*
back to top
Aliases
The feature 'Heterochromatin protein 1-1' has the following synonyms
Synonym
HP1-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000140anterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017984Chromo_dom_subgr
IPR008251Chromo_shadow_dom
IPR000953Chromo/chromo_shadow_dom
IPR023780Chromo_domain
IPR023779Chromodomain_CS
IPR016197Chromo-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus