Smed-Albino

Overview
NameSmed-Albino
Smed IDSMED30032631
Length (bp)2143
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Smed-Albino (SMED30032631) t-SNE clustered cells

Violin plots show distribution of expression levels for Smed-Albino (SMED30032631) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Smed-Albino (SMED30032631) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Smed-Albino (SMED30032631) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032631

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30032631h1SMcG0011123 KX531078.1smed_ncbi_20240424PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30032631h1SMcG0011123 KX531078.1smed_ncbi_20240424PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30032631h1SMcG0011123 KX531078.1smed_ncbi_20240424PMID:27551436
Wang et al., 2016
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30032631h1SMcG0011123 KX531078.1smed_ncbi_20240424PMID:27551436
Wang et al., 2016
FACS sorted cell population asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30032631h1SMcG0011123 KX531078.1smed_ncbi_20240424PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30032631h1SMcG0011123 dd_Smed_v4_6316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032631h1SMcG0011123 dd_Smed_v4_6316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032631h1SMcG0011123 dd_Smed_v4_6316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032631h1SMcG0011123 dd_Smed_v4_6316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032631h1SMcG0011123 dd_Smed_v4_6316_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Smed-Albino vs. Ensembl Human
Match: FOXP1 (forkhead box P1 [Source:HGNC Symbol;Acc:HGNC:3823])

HSP 1 Score: 104.76 bits (260), Expect = 4.415e-23
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1047 IKPIKRASS---NSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S   N  +S      ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  245 VGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRR 358          
BLAST of Smed-Albino vs. Ensembl Human
Match: FOXP4 (forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842])

HSP 1 Score: 106.301 bits (264), Expect = 4.516e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  457 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 545          
BLAST of Smed-Albino vs. Ensembl Human
Match: FOXP4 (forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842])

HSP 1 Score: 106.301 bits (264), Expect = 4.539e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  459 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 547          
BLAST of Smed-Albino vs. Ensembl Human
Match: FOXP4 (forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842])

HSP 1 Score: 106.301 bits (264), Expect = 4.539e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  459 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 547          
BLAST of Smed-Albino vs. Ensembl Human
Match: FOXP4 (forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842])

HSP 1 Score: 105.916 bits (263), Expect = 4.596e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  447 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 535          
BLAST of Smed-Albino vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 104.76 bits (260), Expect = 7.833e-25
Identity = 56/129 (43.41%), Postives = 75/129 (58.14%), Query Frame = 3
Query: 1056 IKRASSNSQLSFFPRMTD----REYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH----GKLWTFNENEYNMKK----SRNRFQYNVPIP 1406
            + R S  S  +  P  TD    R++YR   VRP  +Y +LI+ AI+ES   +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCFQR      G +WT +++E+  ++    S  R Q   P+P
Sbjct:   49 VPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRRPNRASATRSQPQTPLP 177          
BLAST of Smed-Albino vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 104.76 bits (260), Expect = 1.051e-24
Identity = 56/129 (43.41%), Postives = 75/129 (58.14%), Query Frame = 3
Query: 1056 IKRASSNSQLSFFPRMTD----REYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH----GKLWTFNENEYNMKK----SRNRFQYNVPIP 1406
            + R S  S  +  P  TD    R++YR   VRP  +Y +LI+ AI+ES   +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCFQR      G +WT +++E+  ++    S  R Q   P+P
Sbjct:   49 VPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRRPNRASATRSQPQTPLP 177          
BLAST of Smed-Albino vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 104.76 bits (260), Expect = 1.058e-24
Identity = 56/129 (43.41%), Postives = 75/129 (58.14%), Query Frame = 3
Query: 1056 IKRASSNSQLSFFPRMTD----REYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH----GKLWTFNENEYNMKK----SRNRFQYNVPIP 1406
            + R S  S  +  P  TD    R++YR   VRP  +Y +LI+ AI+ES   +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCFQR      G +WT +++E+  ++    S  R Q   P+P
Sbjct:   49 VPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRRPNRASATRSQPQTPLP 177          
BLAST of Smed-Albino vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 104.76 bits (260), Expect = 1.407e-24
Identity = 56/129 (43.41%), Postives = 75/129 (58.14%), Query Frame = 3
Query: 1056 IKRASSNSQLSFFPRMTD----REYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH----GKLWTFNENEYNMKK----SRNRFQYNVPIP 1406
            + R S  S  +  P  TD    R++YR   VRP  +Y +LI+ AI+ES   +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCFQR      G +WT +++E+  ++    S  R Q   P+P
Sbjct:   49 VPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRRPNRASATRSQPQTPLP 177          
BLAST of Smed-Albino vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 106.301 bits (264), Expect = 1.012e-23
Identity = 56/129 (43.41%), Postives = 75/129 (58.14%), Query Frame = 3
Query: 1056 IKRASSNSQLSFFPRMTD----REYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH----GKLWTFNENEYNMKK----SRNRFQYNVPIP 1406
            + R S  S  +  P  TD    R++YR   VRP  +Y +LI+ AI+ES   +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCFQR      G +WT +++E+  ++    S  R Q   P+P
Sbjct:  346 VPRRSRISDKTVQPIATDIAKNRDFYRTNDVRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRVEQNVKGAVWTVDDSEFYRRRPNRASATRSQPQTPLP 474          
BLAST of Smed-Albino vs. Ensembl Fly
Match: FoxP (gene:FBgn0262477 transcript:FBtr0329937)

HSP 1 Score: 105.916 bits (263), Expect = 6.418e-24
Identity = 51/114 (44.74%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDS 1439
            +RE+Y+   VRP  +Y +LI+ AI++SP ++L+LNEIY W Q  F YFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++ +        + GA   TN PD+
Sbjct:  318 NREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAVRHNLSLHKCFMRVENVKGAVWTVDEIEFYKRRPQRTAGIGNNLTGA---TNSPDT 428          
BLAST of Smed-Albino vs. Ensembl Fly
Match: FoxP (gene:FBgn0262477 transcript:FBtr0304869)

HSP 1 Score: 97.0561 bits (240), Expect = 9.293e-21
Identity = 65/197 (32.99%), Postives = 97/197 (49.24%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKK--------------SRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQ--LDS----------------SEYMIKKEMEFN--DENMPE-DKHLEIDEWSNYLHKTS 1583
            +RE+Y+   VRP  +Y +LI+ AI++SP ++L+LNEIY W Q  F YFR     WKNAIR NLSLHKCF R     G  W  ++NE+  ++              S N  Q    +P  +N  ++   +     P     LDS                S+ + K   +++  D  M E + HL IDE+S  ++++S
Sbjct:  318 NREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIESNSHLTIDEYSTNMYESS 514          
BLAST of Smed-Albino vs. Ensembl Fly
Match: bin (gene:FBgn0045759 transcript:FBtr0076900)

HSP 1 Score: 85.5001 bits (210), Expect = 7.132e-17
Identity = 43/130 (33.08%), Postives = 70/130 (53.85%), Query Frame = 3
Query: 1011 SDPESNHVKNEKIKPIKRASSNSQLSFFPRM--TDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR----------KHGKLWTFNENEYNM 1364
            S P  NH++N+        +  S     P    T ++   + P +P+ SY+N+I  AI ESP  +L+L+EIY ++Q  + +FR     WKN++RHNLSL++CF++            G  WT +EN  ++
Sbjct:  267 SPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHL 396          
BLAST of Smed-Albino vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 76.2554 bits (186), Expect = 3.464e-14
Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR--------KHGKLWTFNENEYNM 1364
            V+P  SY+ LI  AI  +  ++++LN IY ++   F Y+RD +Q W+N+IRHNLSL++CF +          G  WT + + YNM
Sbjct:   69 VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYNM 153          
BLAST of Smed-Albino vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 70.4774 bits (171), Expect = 6.259e-13
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 3
Query: 1137 RPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCF--------QRKHGKLWTFNENEYNM 1364
            +P  SY++L   AI+ SP+R L L+EIY ++  +F ++R   QKW+N++RHNLS + CF        +   G  WT +   ++M
Sbjct:   13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDM 96          
BLAST of Smed-Albino vs. Ensembl Zebrafish
Match: foxp4 (forkhead box P4 [Source:ZFIN;Acc:ZDB-GENE-101207-1])

HSP 1 Score: 103.99 bits (258), Expect = 1.295e-22
Identity = 51/113 (45.13%), Postives = 70/113 (61.95%), Query Frame = 3
Query: 1047 IKPIKRASSNSQLSFFPR--MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R +S+   +        + E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  450 VGPIRRRNSDKFCTPIASELAQNCEFYKNADVRPPFTYASLIRHAILEAPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR 562          
BLAST of Smed-Albino vs. Ensembl Zebrafish
Match: foxp1b (forkhead box P1b [Source:NCBI gene;Acc:569047])

HSP 1 Score: 103.99 bits (258), Expect = 1.396e-22
Identity = 51/113 (45.13%), Postives = 71/113 (62.83%), Query Frame = 3
Query: 1047 IKPIKRASSNS-QLSFFPRMT-DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S+   +   P +  ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  416 VGPIRRRYSDKYNMPISPDIVQNKEFYMNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDELEFQKRR 528          
BLAST of Smed-Albino vs. Ensembl Zebrafish
Match: foxp1b (forkhead box P1b [Source:NCBI gene;Acc:569047])

HSP 1 Score: 103.99 bits (258), Expect = 1.396e-22
Identity = 51/113 (45.13%), Postives = 71/113 (62.83%), Query Frame = 3
Query: 1047 IKPIKRASSNS-QLSFFPRMT-DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S+   +   P +  ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  416 VGPIRRRYSDKYNMPISPDIVQNKEFYMNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDELEFQKRR 528          
BLAST of Smed-Albino vs. Ensembl Zebrafish
Match: foxp1b (forkhead box P1b [Source:NCBI gene;Acc:569047])

HSP 1 Score: 103.99 bits (258), Expect = 1.400e-22
Identity = 51/113 (45.13%), Postives = 71/113 (62.83%), Query Frame = 3
Query: 1047 IKPIKRASSNS-QLSFFPRMT-DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S+   +   P +  ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  417 VGPIRRRYSDKYNMPISPDIVQNKEFYMNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDELEFQKRR 529          
BLAST of Smed-Albino vs. Ensembl Zebrafish
Match: foxp1b (forkhead box P1b [Source:NCBI gene;Acc:569047])

HSP 1 Score: 103.99 bits (258), Expect = 1.400e-22
Identity = 51/113 (45.13%), Postives = 71/113 (62.83%), Query Frame = 3
Query: 1047 IKPIKRASSNS-QLSFFPRMT-DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S+   +   P +  ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  417 VGPIRRRYSDKYNMPISPDIVQNKEFYMNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDELEFQKRR 529          
BLAST of Smed-Albino vs. Ensembl Xenopus
Match: ENSXETT00000018831.1 (Blood vessel epicardial substance [Source:UniProtKB/Swiss-Prot;Acc:B1H1G2])

HSP 1 Score: 105.531 bits (262), Expect = 6.270e-23
Identity = 46/91 (50.55%), Postives = 63/91 (69.23%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  404 NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRQFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 494          
BLAST of Smed-Albino vs. Ensembl Xenopus
Match: ENSXETT00000018866.1 (Blood vessel epicardial substance [Source:UniProtKB/Swiss-Prot;Acc:B1H1G2])

HSP 1 Score: 105.531 bits (262), Expect = 6.764e-23
Identity = 46/91 (50.55%), Postives = 63/91 (69.23%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  409 NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRQFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 499          
BLAST of Smed-Albino vs. Ensembl Xenopus
Match: ENSXETT00000018995.1 (Blood vessel epicardial substance [Source:UniProtKB/Swiss-Prot;Acc:B1H1G2])

HSP 1 Score: 105.145 bits (261), Expect = 6.776e-23
Identity = 46/91 (50.55%), Postives = 63/91 (69.23%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  417 NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRQFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 507          
BLAST of Smed-Albino vs. Ensembl Xenopus
Match: ENSXETT00000018918.1 (Blood vessel epicardial substance [Source:UniProtKB/Swiss-Prot;Acc:B1H1G2])

