cilia- and flagella-associated protein 53

Overview
Namecilia- and flagella-associated protein 53
Smed IDSMED30032624
Length (bp)1629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 53 (SMED30032624) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 53 (SMED30032624) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 53 (SMED30032624) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 53 (SMED30032624) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032624

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032624SMESG000004919.1 SmedASXL_006419SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032624SMESG000004919.1 dd_3219dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032624SMESG000004919.1 Contig48812newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032624SMESG000004919.1 Contig48812uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30032624SMESG000004919.1 dd_Smed_v6_3219_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032624SMESG000004919.1 dd_Smed_v6_3219_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032624SMESG000004919.1 dd_Smed_v6_3219_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30032624SMESG000004919.1 dd_Smed_v6_3219_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30032624SMESG000004919.1 dd_Smed_v4_3219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Human
Match: CFAP53 (cilia and flagella associated protein 53 [Source:HGNC Symbol;Acc:HGNC:26530])

HSP 1 Score: 91.6633 bits (226), Expect = 6.018e-19
Identity = 128/505 (25.35%), Postives = 256/505 (50.69%), Query Frame = 2
Query:   53 REFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAY------EEKLKKQ---QKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRS-HPWRK 1537
            RE +GP P  V + ++PP  + ++  ++ +++            K  E   ++ EW++++  K+L +      + A       IE RR++LR+++  E  +   EM    ET+ E++ ++REK + LKE+   + Q     K DQ +R++ E+LR  L      ++ ++    I   E + ++K  E++ F++LW +D   KE+RE Q+     AR Q   K L+E N+ +    Q      + + T  L+  E + +E++NA       ++ LKKQ   Q+TR I    L+++++   +E ++E  L+ K+++  L   + EA+ +  K++ ++ + + Y  YL Q +E+E  +EKE D ++ E+  +   ++  +   E +AR+QL+ EV+  RK QV+++L+     Q +  ++++   + ++    E++ +          YR  L  QIA+ +   E  ++E+  E ++     +    ++   LS   V P++ HP RK
Sbjct:   11 REVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERDRLKAEWDQHNDCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQLKKETIEEKKDRMREKTKLLKEKNEKERQDFVAEKLDQQFRERCEELRVELLSIHQKKVCEERKAQIAFNEELSRQKLVEEQMFSKLWEEDRLAKEKREAQE-----ARRQ---KELME-NTRLGLNAQITSIKAQRQATQLLKEEEARLVESNNAQIKHENEQDMLKKQKAKQETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKDKELRLEKEARRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQKHINESLKELNCEEKENFARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAANKMCLDKVQEVLSTHQVLPQNIHPMRK 506          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 53.5286 bits (127), Expect = 6.235e-7
Identity = 43/137 (31.39%), Postives = 78/137 (56.93%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            +L R  +++QEE+  D +I++ LL   +    L + +++Q+M D      ++KQ  E++L     RE EL  ++ EE    W+KR  +W RE  AR +L+ EV+  R+QQ+++++  N   Q ++L  RE   + +E
Sbjct:  281 QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADV----AWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLE 413          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 53.5286 bits (127), Expect = 6.235e-7
Identity = 43/137 (31.39%), Postives = 78/137 (56.93%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            +L R  +++QEE+  D +I++ LL   +    L + +++Q+M D      ++KQ  E++L     RE EL  ++ EE    W+KR  +W RE  AR +L+ EV+  R+QQ+++++  N   Q ++L  RE   + +E
Sbjct:  281 QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADV----AWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLE 413          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Human
Match: TCHP (trichoplein keratin filament binding [Source:HGNC Symbol;Acc:HGNC:28135])

HSP 1 Score: 53.5286 bits (127), Expect = 6.235e-7
Identity = 43/137 (31.39%), Postives = 78/137 (56.93%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            +L R  +++QEE+  D +I++ LL   +    L + +++Q+M D      ++KQ  E++L     RE EL  ++ EE    W+KR  +W RE  AR +L+ EV+  R+QQ+++++  N   Q ++L  RE   + +E
Sbjct:  281 QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADV----AWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLE 413          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Zebrafish
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:567344])

HSP 1 Score: 166.007 bits (419), Expect = 1.269e-44
Identity = 158/458 (34.50%), Postives = 266/458 (58.08%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAF 1393
            M+T Q+ + + RE  GPA  SVA+ ARPP SR  D I    +KQ   R    E  KD  +  +R  WERN++++++ A+  R  Q A  Q Q GI+ +R+RLR+++  E  +L +EM +  ETV+ERQAK+ E+A+ L+E +  + Q V   K DQ++R+QSE+LR    K+   ++  +    IR+KE + + ++ E++ FA++W  D   KEER   ++ +    N +   +L  Q  +  ++R + K+LK+EE  L     E+ +LE +  + +KL+ Q+K R   D +LR K+KR  R+ QEE+ALD  I+E LLA  + E   ++ KK +  ++ RRYR+YL Q  E++   E E + +   E+ ++W +R  QW  E  AR +L+++V++  + Q++++L  N   Q +A  ++E+  ++I+  K  DE  K    E    Y+ DL+ Q+ +
Sbjct:    1 MLTAQRSRIRCREITGPA-HSVALKARPPLSRDIDDIFVRRRKQEATRGEVLEFTKDQSSCDVRMRWERNTQRRVVSATVNRHLQDALDQYQMGIDEKRERLRELLESEELELFKEMEAKKETVLERQAKMHERAKTLRERRESERQRVVADKLDQLFREQSEELRAVQIKRRQDQVCTERESQIRTKEEVRRVQEEEEKLFAQMWESDRLAKEERHNLELQRQRENNLQQKAVLQTQMDMAEQQRIQAKELKQEEAQLLKDQREMLRLEAEREHRQKLQDQEKRRKQLDLSLRLKMKRLTRDRQEELALDMSILEQLLAQEKDEKQDEVLKKLERQEEQRRYREYLSQQLEEQKRLEAETEQLFESELQQAWARREAQWRLEKTARDRLMKDVMDTLRLQIQEKLNENMQKQAEAFKEKEELDRIIQANKLLDEEEKAHFREATKEYQADLLAQMMY 457          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Zebrafish
Match: tchp (trichoplein, keratin filament binding [Source:NCBI gene;Acc:678595])