HSP 1 Score: 105.145 bits (261), Expect = 6.899e-23
Identity = 46/91 (50.55%), Postives = 63/91 (69.23%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  401 NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRQFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 491          
BLAST of Smed-Albino vs. Ensembl Xenopus
Match: ENSXETT00000033089.1 (Blood vessel epicardial substance [Source:UniProtKB/Swiss-Prot;Acc:B1H1G2])

HSP 1 Score: 105.145 bits (261), Expect = 7.035e-23
Identity = 46/91 (50.55%), Postives = 63/91 (69.23%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  371 NQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRQFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 461          
BLAST of Smed-Albino vs. Ensembl Mouse
Match: Foxp4 (forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373])

HSP 1 Score: 105.916 bits (263), Expect = 3.428e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  462 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 550          
BLAST of Smed-Albino vs. Ensembl Mouse
Match: Foxp4 (forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373])

HSP 1 Score: 105.916 bits (263), Expect = 3.428e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  462 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 550          
BLAST of Smed-Albino vs. Ensembl Mouse
Match: Foxp4 (forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373])

HSP 1 Score: 105.916 bits (263), Expect = 3.445e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  464 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 552          
BLAST of Smed-Albino vs. Ensembl Mouse
Match: Foxp4 (forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373])

HSP 1 Score: 105.916 bits (263), Expect = 3.445e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  464 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 552          
BLAST of Smed-Albino vs. Ensembl Mouse
Match: Foxp4 (forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373])

HSP 1 Score: 105.916 bits (263), Expect = 3.744e-23
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  452 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 540          
BLAST of Smed-Albino vs. UniProt/SwissProt
Match: sp|Q8IVH2|FOXP4_HUMAN (Forkhead box protein P4 OS=Homo sapiens OX=9606 GN=FOXP4 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.180e-22
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILE+P R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  459 EFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRR 547          
BLAST of Smed-Albino vs. UniProt/SwissProt
Match: sp|Q58NQ4|FOXP1_CHICK (Forkhead box protein P1 OS=Gallus gallus OX=9031 GN=FOXP1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.458e-22
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1047 IKPIKRASS---NSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S   N  +S      ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  441 VGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEQEFQKRR 554          
BLAST of Smed-Albino vs. UniProt/SwissProt
Match: sp|Q498D1|FOXP1_RAT (Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.759e-22
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1047 IKPIKRASS---NSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S   N  +S      ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  466 VGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRR 579          
BLAST of Smed-Albino vs. UniProt/SwissProt
Match: sp|Q9H334|FOXP1_HUMAN (Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.996e-22
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1047 IKPIKRASS---NSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S   N  +S      ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  432 VGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRR 545          
BLAST of Smed-Albino vs. UniProt/SwissProt
Match: sp|P58462|FOXP1_MOUSE (Forkhead box protein P1 OS=Mus musculus OX=10090 GN=Foxp1 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.194e-22
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 3
Query: 1047 IKPIKRASS---NSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R  S   N  +S      ++E+Y+   VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  460 VGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRR 573          
BLAST of Smed-Albino vs. TrEMBL
Match: A0A3G1E8G6 (Smed-Albino OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 518/521 (99.42%), Postives = 520/521 (99.81%), Query Frame = 3
Query:   75 EFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNAXXXXXXXXXXXXXXXLTVPALSSIPQQLIDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASPPQLISQQTHSAFTXXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXXXXXQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPR-MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 1634
            +FNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFP+ MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD
Sbjct:  132 KFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPKGMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 652          
BLAST of Smed-Albino vs. TrEMBL
Match: G7YJ28 (Forkhead box protein P2 OS=Clonorchis sinensis OX=79923 GN=CLF_109222 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.523e-27
Identity = 68/154 (44.16%), Postives = 87/154 (56.49%), Query Frame = 3
Query: 1005 PRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKKSRNRFQY---------NVPIPGAENQTND 1430
            P SD E  H  +    P    SS         +T R+YYR    RP  +Y  LI+ AILESPR++LSL+ IYVW+Q EFAYFR  E  WKNA+RHNLSLHKCF+R     G +W  +ENEY  +K++   ++         NV    A N+ ND
Sbjct:  600 PDSDGEGGHGHDSPPSPSIHNSS---------ITHRQYYRSHCARPRFTYATLIRQAILESPRKQLSLSAIYVWLQKEFAYFRQNEATWKNAVRHNLSLHKCFRRVETASGSVWVVDENEYQRRKAKRVVRWFPTNGTLGANVKTQAATNRDND 744          
BLAST of Smed-Albino vs. TrEMBL
Match: A0A3R7ELH1 (Forkhead box protein P1-B (Fragment) OS=Clonorchis sinensis OX=79923 GN=foxp1b PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.822e-27
Identity = 68/154 (44.16%), Postives = 87/154 (56.49%), Query Frame = 3
Query: 1005 PRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKKSRNRFQY---------NVPIPGAENQTND 1430
            P SD E  H  +    P    SS         +T R+YYR    RP  +Y  LI+ AILESPR++LSL+ IYVW+Q EFAYFR  E  WKNA+RHNLSLHKCF+R     G +W  +ENEY  +K++   ++         NV    A N+ ND
Sbjct:  519 PDSDGEGGHGHDSPPSPSIHNSS---------ITHRQYYRSHCARPRFTYATLIRQAILESPRKQLSLSAIYVWLQKEFAYFRQNEATWKNAVRHNLSLHKCFRRVETASGSVWVVDENEYQRRKAKRVVRWFPTNGTLGANVKTQAATNRDND 663          
BLAST of Smed-Albino vs. TrEMBL
Match: A0A4S2L6X3 (Fork-head domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010173 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 8.782e-27
Identity = 62/132 (46.97%), Postives = 80/132 (60.61%), Query Frame = 3
Query: 1005 PRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKKSRNRFQY 1391
            P SD E  H  +    P    SS         +T R+YYR    RP  +Y  LI+ AILESPR++LSL+ IYVW+Q EFAYFR  E  WKNA+RHNLSLHKCF+R     G +W  +ENEY  +K++   ++
Sbjct:  374 PDSDGEGGHGHDSPPSPSIHNSS---------ITHRQYYRSHCARPRFTYATLIRQAILESPRKQLSLSAIYVWLQKEFAYFRQNEATWKNAVRHNLSLHKCFRRVETASGSVWVVDENEYQRRKAKRVVRW 496          
BLAST of Smed-Albino vs. TrEMBL
Match: A0A4S2L2G3 (Fork-head domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010173 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.110e-26
Identity = 62/132 (46.97%), Postives = 80/132 (60.61%), Query Frame = 3
Query: 1005 PRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKKSRNRFQY 1391
            P SD E  H  +    P    SS         +T R+YYR    RP  +Y  LI+ AILESPR++LSL+ IYVW+Q EFAYFR  E  WKNA+RHNLSLHKCF+R     G +W  +ENEY  +K++   ++
Sbjct:  667 PDSDGEGGHGHDSPPSPSIHNSS---------ITHRQYYRSHCARPRFTYATLIRQAILESPRKQLSLSAIYVWLQKEFAYFRQNEATWKNAVRHNLSLHKCFRRVETASGSVWVVDENEYQRRKAKRVVRW 789          
BLAST of Smed-Albino vs. Ensembl Cavefish
Match: foxp1b (forkhead box P1b [Source:NCBI gene;Acc:569047])