HSP 1 Score: 61.6178 bits (148), Expect = 1.181e-9
Identity = 49/168 (29.17%), Postives = 98/168 (58.33%), Query Frame = 2
Query:  812 ELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            EL++LE++    E+ +++ +         R +LKR  +++QEE+  D KI+  LL G   E      ++++ + D+     ++K++ E++L     RE E D +  EE  R W+KR  +W++E  AR++L++EV+  R+QQ+++R++ N   + ++L  RE+  + +E
Sbjct:  251 ELEKLEDERKMMEESRRKTEFGRFLTRQYRAQLKRRAQQVQEELEADRKILAALLEGELDEQRFHKARRERAVADA----AWMKRVIEEQLQLEREREAEFDILYREEAQRVWEKREAEWEKERRARERLMREVLAGRQQQLQERMQENRLAREESLQRREELLQQLE 414          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Match: st3gal2.1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2, gene 1 [Source:Xenbase;Acc:XB-GENE-963532])

HSP 1 Score: 148.673 bits (374), Expect = 2.918e-38
Identity = 156/518 (30.12%), Postives = 288/518 (55.60%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLAST----FREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNA-------NYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRS-HPWRK 1537
            M+  Q+ + + RE  GP P SVA++A+ P SR  D  I + ++  + R       K   T  ++ EW R + +K+L  +     +R  Q  K  ++E    RR+RL  ++  E  + ++EM +  ET +ERQAK+RE+ + L+E++  +       K +Q +RDQ E+LR+  S+    E+  + +  I  KE + +++K ED  F +LW  D   KEE+E++   K +  NQE+  +   Q +    ++ +EK LK+EE  L  +   L +LE + + +EK + + + + + + ++R K+KR  RE QEE+ALD KI+E+++ G++ +   +  +K +L  + + YR+YL Q  E+E  +E+E+D M+  E+ +SW K+ +Q  +E +AR +L+++V++ R+ Q+ ++L  N   Q +   D+E    L++R  +E   HK+   E+NA        Y+ DL+ Q+A+ ++  +   +E + E ++    E+ +Q  +   LS  +V   + HP R+
Sbjct:    1 MLYSQRSRPRLREVTGPQPHSVAVVAKFPSSRPIDFAILERRRYEEAREHMLTFTKQNTTERVKNEWARVTEKKLLHNTVQRAVYRTMQEYKMHLEE----RRERLSTLLEREEMEHIKEMEAMEETTLERQAKMRERVKSLREKREKERMDFVAEKREQQFRDQCEELRSLRSQIHLNEVCTERMAQIALKEEINRQRKEEDTIFDQLWEHDRLAKEEQEEKKRQKRMELNQEIASL---QKAASEAQKMQEKWLKDEESKLVAEERRLIKLEEERSLKEKQQNRLQVKSMLEDSIRLKMKRLAREQQEELALDMKILEHVMQGYQDDTEEKRQRKMELKKEQQIYREYLAQQLEEEKRQEREMDKMIEAELEKSWAKKTEQMRKEKEARNRLMKDVMDTRRVQIHEKLEKNAKLQEELAQDKE----LLQRATEE---HKQLETERNARQMNLAQQYQQDLLSQVAYQQWQRQAEREEEQREYEAGMAAEKAYQNTLREILSRPYVGHENIHPLRR 504          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Match: ENSXETT00000035157.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 65.0846 bits (157), Expect = 1.734e-10
Identity = 53/176 (30.11%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELRE 1420
            ++KR  + +QEE+ +D +I+  L++  +   +LQ  +++Q + D      ++K + E++L     RE ELD +  EE  + W KR  +W+RE +AR +L++EV+  R+ Q+++R+  N+  Q +++ +RE   + +E  +Q     KK   E+    R +L  QI    F   LRE
Sbjct:  346 QMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADV----TWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQI----FEQRLRE 513          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Match: ENSXETT00000021681.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 64.3142 bits (155), Expect = 2.376e-10
Identity = 53/176 (30.11%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELRE 1420
            ++KR  + +QEE+ +D +I+  L++  +   +LQ  +++Q + D      ++K + E++L     RE ELD +  EE  + W KR  +W+RE +AR +L++EV+  R+ Q+++R+  N+  Q +++ +RE   + +E  +Q     KK   E+    R +L  QI    F   LRE
Sbjct:  283 QMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADV----TWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQI----FEQRLRE 450          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Match: ENSXETT00000035168.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 64.3142 bits (155), Expect = 2.538e-10
Identity = 53/176 (30.11%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELRE 1420
            ++KR  + +QEE+ +D +I+  L++  +   +LQ  +++Q + D      ++K + E++L     RE ELD +  EE  + W KR  +W+RE +AR +L++EV+  R+ Q+++R+  N+  Q +++ +RE   + +E  +Q     KK   E+    R +L  QI    F   LRE
Sbjct:  281 QMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADV----TWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQI----FEQRLRE 448          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Match: ENSXETT00000035176.1 (trichoplein, keratin filament binding [Source:NCBI gene;Acc:100379712])