HSP 1 Score: 105.145 bits (261), Expect = 3.567e-23
Identity = 52/117 (44.44%), Postives = 71/117 (60.68%), Query Frame = 3
Query: 1029 HVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            HVK+ + KP  +          P + ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  369 HVKSTEPKPTPQ----------PIVQNKEFYMNADVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDELEFQKRR 475          
BLAST of Smed-Albino vs. Ensembl Cavefish
Match: foxp4 (forkhead box P4 [Source:ZFIN;Acc:ZDB-GENE-101207-1])

HSP 1 Score: 104.76 bits (260), Expect = 5.781e-23
Identity = 48/89 (53.93%), Postives = 60/89 (67.42%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            E+Y+   VRP  +Y +LI+ AILESP R+L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  435 EFYKNADVRPPFTYASLIRHAILESPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR 523          
BLAST of Smed-Albino vs. Ensembl Cavefish
Match: foxp3a (forkhead box P3a [Source:ZFIN;Acc:ZDB-GENE-061116-2])

HSP 1 Score: 100.138 bits (248), Expect = 6.387e-23
Identity = 47/100 (47.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query: 1089 FFPRM-TDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKKSR 1376
            F P + T  E+Y+   +RP  +Y ++I+ AILESP ++L+LNEIY W   +F+YFR     WKNA+RHNLSLHKCF R     G +WT +E E+  +K +
Sbjct:  168 FIPGLITSIEWYKYTNIRPPFTYASMIRWAILESPEKQLTLNEIYHWFTRKFSYFRHNTATWKNAVRHNLSLHKCFVRVDGGKGSVWTVDEAEFLRRKGQ 267          
BLAST of Smed-Albino vs. Ensembl Cavefish
Match: foxp1a (forkhead box protein P1-B-like [Source:NCBI gene;Acc:103043259])

HSP 1 Score: 101.293 bits (251), Expect = 7.167e-22
Identity = 45/91 (49.45%), Postives = 59/91 (64.84%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y  LI+ AI ESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  390 NKEFYLSAEVRPPFTYAALIRQAIFESPDKQLTLNEIYNWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEMEFQKRR 480          
BLAST of Smed-Albino vs. Ensembl Cavefish
Match: foxp1a (forkhead box protein P1-B-like [Source:NCBI gene;Acc:103043259])

HSP 1 Score: 101.293 bits (251), Expect = 7.912e-22
Identity = 45/91 (49.45%), Postives = 59/91 (64.84%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y  LI+ AI ESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  417 NKEFYLSAEVRPPFTYAALIRQAIFESPDKQLTLNEIYNWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEMEFQKRR 507          
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006123.1 (pep scaffold:Pmarinus_7.0:GL480955:5430:26261:-1 gene:ENSPMAG00000005535.1 transcript:ENSPMAT00000006123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.193e-23
Identity = 44/91 (48.35%), Postives = 61/91 (67.03%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + E+Y+   VRP  +Y +LI+ AI+E+P  +L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:    7 NEEFYQNAEVRPPFTYASLIRQAIIETPDHQLTLNEIYNWFTRKFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEMEFQKRR 97          
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006121.1 (pep scaffold:Pmarinus_7.0:GL480955:5430:26261:-1 gene:ENSPMAG00000005535.1 transcript:ENSPMAT00000006121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.544e-23
Identity = 44/91 (48.35%), Postives = 61/91 (67.03%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + E+Y+   VRP  +Y +LI+ AI+E+P  +L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:    7 NEEFYQNAEVRPPFTYASLIRQAIIETPDHQLTLNEIYNWFTRKFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEMEFQKRR 97          
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 75.0998 bits (183), Expect = 5.098e-16
Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR--------KHGKLWTFNENEYNM 1364
            V+P  SY+ LI  AI  +P ++++LN IY ++  +F ++R+ +Q W+N+IRHNLSL++CF +          G  W+ + + YNM
Sbjct:   76 VKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNM 160          
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 70.8626 bits (172), Expect = 3.821e-15
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 3
Query: 1131 PVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCF 1313
            P +P  SY+ LI  AI  SP + ++L+EIY ++Q  F +FR   Q WKN++RHNLSL++CF
Sbjct:    3 PEKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECF 63          
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 70.8626 bits (172), Expect = 7.110e-15
Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 3
Query: 1131 PVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCF 1313
            P +P  SY+ LI  AI  SP + ++L+EIY ++Q  F +FR   Q WKN++RHNLSL++CF
Sbjct:    4 PEKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECF 64          
BLAST of Smed-Albino vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 67.781 bits (164), Expect = 3.881e-12
Identity = 28/62 (45.16%), Postives = 43/62 (69.35%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR 1319
            V+P  SY  +I  AIL SP   +SL +IY ++ + +AY+R  +  W+N+IRHNLSL+K F++
Sbjct:  339 VKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEK 400          
BLAST of Smed-Albino vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 64.6994 bits (156), Expect = 2.501e-11
Identity = 32/86 (37.21%), Postives = 48/86 (55.81%), Query Frame = 3
Query: 1065 ASSNSQLSF---FPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCF 1313
            A SN  L+       +  R    +   +P  SY  LI  AIL+S   +L+L++IY W+   F Y++ K+  W+N+IRHNLSL+  F
Sbjct:   82 ARSNGNLTLEEILQSLERRRINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAF 167          
BLAST of Smed-Albino vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 62.3882 bits (150), Expect = 1.320e-10
Identity = 24/62 (38.71%), Postives = 43/62 (69.35%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR 1319
            ++P  SY ++I  AIL +P   +SL +IY ++   +A++R  +  W+N++RHNLSL+K F++
Sbjct:  302 IKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEK 363          
BLAST of Smed-Albino vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 57.7658 bits (138), Expect = 4.833e-9
Identity = 31/91 (34.07%), Postives = 56/91 (61.54%), Query Frame = 3
Query: 1125 QFPVRPSASYVNLIKTAILE-SPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR--KHGK--LWTFNENEYNMKKSRNR 1382
            ++  +P+ SY  ++ T I + S  + +SL+EIY  ++  F Y++     W++++RHNLSL+K F++  K GK  LW  +E EY  ++ R +
Sbjct:  457 EYRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKEGKGWLWGLDE-EYIAERERQK 546          
BLAST of Smed-Albino vs. Ensembl Nematostella
Match: EDO46897 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ7])

HSP 1 Score: 99.3673 bits (246), Expect = 1.030e-23
Identity = 44/97 (45.36%), Postives = 65/97 (67.01%), Query Frame = 3
Query: 1113 EYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKKSRNRFQYN 1394
            ++Y++  VRP  +Y +LI+ AIL+SP  +L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF RK    G +W  +E E+  ++ +++  ++
Sbjct:  115 DFYQKADVRPPFTYASLIRQAILDSPDTQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRKENVKGAVWMVDEEEFMKRRPQSKVTHS 211          
BLAST of Smed-Albino vs. Ensembl Nematostella
Match: EDO45043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU95])

HSP 1 Score: 73.559 bits (179), Expect = 4.868e-16
Identity = 33/80 (41.25%), Postives = 50/80 (62.50%), Query Frame = 3
Query: 1137 RPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR------KHGKLWTFNENEY 1358
            +PS SY+ LI  AI+  P+++L L++IY ++ T + YFR+K   W+N+IRHNLSL++CF +        G  W  N   Y
Sbjct:    1 KPSQSYIGLIGKAIMSVPQKKLVLSDIYNYILTHYPYFRNKGAGWRNSIRHNLSLNECFVKVGRSSNGKGHFWAINPENY 80          
BLAST of Smed-Albino vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 72.7886 bits (177), Expect = 1.369e-15
Identity = 38/89 (42.70%), Postives = 52/89 (58.43%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---------KHGKLWTFNENEYNMKKS 1373
            V+P  SY+ LI  +I  SP R  +LNEIY ++ T F YFR  +QKW+N+IRHNLSL+ CF +           G  WT + +  +M  S
Sbjct:   15 VKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDMFGS 103          
BLAST of Smed-Albino vs. Ensembl Nematostella
Match: EDO49084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI36])

HSP 1 Score: 71.633 bits (174), Expect = 2.103e-15
Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 3
Query: 1137 RPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---------KHGKLWTFN 1346
            +P  S+ +LI  AI ESP + L + +IY W+   F YFRD    WKN++RHNLSL+KCF++           G LWT +
Sbjct:    2 KPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYFRDARLGWKNSVRHNLSLNKCFKKVDKDKGQNVGKGSLWTVD 80          
BLAST of Smed-Albino vs. Ensembl Nematostella
Match: EDO38502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW5])

HSP 1 Score: 70.0922 bits (170), Expect = 7.637e-15
Identity = 32/81 (39.51%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1137 RPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH------GKLWTFNENEYN 1361
            +P+ SY++LI  AIL SP ++L L++IY ++ T + YFR K   W+N+IRHNLSL++CF +        G  W  +   ++
Sbjct:    1 KPNQSYISLISEAILSSPEQKLILSDIYNFILTRYPYFRTKGTGWRNSIRHNLSLNECFVKAGRSPNGKGHFWAIDATYFD 81          
BLAST of Smed-Albino vs. Ensembl Medaka
Match: foxp4 (forkhead box P4 [Source:NCBI gene;Acc:100301623])

HSP 1 Score: 105.531 bits (262), Expect = 1.919e-23
Identity = 52/113 (46.02%), Postives = 71/113 (62.83%), Query Frame = 3
Query: 1047 IKPIKRASSNSQLSFFPR--MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            + PI+R +S+   +        + E+Y+   VRP  +Y +LI+ AILESP R+L+LNEIY W   +FAYFR     WKNA+RHNLSLHKCF R     G +WT +E EY  ++
Sbjct:  280 VGPIRRRNSDKYCTPIASELAQNCEFYKNADVRPPFTYASLIRHAILESPDRQLTLNEIYNWFTRKFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR 392          
BLAST of Smed-Albino vs. Ensembl Medaka
Match: ENSORLT00000043790.1 (forkhead box protein P1-B [Source:NCBI gene;Acc:100301622])

HSP 1 Score: 102.834 bits (255), Expect = 4.859e-23
Identity = 46/91 (50.55%), Postives = 62/91 (68.13%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y +LI+ AI ESPR++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E++ ++
Sbjct:  301 NKEFYLTTEVRPPFTYASLIRQAIFESPRKQLTLNEIYNWFTRNFAYFRRNAATWKNAVRHNLSLHKCFVRLENVKGAVWTVDEIEFHRRR 391          
BLAST of Smed-Albino vs. Ensembl Medaka
Match: ENSORLT00000016828.2 (forkhead box protein P1-B [Source:NCBI gene;Acc:100301622])