HSP 1 Score: 64.3142 bits (155), Expect = 2.676e-10
Identity = 53/176 (30.11%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELRE 1420
            ++KR  + +QEE+ +D +I+  L++  +   +LQ  +++Q + D      ++K + E++L     RE ELD +  EE  + W KR  +W+RE +AR +L++EV+  R+ Q+++R+  N+  Q +++ +RE   + +E  +Q     KK   E+    R +L  QI    F   LRE
Sbjct:  300 QMKRRAQLVQEELMMDKQILSALISKEDEGQHLQSARREQAIADV----TWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKREAEWERERNARNRLMKEVLAARQMQIQERIERNQLAQAESIKNREQLLRQLEEARQFTSREKKEEEEQKTTRRAELKAQI----FEQRLRE 467          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Mouse
Match: Cfap53 (cilia and flagella associated protein 53 [Source:MGI Symbol;Acc:MGI:1921703])

HSP 1 Score: 105.145 bits (261), Expect = 1.353e-23
Identity = 139/470 (29.57%), Postives = 246/470 (52.34%), Query Frame = 2
Query:   50 TREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEW-ERNSRQKMLLASTFREFQHAKCQ-IQEGIEI----RRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKD-NLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAY------EEKLKKQ---QKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRET----DARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFA---KLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 1390
             REF+GP P +V I A+PP ++ ++Q +K +++            K  E   ++ +W +RN+ +      TF     A+ Q   +G  I    RR++LR+++  E  +   EM    ET+ E++ K+RE+ + L+E+K  + Q     K DQ +R++ E+LRT L+     ++ ++ N ++  +KEL  Q K  E+  FARLW +D   KE RE Q+      R +E+      QN+ +    Q      + +   R++  E + LE + A       +EKL+KQ   Q+TR      ++ K++   RE +E++ L+ K++   L   + EA+ +  K++++  + + Y DYL Q +E+E  +EKEL+ ++ E+I     K++ + DRE      ARKQL+ EV+N RK QV++RL+     Q +  +  +  +   K++ +   ED   + ++ E+   YRN L  QIA
Sbjct:   10 PREFKGPTPKAVIIRAKPPKAQRAEQHLKRIQRSYHKYHTTLASIKSNEENRLKCDWIQRNNHK------TFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDKMRERTKLLREKKEKERQEFVAEKLDQQFRERCEELRTKLASIHEKKVVEERNAQIEFNKELKRQ-KLVEEHLFARLWEEDRLAKERREAQEEK----RQRELV-----QNTRLGLDAQVTSIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRALQDLQDEADKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLL-EDIK---AKKLAEKDRELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCALAEE---YRNQLQMQIA 456          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Mouse
Match: Tchp (trichoplein, keratin filament binding [Source:MGI Symbol;Acc:MGI:1925082])

HSP 1 Score: 60.8474 bits (146), Expect = 2.671e-9
Identity = 48/144 (33.33%), Postives = 81/144 (56.25%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQ---IGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQ 1315
            +L R  +E+QEE+ +D +I++ LL   E E  LQ   + +++Q   D+     ++KQ+ E++L     RE EL  ++ EE    W+KR  +W RE  AR +L+ EV+  R+QQ+ +++  N   Q + L  RE   + +E  KQ
Sbjct:  280 QLNRRTQEIQEELEVDGRILQALL---EKEGELQQVELARREQARADA----AWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKREAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLEEGKQ 416          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Mouse
Match: Tchp (trichoplein, keratin filament binding [Source:MGI Symbol;Acc:MGI:1925082])