HSP 1 Score: 103.605 bits (257), Expect = 8.191e-23
Identity = 46/91 (50.55%), Postives = 62/91 (68.13%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y +LI+ AI ESPR++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E++ ++
Sbjct:  307 NKEFYLTTEVRPPFTYASLIRQAIFESPRKQLTLNEIYNWFTRNFAYFRRNAATWKNAVRHNLSLHKCFVRLENVKGAVWTVDEIEFHRRR 397          
BLAST of Smed-Albino vs. Ensembl Medaka
Match: ENSORLT00000016832.2 (forkhead box protein P1-B [Source:NCBI gene;Acc:100301622])

HSP 1 Score: 103.605 bits (257), Expect = 1.061e-22
Identity = 46/91 (50.55%), Postives = 62/91 (68.13%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR---KHGKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y +LI+ AI ESPR++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E++ ++
Sbjct:  355 NKEFYLTTEVRPPFTYASLIRQAIFESPRKQLTLNEIYNWFTRNFAYFRRNAATWKNAVRHNLSLHKCFVRLENVKGAVWTVDEIEFHRRR 445          
BLAST of Smed-Albino vs. Ensembl Medaka
Match: foxp1b (forkhead box protein P1-B [Source:NCBI gene;Acc:101173216])

HSP 1 Score: 102.449 bits (254), Expect = 3.230e-22
Identity = 46/91 (50.55%), Postives = 61/91 (67.03%), Query Frame = 3
Query: 1107 DREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKH---GKLWTFNENEYNMKK 1370
            ++E+Y    VRP  +Y +LI+ AILESP ++L+LNEIY W    FAYFR     WKNA+RHNLSLHKCF R     G +WT +E E+  ++
Sbjct:  410 NKEFYMNADVRPPFTYASLIRQAILESPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEIEFQKRR 500          
BLAST of Smed-Albino vs. Planmine SMEST
Match: SMESG000068148.1 (SMESG000068148.1)

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 519/520 (99.81%), Postives = 520/520 (100.00%), Query Frame = 3
Query:   75 EFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNAXXXXXXXXXXXXXXXLTVPALSSIPQQLIDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASPPQLISQQTHSAFTXXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXXXXXQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 1634
            +FNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD
Sbjct:  132 KFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 651          
BLAST of Smed-Albino vs. Planmine SMEST
Match: SMESG000068148.1 (SMESG000068148.1)