HSP 1 Score: 58.5362 bits (140), Expect = 2.812e-9
Identity = 46/140 (32.86%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  905 KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQ---IGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            +L R  +E+QEE+ +D +I++ LL   E E  LQ   + +++Q   D+     ++KQ+ E++L     RE EL  ++ EE    W+KR  +W RE  AR +L+ EV+  R+QQ+ +++  N   Q + L  RE   + +E
Sbjct:   81 QLNRRTQEIQEELEVDGRILQALL---EKEGELQQVELARREQARADA----AWMKQVIEEQLQLEKAREAELQQLLREEAKEMWEKREAEWAREQVARDRLMSEVLTGRQQQILEKIEQNRRAQEETLKHREKLIRSLE 213          
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Match: sp|A0A0R4IFG5|CFA53_DANRE (Cilia- and flagella-associated protein 53 OS=Danio rerio OX=7955 GN=cfap53 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 9.579e-44
Identity = 158/458 (34.50%), Postives = 266/458 (58.08%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAF 1393
            M+T Q+ + + RE  GPA  SVA+ ARPP SR  D I    +KQ   R    E  KD  +  +R  WERN++++++ A+  R  Q A  Q Q GI+ +R+RLR+++  E  +L +EM +  ETV+ERQAK+ E+A+ L+E +  + Q V   K DQ++R+QSE+LR    K+   ++  +    IR+KE + + ++ E++ FA++W  D   KEER   ++ +    N +   +L  Q  +  ++R + K+LK+EE  L     E+ +LE +  + +KL+ Q+K R   D +LR K+KR  R+ QEE+ALD  I+E LLA  + E   ++ KK +  ++ RRYR+YL Q  E++   E E + +   E+ ++W +R  QW  E  AR +L+++V++  + Q++++L  N   Q +A  ++E+  ++I+  K  DE  K    E    Y+ DL+ Q+ +
Sbjct:    1 MLTAQRSRIRCREITGPA-HSVALKARPPLSRDIDDIFVRRRKQEATRGEVLEFTKDQSSCDVRMRWERNTQRRVVSATVNRHLQDALDQYQMGIDEKRERLRELLESEELELFKEMEAKKETVLERQAKMHERAKTLRERRESERQRVVADKLDQLFREQSEELRAVQIKRRQDQVCTERESQIRTKEEVRRVQEEEEKLFAQMWESDRLAKEERHNLELQRQRENNLQQKAVLQTQMDMAEQQRIQAKELKQEEAQLLKDQREMLRLEAEREHRQKLQDQEKRRKQLDLSLRLKMKRLTRDRQEELALDMSILEQLLAQEKDEKQDEVLKKLERQEEQRRYREYLSQQLEEQKRLEAETEQLFESELQQAWARREAQWRLEKTARDRLMKDVMDTLRLQIQEKLNENMQKQAEAFKEKEELDRIIQANKLLDEEEKAHFREATKEYQADLLAQMMY 457          
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Match: sp|Q9D439|CFA53_MOUSE (Cilia- and flagella-associated protein 53 OS=Mus musculus OX=10090 GN=Cfap53 PE=2 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 9.465e-23
Identity = 139/470 (29.57%), Postives = 246/470 (52.34%), Query Frame = 2
Query:   50 TREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEW-ERNSRQKMLLASTFREFQHAKCQ-IQEGIEI----RRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKD-NLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAY------EEKLKKQ---QKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRET----DARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFA---KLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 1390
             REF+GP P +V I A+PP ++ ++Q +K +++            K  E   ++ +W +RN+ +      TF     A+ Q   +G  I    RR++LR+++  E  +   EM    ET+ E++ K+RE+ + L+E+K  + Q     K DQ +R++ E+LRT L+     ++ ++ N ++  +KEL  Q K  E+  FARLW +D   KE RE Q+      R +E+      QN+ +    Q      + +   R++  E + LE + A       +EKL+KQ   Q+TR      ++ K++   RE +E++ L+ K++   L   + EA+ +  K++++  + + Y DYL Q +E+E  +EKEL+ ++ E+I     K++ + DRE      ARKQL+ EV+N RK QV++RL+     Q +  +  +  +   K++ +   ED   + ++ E+   YRN L  QIA
Sbjct:   10 PREFKGPTPKAVIIRAKPPKAQRAEQHLKRIQRSYHKYHTTLASIKSNEENRLKCDWIQRNNHK------TFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDKMRERTKLLREKKEKERQEFVAEKLDQQFRERCEELRTKLASIHEKKVVEERNAQIEFNKELKRQ-KLVEEHLFARLWEEDRLAKERREAQEEK----RQRELV-----QNTRLGLDAQVTSIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRALQDLQDEADKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLL-EDIK---AKKLAEKDRELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCALAEE---YRNQLQMQIA 456          
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Match: sp|Q96M91|CFA53_HUMAN (Cilia- and flagella-associated protein 53 OS=Homo sapiens OX=9606 GN=CFAP53 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 2.890e-18
Identity = 128/505 (25.35%), Postives = 256/505 (50.69%), Query Frame = 2
Query:   53 REFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAY------EEKLKKQ---QKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRS-HPWRK 1537
            RE +GP P  V + ++PP  + ++  ++ +++            K  E   ++ EW++++  K+L +      + A       IE RR++LR+++  E  +   EM    ET+ E++ ++REK + LKE+   + Q     K DQ +R++ E+LR  L      ++ ++    I   E + ++K  E++ F++LW +D   KE+RE Q+     AR Q   K L+E N+ +    Q      + + T  L+  E + +E++NA       ++ LKKQ   Q+TR I    L+++++   +E ++E  L+ K+++  L   + EA+ +  K++ ++ + + Y  YL Q +E+E  +EKE D ++ E+  +   ++  +   E +AR+QL+ EV+  RK QV+++L+     Q +  ++++   + ++    E++ +          YR  L  QIA+ +   E  ++E+  E ++     +    ++   LS   V P++ HP RK
Sbjct:   11 REVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERDRLKAEWDQHNDCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQLKKETIEEKKDRMREKTKLLKEKNEKERQDFVAEKLDQQFRERCEELRVELLSIHQKKVCEERKAQIAFNEELSRQKLVEEQMFSKLWEEDRLAKEKREAQE-----ARRQ---KELME-NTRLGLNAQITSIKAQRQATQLLKEEEARLVESNNAQIKHENEQDMLKKQKAKQETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKDKELRLEKEARRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQKHINESLKELNCEEKENFARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAANKMCLDKVQEVLSTHQVLPQNIHPMRK 506          
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Match: sp|A0AUT1|TCHP_XENLA (Trichoplein keratin filament-binding protein OS=Xenopus laevis OX=8355 GN=tchp PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.385e-12
Identity = 51/165 (30.91%), Postives = 97/165 (58.79%), Query Frame = 2
Query:  908 LKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQEL----VREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 1390
            +KR  +++QEE+ +D KI+  L++  + + +LQ  +++Q + D      ++K + E++L     RE ELD +  EE  + W KR  +W+RE +AR +L++EV+  R+ Q+++R+  N+  Q +++++RE   + +E  +Q     KK   E+    R +L  QIA
Sbjct:  283 MKRRAQQVQEELEMDKKILSALISKEDEDQHLQSARREQAIADV----AWMKHVIEEQLHLERQREAELDTLFREEAKQVWAKRETEWERERNARNRLMKEVLAGRQMQIQERIERNQLAQAESVMNRERLLRQLEEARQFTSREKKQEEEQKTARRTELEAQIA 443          
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Match: sp|Q1RM03|TCHP_DANRE (Trichoplein keratin filament-binding protein OS=Danio rerio OX=7955 GN=tchp PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.919e-9
Identity = 49/168 (29.17%), Postives = 98/168 (58.33%), Query Frame = 2
Query:  812 ELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            EL++LE++    E+ +++ +         R +LKR  +++QEE+  D KI+  LL G   E      ++++ + D+     ++K++ E++L     RE E D +  EE  R W+KR  +W++E  AR++L++EV+  R+QQ+++R++ N   + ++L  RE+  + +E
Sbjct:  251 ELEKLEDERKMMEESRRKTEFGRFLTRQYRAQLKRRAQQVQEELEADRKILAALLEGELDEQRFHKARRERAVADA----AWMKRVIEEQLQLEREREAEFDILYREEAQRVWEKREAEWEKERRARERLMREVLAGRQQQLQERMQENRLAREESLQRREELLQQLE 414          
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Match: A0A1S3HHY1 (cilia- and flagella-associated protein 53-like OS=Lingula unguis OX=7574 GN=LOC106155374 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.585e-76
Identity = 188/506 (37.15%), Postives = 320/506 (63.24%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            M+  Q+ + + RE  GP+P SVAI+ARP   R  + +I + +K+ + R     Q K  E   ++ +WER + +++ + +  R+        Q GIE RR++LR ++ EE +Q L+EM    ETV+ERQAK+R +A+ L+E++  +   + + K DQ +R++ E+LR+TLSK+   E+  + LE +R KE + +EKK E+  +A LW+ D+  K ERE+++     ARN+E+  ++  Q + +  ++++  +L+EEE  L  Q  +L++LE   A EEK ++QQ+TR+I+D ++R K+KR  +E+QEE+A D KI+E LL     EA  Q  +KK+L ++ RRYR+YLKQ+ E+E +RE E++ +++E++ R WQKR+ QW  E +ARK+LL+EV+ +R+QQ+ ++L +NE  QR+AL++RE+  + IE  KQ +   ++   +KN  Y++DL  Q+ + +    +   E + E +   E E  ++ ++ A L   +VD + HP RK
Sbjct:    1 MMATQRQR-RCREHTGPSPHSVAIVARPTNKRPPEHLILERRKKEEMREEALHQTKYNEFCDLKNDWERWTDRRIQINTVKRKVAGLMQAEQFGIEDRREKLRDLLMEEEQQYLKEMEEKEETVLERQAKMRGRAKDLREKREQERMQIVKEKLDQKFRNECEELRSTLSKRHQDEVCTERLEQLRIKERIEEEKKQEEAMYADLWHKDMLSKMEREEREAQAQHARNREVLGVIQLQRAALEAQKEEAIRLREEEARLLAQQNQLRKLEEQQALEEKRRQQQETREIYDRSVRMKMKRKAKEIQEELAFDMKILEQLLEESRNEAMEQEQRKKELREEDRRYREYLKQMLEEEKIRESEMERLIDEDVERMWQKRLAQWRLEKEARKKLLEEVLAVRRQQINEKLSINEKKQREALVEREEILRAIEENKQIELEQQERQRQKNLQYQSDLEGQMNYTQRQKHIESLEAQREYEKQLEAEMAYRHKLKAELDRPYVD-KVHPMRK 504          
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Match: A0A1S3IG99 (cilia- and flagella-associated protein 53 OS=Lingula unguis OX=7574 GN=LOC106163759 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.388e-75
Identity = 187/506 (36.96%), Postives = 319/506 (63.04%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            M+  Q+ + + RE  GP+P SVAI+ARP   R  + +I + +K+ + R     Q K  E   ++ +WER + +++ + +  R+        Q GIE RR++LR ++ EE +Q L+EM    ETV+ERQAK+R +A+ L+E++  +   + + K DQ +R++ E+LR+TLSK+   E+  + LE +R KE + +EKK E+  +A LW+ D+  K ERE+++     ARN+E+  ++  Q + +  ++++  +L+EEE  L  Q  +L++LE   A EEK ++QQ+TR+I+D ++R K+KR  +E+QEE+A D KI+E LL     EA  Q  +KK+L ++ RRYR+YLKQ+ E+E +RE E++ +++E++ R WQKR+ QW  E +ARK+LL+EV+ +R+QQ+ ++L +NE  QR+AL++RE+  + IE  KQ +   ++   +KN  Y++DL  Q+ + +    +   E + E +   E E  ++ ++   L   +VD + HP RK
Sbjct:    1 MMATQRQR-RCREHTGPSPHSVAIVARPTNKRPPEHLILERRKKEEMREEALHQTKYNEFCDLKNDWERWTDRRIQINTVKRKVAGLMQAEQFGIEDRREKLRDLLMEEEQQYLKEMEEKEETVLERQAKMRGRAKDLREKREQERMQIVKEKLDQKFRNECEELRSTLSKRHQDEVCTERLEQLRIKERIEEEKKQEEAMYADLWHKDMLSKMEREEREAQAQHARNREVLGVIQLQRAALEAQKEEAIRLREEEARLLAQQNQLRKLEEQQALEEKRRQQQETREIYDRSVRMKMKRKAKEIQEELAFDMKILEQLLEESRNEAMEQEQRKKELREEDRRYREYLKQMLEEEKIRESEMERLIDEDVERMWQKRLAQWRLEKEARKKLLEEVLAVRRQQINEKLSINEKKQREALVEREEILRAIEENKQIELEQQERQRQKNLQYQSDLEGQMNYTQRQKHIESLEAQREYEKQLEAEMAYRHKLKEELDRPYVD-KVHPMRK 504          
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Match: A0A267ECB0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024162g1 PE=4 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.196e-73
Identity = 188/506 (37.15%), Postives = 314/506 (62.06%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            M+T++K + + REFRGP P SV IL R PGS   D II+  +++A  R   + + +      +R +WE+ + +++   +  R  Q  + Q++  IE RRDRLR ++  +  + L+EM++  ETV+ERQAK+RE+A++L+EEK  + Q + + K +++WR+QSE+LRT L K+  AE+  +    +  K+ +  +++ E+ YF  LW D++  K ERE++D+ +   R  E   +L +Q +    +R +E +LKEEE  L  +M EL+++E   A EE+ +K+Q+TR + D N+R ++++  RE QEE+A D KI+E L      E      +K  + ++ RRYR+YL+ + E+E  RE EL+ +++ EI + WQKRVDQW RE +AR+QLL++V+  R+ Q+++RL  NE  QR+A  ++ +    IE  K E+     + H+KN N+  +L  QI FN    +L+E+ER  E + +++E E   +R+ A  + +W+DP+ HP RK
Sbjct:   18 MLTVEKRRTRQREFRGPEPNSVGILGRTPGSGGGDWIIQQSREEAARRAERDAEVRAQALMDMRSDWEQQTNKRLQRKAVNRRLQEYRRQMEMRIEERRDRLRALLEADERRHLEEMDASQETVLERQAKMRERAKQLREEKEAERQQLVEQKMNELWREQSEELRTNLQKRHLAEVIAERDNQVHLKKRLEAQRQAEERYFHELWKDELAAKAEREERDLAERKQREMETVAVLEQQRAAFKARRDEELKLKEEEAQLVREMEELRKVEAAQAAEERRRKEQETRRMLDRNIRLRMRQKAREAQEELAFDMKILEQLAEESRVEEANTRARKLAMREEDRRYREYLRNMMEEEKAREAELERLLDAEIQQQWQKRVDQWRREKEARRQLLEQVMAERRTQIQERLLANERRQREAAEEKAEILARIEAMKVEEREEAAARHQKNLNFGEELKAQINFNEHLRQLQEEERRQEEERLRQERERELERLRAAANMEWIDPKMHPMRK 523          
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Match: A0A267DKA7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024162g2 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.137e-72
Identity = 187/506 (36.96%), Postives = 314/506 (62.06%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            M+T++K + + REFRGP P SV IL R PGS   D II+  +++A  R   + + +      +R +WE+ + +++   +  R  Q  + Q++  IE RRDRLR ++  +  + L+EM++  ETV+ERQAK+RE+A++L+EEK  + Q + + K +++WR+QSE+LRT L K+  AE+  +    +  K+ +  +++ E+ YF  LW +++  K ERE++D+ +   R  E   +L +Q +    +R +E +LKEEE  L  +M EL+++E   A EE+ +K+Q+TR + D N+R ++++  RE QEE+A D KI+E L      E      +K  + ++ RRYR+YL+ + E+E  RE EL+ +++ EI + WQKRVDQW RE +AR+QLL++V+  R+ Q+++RL  NE  QR+A  ++ +    IE  K E+     + H+KN N+  +L  QI FN    +L+E+ER  E + +++E E   +R+ A  + +W+DP+ HP RK
Sbjct:   18 MLTVEKRRTRQREFRGPEPNSVGILGRTPGSGGGDWIIQQSREEAARRAERDAEVRAQALMDMRSDWEQQTNKRLQRKAVNRRLQEYRRQMEMRIEERRDRLRALLEADERRHLEEMDASQETVLERQAKMRERAKQLREEKEAERQQLVEQKMNELWREQSEELRTNLQKRHLAEVIAERDNQVHLKKRLEAQRQAEERYFHELWKEELAAKAEREERDLAERKQREMETVAVLEQQRAAFKARRDEELKLKEEEAQLVREMEELRKVEAAQAAEERRRKEQETRRMLDRNIRLRMRQKAREAQEELAFDMKILEQLAEESRVEEANTRARKLAMREEDRRYREYLRNMMEEEKAREAELERLLDAEIQQQWQKRVDQWRREKEARRQLLEQVMAERRTQIQERLLANERRQREAAEEKAEILARIEAMKVEEREEAAARHQKNLNFGEELKAQINFNEHLRQLQEEERRQEEERLRQERERELERLRAAANMEWIDPKMHPMRK 523          
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Match: A0A267DJG8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024162g3 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.202e-72
Identity = 187/506 (36.96%), Postives = 314/506 (62.06%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            M+T++K + + REFRGP P SV IL R PGS   D II+  +++A  R   + + +      +R +WE+ + +++   +  R  Q  + Q++  IE RRDRLR ++  +  + L+EM++  ETV+ERQAK+RE+A++L+EEK  + Q + + K +++WR+QSE+LRT L K+  AE+  +    +  K+ +  +++ E+ YF  LW +++  K ERE++D+ +   R  E   +L +Q +    +R +E +LKEEE  L  +M EL+++E   A EE+ +K+Q+TR + D N+R ++++  RE QEE+A D KI+E L      E      +K  + ++ RRYR+YL+ + E+E  RE EL+ +++ EI + WQKRVDQW RE +AR+QLL++V+  R+ Q+++RL  NE  QR+A  ++ +    IE  K E+     + H+KN N+  +L  QI FN    +L+E+ER  E + +++E E   +R+ A  + +W+DP+ HP RK
Sbjct:   22 MLTVEKRRTRQREFRGPEPNSVGILGRTPGSGGGDWIIQQSREEAARRAERDAEVRAQALMDMRSDWEQQTNKRLQRKAVNRRLQEYRRQMEMRIEERRDRLRALLEADERRHLEEMDASQETVLERQAKMRERAKQLREEKEAERQQLVEQKMNELWREQSEELRTNLQKRHLAEVIAERDNQVHLKKRLEAQRQAEERYFHELWKEELAAKAEREERDLAERKQREMETVAVLEQQRAAFKARRDEELKLKEEEAQLVREMEELRKVEAAQAAEERRRKEQETRRMLDRNIRLRMRQKAREAQEELAFDMKILEQLAEESRVEEANTRARKLAMREEDRRYREYLRNMMEEEKAREAELERLLDAEIQQQWQKRVDQWRREKEARRQLLEQVMAERRTQIQERLLANERRQREAAEEKAEILARIEAMKVEEREEAAARHQKNLNFGEELKAQINFNEHLRQLQEEERRQEEERLRQERERELERLRAAANMEWIDPKMHPMRK 527          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Cavefish
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:103021622])