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 518/521 (99.42%), Postives = 520/521 (99.81%), Query Frame = 3
Query:   75 EFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNAXXXXXXXXXXXXXXXLTVPALSSIPQQLIDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASPPQLISQQTHSAFTXXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXXXXXQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPR-MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 1634
            +FNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFP+ MTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD
Sbjct:  132 KFNENKMSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDIEENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHLDQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNSFHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLSSVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTNNILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSSDSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPKGMTDREYYRQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLISSSDDNMKPPDISVD 652          
BLAST of Smed-Albino vs. Planmine SMEST
Match: SMESG000075929.1 (SMESG000075929.1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.314e-16
Identity = 40/98 (40.82%), Postives = 58/98 (59.18%), Query Frame = 3
Query: 1122 RQFPVRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR--------KHGKLWTFNENE---YNMKKSRNR 1382
            ++  ++P  SY++LI  AI  SP ++ +LNEIY ++   F +FR + Q WKN+IRHNLSL+ CF +          G  WT NEN    +N K +R R
Sbjct:   29 KEIYLKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRR 126          
BLAST of Smed-Albino vs. Planmine SMEST
Match: SMESG000075929.1 (SMESG000075929.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.038e-15
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCFQR--------KHGKLWTFNENE---YNMKKSRNR 1382
            ++P  SY++LI  AI  SP ++ +LNEIY ++   F +FR + Q WKN+IRHNLSL+ CF +          G  WT NEN    +N K +R R
Sbjct:   35 LKPPFSYISLIAMAIQASPYQQCTLNEIYEYLSEHFKFFRGEYQGWKNSIRHNLSLNDCFIKIPKGFGRIGKGHYWTMNENASFLFNEKCNRRR 128          
BLAST of Smed-Albino vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.230e-15
Identity = 49/158 (31.01%), Postives = 73/158 (46.20%), Query Frame = 3
Query: 1134 VRPSASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHNLSLHKCF--------QRKHGKLWTFNENEYNM------KKSRNRFQYNVPIPGAENQTNDPDSYEDEEDPQEQLDSSE---------------YMIKKEMEFNDE 1520
            V+P  SY+ LI  AI   P   ++LN IY ++   F Y+R+ +Q W+N+IRHNLSL++CF        +   G  WT + N YNM       + R RF+Y      AE    + D      D  E++ + +               + +KK   F DE
Sbjct:  145 VKPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNAYNMFENGSFLRRRRRFKYKDDTISAEATATNSDIIISNSDDLEKVHTCKVENPHSITNDFKGLNFSLKKNSTFGDE 302          
The following BLAST results are available for this feature:
BLAST of Smed-Albino vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXP14.415e-2345.61forkhead box P1 [Source:HGNC Symbol;Acc:HGNC:3823][more]
FOXP44.516e-2352.81forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842... [more]
FOXP44.539e-2352.81forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842... [more]
FOXP44.539e-2352.81forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842... [more]
FOXP44.596e-2352.81forkhead box P4 [Source:HGNC Symbol;Acc:HGNC:20842... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-77.833e-2543.41ForKHead transcription factor family [Source:UniP... [more]
fkh-71.051e-2443.41ForKHead transcription factor family [Source:UniP... [more]
fkh-71.058e-2443.41ForKHead transcription factor family [Source:UniP... [more]
fkh-71.407e-2443.41ForKHead transcription factor family [Source:UniP... [more]
fkh-71.012e-2343.41ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FoxP6.418e-2444.74gene:FBgn0262477 transcript:FBtr0329937[more]
FoxP9.293e-2132.99gene:FBgn0262477 transcript:FBtr0304869[more]
bin7.132e-1733.08gene:FBgn0045759 transcript:FBtr0076900[more]
croc3.464e-1440.00gene:FBgn0014143 transcript:FBtr0078395[more]
fd96Cb6.259e-1336.90gene:FBgn0004898 transcript:FBtr0084771[more]
back to top
BLAST of Smed-Albino vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxp41.295e-2245.13forkhead box P4 [Source:ZFIN;Acc:ZDB-GENE-101207-1... [more]
foxp1b1.396e-2245.13forkhead box P1b [Source:NCBI gene;Acc:569047][more]
foxp1b1.396e-2245.13forkhead box P1b [Source:NCBI gene;Acc:569047][more]
foxp1b1.400e-2245.13forkhead box P1b [Source:NCBI gene;Acc:569047][more]
foxp1b1.400e-2245.13forkhead box P1b [Source:NCBI gene;Acc:569047][more]
back to top
BLAST of Smed-Albino vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000018831.16.270e-2350.55Blood vessel epicardial substance [Source:UniProt... [more]
ENSXETT00000018866.16.764e-2350.55Blood vessel epicardial substance [Source:UniProt... [more]
ENSXETT00000018995.16.776e-2350.55Blood vessel epicardial substance [Source:UniProt... [more]
ENSXETT00000018918.16.899e-2350.55Blood vessel epicardial substance [Source:UniProt... [more]
ENSXETT00000033089.17.035e-2350.55Blood vessel epicardial substance [Source:UniProt... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxp43.428e-2352.81forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373... [more]
Foxp43.428e-2352.81forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373... [more]
Foxp43.445e-2352.81forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373... [more]
Foxp43.445e-2352.81forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373... [more]
Foxp43.744e-2352.81forkhead box P4 [Source:MGI Symbol;Acc:MGI:1921373... [more]
back to top
BLAST of Smed-Albino vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVH2|FOXP4_HUMAN2.180e-2252.81Forkhead box protein P4 OS=Homo sapiens OX=9606 GN... [more]
sp|Q58NQ4|FOXP1_CHICK2.458e-2245.61Forkhead box protein P1 OS=Gallus gallus OX=9031 G... [more]
sp|Q498D1|FOXP1_RAT3.759e-2245.61Forkhead box protein P1 OS=Rattus norvegicus OX=10... [more]
sp|Q9H334|FOXP1_HUMAN3.996e-2245.61Forkhead box protein P1 OS=Homo sapiens OX=9606 GN... [more]
sp|P58462|FOXP1_MOUSE4.194e-2245.61Forkhead box protein P1 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Smed-Albino vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3G1E8G60.000e+099.42Smed-Albino OS=Schmidtea mediterranea OX=79327 PE=... [more]
G7YJ282.523e-2744.16Forkhead box protein P2 OS=Clonorchis sinensis OX=... [more]
A0A3R7ELH12.822e-2744.16Forkhead box protein P1-B (Fragment) OS=Clonorchis... [more]
A0A4S2L6X38.782e-2746.97Fork-head domain-containing protein OS=Opisthorchi... [more]
A0A4S2L2G31.110e-2646.97Fork-head domain-containing protein OS=Opisthorchi... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxp1b3.567e-2344.44forkhead box P1b [Source:NCBI gene;Acc:569047][more]
foxp45.781e-2353.93forkhead box P4 [Source:ZFIN;Acc:ZDB-GENE-101207-1... [more]
foxp3a6.387e-2347.00forkhead box P3a [Source:ZFIN;Acc:ZDB-GENE-061116-... [more]
foxp1a7.167e-2249.45forkhead box protein P1-B-like [Source:NCBI gene;A... [more]
foxp1a7.912e-2249.45forkhead box protein P1-B-like [Source:NCBI gene;A... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006123.11.193e-2348.35pep scaffold:Pmarinus_7.0:GL480955:5430:26261:-1 g... [more]
ENSPMAT00000006121.11.544e-2348.35pep scaffold:Pmarinus_7.0:GL480955:5430:26261:-1 g... [more]
FOXC25.098e-1637.65forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
foxf2a3.821e-1549.18forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
foxf2a7.110e-1549.18forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH23.881e-1245.16Forkhead family transcription factor; rate-limitin... [more]
HCM12.501e-1137.21Forkhead transcription factor; drives S-phase acti... [more]
FKH11.320e-1038.71Forkhead family transcription factor; rate-limitin... [more]
FHL14.833e-934.07Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468971.030e-2345.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450434.868e-1641.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395291.369e-1542.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490842.103e-1543.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385027.637e-1539.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Smed-Albino vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxp41.919e-2346.02forkhead box P4 [Source:NCBI gene;Acc:100301623][more]
ENSORLT00000043790.14.859e-2350.55forkhead box protein P1-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000016828.28.191e-2350.55forkhead box protein P1-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000016832.21.061e-2250.55forkhead box protein P1-B [Source:NCBI gene;Acc:10... [more]
foxp1b3.230e-2250.55forkhead box protein P1-B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Smed-Albino vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068148.10.000e+099.81SMESG000068148.1[more]
SMESG000068148.10.000e+099.42SMESG000068148.1[more]
SMESG000075929.19.314e-1640.82SMESG000075929.1[more]
SMESG000075929.11.038e-1542.55SMESG000075929.1[more]
SMESG000004239.11.230e-1531.01SMESG000004239.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032631 ID=SMED30032631|Name=Smed-Albino|organism=Schmidtea mediterranea sexual|type=transcript|length=2143bp
TTGAATTACAACAACTTTTTGTTTGAATATTGGTTTGAAACAATTTATGG
ATTGATTAATATTTCTTTAGTATTGAATTCAATGAAAATAAAATGTCAAA
TCCGAATCCTTTCTTGATTAGTGAGTATCAGAAAATCAAGCAATTGATTG
ATAAATCAGGAATGTTATTGCCGAATGAGAAGCTTGTTACAAAAAATCGG
GGAGAATGTTACTGGGCTAATTGTTTTTTTCAAAGTGATATTGAAGAGAA
TTTCAAAAAACATCTCAACGAATGTCATCATATGACGACGTCTGCACTTG
CACAATTAGAAATTTCATTCGAAAAAGCTATGCAATTATCAAAACTGCTA
TTAAATGAACAAAATCATCTTTATAACATGTTCTTGCATCTTGATCAAAA
ACTGAAAAGTCTTCCTAATGACAATTGTTTATTACTAAATGATAGTCAAT
ATCTTGCAGCTCTTTTGAATAAATTTAAACAAATGCCTAATATTTTCGAC
TTCTTCGCTGATTCTAATCGATTCAATGGAGACCTAAACTCCTTTCATCC
ATCACATAGACTAGACAATCATCAGTTTACAATAAGTAATGCTAGCCATC
ATACTCAACAGCCTTCACCTCATCAACAACAATCTCCCTTGACTGTTCCA
GCATTATCGAGTATTCCTCAACAATTAATTGATAATCTTTCATCAGTTTT
AATGAGACAACAACAACAACAGCAGCCACCACAATTGATACCATTATCAT
CACAAAACTCTAATCAACAACCCAATTTTCAACAGTCAATTGCTTCTCCT
CCTCAACTAATCAGTCAACAAACTCATTCGGCGTTTACAAATAATATTCT
ACCACTCATAAACGCCAATAACAATATTAATAGTCTACTCGTGAACAGTT
CAGATCCAAATCTTATCAATATCAGTCCCAATAATCAACTCAACAACATT
GACAACAATCTCAAAGATATTTTGTCTCAATCCAGATCCTCAGATTCCAA
TTATCCAAGGTCTGATCCGGAATCGAATCACGTAAAAAATGAAAAAATCA
AACCTATCAAAAGGGCGTCTTCAAACAGTCAGTTATCATTTTTCCCAAGA
ATGACAGACCGCGAGTATTACCGGCAGTTTCCTGTCCGACCCAGTGCCAG
TTATGTCAACTTAATCAAAACTGCAATTTTGGAATCACCAAGACGTGAAT
TGTCACTGAATGAAATTTATGTTTGGATGCAAACTGAATTCGCTTATTTC
CGTGACAAGGAACAGAAGTGGAAAAATGCCATCAGACATAACTTGTCGCT
TCATAAATGCTTTCAAAGAAAACATGGGAAATTATGGACTTTCAATGAAA
ATGAATACAACATGAAAAAGTCGAGAAATCGATTTCAGTACAATGTTCCA
ATTCCAGGAGCTGAGAATCAGACAAATGATCCGGACAGTTACGAAGATGA
AGAAGATCCCCAAGAACAGTTGGATAGTTCTGAATACATGATAAAGAAGG
AAATGGAATTCAATGATGAAAATATGCCTGAAGACAAACATTTAGAGATT
GATGAGTGGTCCAATTATCTTCACAAAACCTCTTTGATCAGTTCAAGTGA
CGATAACATGAAACCACCAGATATCAGTGTCGATTGAGTCTCTAGAAATA
TCTTCAACCAGCTCAACTCTTTATTTCCCACATCCGTAGTCATATTTTCA
GTAAAAAAATAATAATAAAAAATGTAAAATGTATATAAAAATCTTTTTTT
CGTTAGCTATGTGCTCTGATGTCATTAATCGATGATAATTACTATTTTAT
CGACCCAAATTTTGATGTGTAATTTTGATCCGTGATTTTATACATATTTT
GTTTTATATAATATTGTGAATATACAGTTTATTCTCTATTTTGTTACGAT
TTTTACCAATTGAATTACGAACCAATAAATGTTGATCTATATTTGCTTGA
TGACGATTTGGTGATTATCGATAAATTGTGTTTTAGTCGGTTCATTTTTT
TATTCTAGGATTTTATCATTACGATTGTTTTCTAAACTACGCGTATATAG
TATCGATCGGTGTATCAATTGCACTTTTGTTCGCTTTTCTGCAAGTCTGA
TTTAATTGAAAATGAAAGGAGAAAATCTGGAAATGAGTGGCGG
back to top