HSP 1 Score: 188.734 bits (478), Expect = 5.504e-53
Identity = 160/457 (35.01%), Postives = 264/457 (57.77%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYL-KQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQI 1387
            M+  Q+H+ Q REF GP P SVA+ AR P S+  D  I + +KQ   R    E  KD +T  ++  WERN+ Q+M+ A+  R    A  Q Q  I+ RR+RLR+++  E  + L+      ETV+ERQ K+R +A+ L+E++  + Q VA  K DQ++R+Q E+LRT  + +   EI ++    IR+++   +  K E+  FA LW +D   KE+RE Q+  +    N      L +Q     ++RQ+ KQLKEEE  L  +  E+ +LE    +++KL+ Q++ R   D +LR K+KR  +E Q+E+ALD  I+E LL   + E   +  +K +L  + + YR YL +QL+EQ  + E E + ++  E+ ++W +R  QW+ E +AR +L+++V++ R+ Q++++L  N   Q +   +R+D  ++++  K  DE  K  + E    Y+ DL+ QI
Sbjct:    1 MLMSQRHRTQCREFTGPTPHSVAVRARHPSSKPPDYFILERRKQEVSRNKVLEFTKDQKTCDLKMLWERNTEQRMVSATIDRRVNEAMEQYQMSIDERRERLRKMLESEEREFLRATEEQNETVLERQTKMRARAKYLQEKRESERQKVAAEKLDQLFREQCEELRTAETLRRRDEICRERAAQIRTRDEARRLHKDEEMLFANLWENDRLAKEQREIQEAQRQRESNFHTLAFLQDQMMAAEQQRQQAKQLKEEEAKLLREQSEMLRLEEQREHKQKLQSQERRRRQLDLSLRLKMKRVAQEQQDELALDMSILEQLLTIEKDEKKEEALRKLELCKEQQTYRQYLAEQLEEQRRL-EAETEQLIEAELQQTWNRRAAQWNLEKEARDRLMKDVLDTRRIQIQEKLERNAQKQVELAKERDDLNRVVQENKLLDEQEKTRLRESCLEYQADLLAQI 456          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Sea Lamprey
Match: cfap53 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:567344])

HSP 1 Score: 100.908 bits (250), Expect = 4.817e-23
Identity = 127/397 (31.99%), Postives = 237/397 (59.70%), Query Frame = 2
Query:  200 ATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLW-NDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDR---EDFAKLIERYKQEDEGHKKSIH-EKNANYRNDL 1375
            A ++GEWE+ S Q+   ++  R    A   +   ++ RR+RL +++ EE    L+E+    ET +ERQA++RE+A+ L+E++  + Q +   K DQ +R+QSE+LRT LS+    ++  +    +  ++   Q +  E+  FA LW  D + K E  E+Q +++A + N+E  + L +Q +   E+R++ K+LK+EE  L  +  EL ++E + A ++K +++Q+TR + D+++R KL+R  RE QEE+ LD +++E ++     E+  Q  +K +L  + + YR +L Q  E+E    +E++ +M  E+ R W++R +QW  E +AR +L ++V++ RKQQ++++L  N   Q++ + D+   E+ AK  +R ++E +   KS + E  A  R+ +
Sbjct:   33 ACVKGEWEQRSEQRATRSTVDRHLYTAMQGLSLSLQDRRERLTKLLEEEERGYLEELQRTQETTLERQARMRERAKALREQRECERQQLVTQKLDQQFREQSEELRTVLSRWHQDQVCTERHVQLAERDAARQREHQEERLFAELWERDRLAKTEREERQALERAES-NRESLQALQQQRAAAQEQREQAKRLKQEEAELMREQRELCKVEEERAQQDKQRQRQQTRAMLDSSVRFKLQRLARERQEEMDLDMRLLEQMVQTSSNESQDQQQRKMELRKEQQLYRQHLAQQAEEERQCAREMERLMGAELERMWRRREEQWRLEKEARNRLFKDVMDARKQQIQEKLDRNSHKQQELIQDQKLMEEAAKESKRIEEEQQARVKSANWEHQAALRSQI 428          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Nematostella
Match: EDO36212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC8])