protein sequence of SMED30032631-orf-1

>SMED30032631-orf-1 ID=SMED30032631-orf-1|Name=SMED30032631-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MSNPNPFLISEYQKIKQLIDKSGMLLPNEKLVTKNRGECYWANCFFQSDI
EENFKKHLNECHHMTTSALAQLEISFEKAMQLSKLLLNEQNHLYNMFLHL
DQKLKSLPNDNCLLLNDSQYLAALLNKFKQMPNIFDFFADSNRFNGDLNS
FHPSHRLDNHQFTISNASHHTQQPSPHQQQSPLTVPALSSIPQQLIDNLS
SVLMRQQQQQQPPQLIPLSSQNSNQQPNFQQSIASPPQLISQQTHSAFTN
NILPLINANNNINSLLVNSSDPNLINISPNNQLNNIDNNLKDILSQSRSS
DSNYPRSDPESNHVKNEKIKPIKRASSNSQLSFFPRMTDREYYRQFPVRP
SASYVNLIKTAILESPRRELSLNEIYVWMQTEFAYFRDKEQKWKNAIRHN
LSLHKCFQRKHGKLWTFNENEYNMKKSRNRFQYNVPIPGAENQTNDPDSY
EDEEDPQEQLDSSEYMIKKEMEFNDENMPEDKHLEIDEWSNYLHKTSLIS
SSDDNMKPPDISVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR032354FOXP-CC
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 349..362
score: 46.94
coord: 393..410
score: 58.86
coord: 370..387
score: 41.09
IPR001766Fork head domainSMARTSM00339forkneu4coord: 347..429
e-value: 3.9E-26
score: 102.8
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 349..420
e-value: 9.0E-23
score: 80.4
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 349..420
score: 21.06
IPR032354FOXP, coiled-coil domainPFAMPF16159FOXP-CCcoord: 36..100
e-value: 1.0E-9
score: 38.9
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 348..435
e-value: 5.1E-28
score: 98.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 441..461
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 446..460
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 296..322
NoneNo IPR availablePANTHERPTHR45796FAMILY NOT NAMEDcoord: 37..471
NoneNo IPR availablePANTHERPTHR45796:SF4FORKHEAD BOX P, ISOFORM Ccoord: 37..471
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 393..399
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 348..430