HSP 1 Score: 95.5153 bits (236), Expect = 3.588e-21
Identity = 105/304 (34.54%), Postives = 187/304 (61.51%), Query Frame = 2
Query:  323 LRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDR 1234
            LR ++  E +Q +QEM +  ET +ERQAK+RE+AR LKE++  +   + + KYDQ WR++ E+LR+ LS++   E+  +  + IR K    Q +K  ++ +A LW  D++ K +RE+Q+  + + RN+E  ++L  Q+   A++R++E++LKE E     +   ++  E +   +EKL+KQ+  +   D ++R K ++  +E QEE+ALD KI+E LL     EA  +  +KK+L +++ R+  Y +  ++ E  RE+ L+  +N E+ + W K+++Q+  E  ARK+LL  V+  R+ Q+ +R
Sbjct:   26 LRDLLLNEEQQFIQEMEAKEETTLERQAKMRERARFLKEKREAERLQIVKEKYDQRWREECEELRSHLSRRHQDEVFSERSDQIRMKNEQKQREKDLEKMYADLWERDVKAKAQREEQEAMEQMERNRETLRVLQLQSEANAKQREEERRLKELEAEWLKEQNAMRAQEEEFLKQEKLRKQEAAKRARDVSIRLKNEKEAKEKQEELALDMKILEKLLDDTRNEAMEESQRKKELREENLRFMKYCEMNRKDEEDRERALEAHVNAEVEKQWAKKIEQYRIERAARKKLLDNVLQTRQLQMHER 329          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Nematostella
Match: EDO35876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKB0])

HSP 1 Score: 51.2174 bits (121), Expect = 8.179e-7
Identity = 43/157 (27.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query:  854 LKKQQKTRDIFDANLRQ---KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIE 1303
            L++ ++ R+     LRQ   ++ R ++E+Q+ + LD KI+E +      +  +   ++++   D+    +Y++Q+   +L     RE ELD +  +E  R W KR  +W+RE  AR++L+ EV+  RK+Q++D++      Q +++  RE+  + +E
Sbjct:  225 LEEARRKREFGRVLLRQHKAQMMRKSQEIQQALELDLKILEAMAKEESKDKEIMTSRREKAKADA----EYMRQVVADQLKLEREREAELDMLYRDEAARMWSKREAEWERERLARERLMAEVLAERKRQLDDKMSRLRQRQEESIESREELLRELE 377          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Nematostella
Match: EDO48130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK95])

HSP 1 Score: 50.447 bits (119), Expect = 1.388e-6
Identity = 39/135 (28.89%), Postives = 79/135 (58.52%), Query Frame = 2
Query:  854 LKKQQKTRDIFDANLRQ---KLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRL 1237
            L++ ++ R+     LRQ   ++ R ++E+Q+ + LD KI+E++      +  +   ++++   D+    +Y++Q+   +L     RE ELD +  +E  R W KR  +W+RE  AR++L+ EV+  RK+Q++D++
Sbjct:  263 LEEARRKREFGRVLLRQHKAQMMRKSQEIQQALELDLKILESMAKEENKDKEIMTSRREKAKADA----EYMRQVVADQLKLEREREAELDMLYRDEAARMWSKREAEWERERLARERLMAEVLAERKRQLDDKM 393          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Medaka
Match: ENSORLT00000037913.1 (cilia and flagella associated protein 53 [Source:NCBI gene;Acc:101173684])

HSP 1 Score: 72.7886 bits (177), Expect = 3.002e-13
Identity = 106/348 (30.46%), Postives = 193/348 (55.46%), Query Frame = 2
Query:  353 QLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALI--DREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 1390
            QLLQE+    ETV+E+QA++RE+ ++LK+ +  +     + K + ++R+Q E+LR   S++    + ++    +RS+      ++ E++ F +LW  D R KEE+E     +   RN E   +L  Q      +RQ+EK+L+EEE  L LQ  E+  L+     ++KL +Q + R   D  LR K++R  RE QEE+ LD KI++ +    + E      KK +L +  + +R +L +  E+    EKE + ++ E++   W KR ++   + +AR  L+++V+  R+ Q+++  +L+++ Q++A +  +RE+  +  E  K ++   K+S       YR+DL  QIA
Sbjct:   74 QLLQEVEEQKETVVEKQARMRERVKELKKRREEERTEEVERKMELLFREQCEELRCIQSQRQQQLVCQEREAQVRSRREQHTLQQLEEQLFHKLWEADHRAKEEQESARHQERQRRNLEQLNVLRSQREETERRRQQEKELREEEARLILQQKEVLLLQEQRNQQQKLLEQNRCRQQLDRGLRMKMRRLAREQQEELELDVKILQQMEEQQKEEQQQAGQKKMELWESQQTHRQHLSEELERRRKEEKETEQLLEEKLREVWTKREEKSRLQREARNLLMEQVMEARRLQIQN--KLDKSRQKKAELQKEREELCRATEESKIKEAEEKRSRRCAAVAYRDDLQAQIA 419          
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Medaka
Match: ENSORLT00000009185.2 (trichoplein keratin filament binding [Source:NCBI gene;Acc:101169367])

HSP 1 Score: 57.3806 bits (137), Expect = 2.114e-8
Identity = 43/142 (30.28%), Postives = 84/142 (59.15%), Query Frame = 2
Query:  863 QQKT--RDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELV----REKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQAL 1270
            Q+KT  R       R ++KR  +++Q E+  D +I+  LL G + E  L+  ++++ + D+     ++K++ E++L     RE E + +  EE  R W++R  QW++E  AR++L++EV+  R+QQ+E +++ N   Q ++L
Sbjct:  266 QKKTEIRHFLIRQYRAQMKRRAQQVQGELEADRRILAALLEGEQEEMKLETVRRERAVADA----AWMKRVIEEQLKLERQREAEFESLHREEAQRVWERREAQWEKERKARERLMREVLMGRQQQLELKMQKNREAQEESL 403          
BLAST of cilia- and flagella-associated protein 53 vs. Planmine SMEST
Match: SMESG000004919.1 (SMESG000004919.1)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 506/506 (100.00%), Postives = 506/506 (100.00%), Query Frame = 2
Query:   20 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIXXXXXXXXXXXXXXXXXXXDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAXXXXXXXXXXXXXXXXXXXMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQXXXXXXXXXXXXXXFFQKRIDATLSEDWVDPRSHPWRK 1537
            MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIERQAKLREKARKLKEEKALDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAEKRQKEKQLKEEEKTLRLQMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQERENERKSMKEEEEFFQKRIDATLSEDWVDPRSHPWRK
Sbjct:    1 MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVLCEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRDRLRQVITEEHEQLLQEMNSGYETVIERQAKLREKARKLKEEKALDNQMVAQMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDEYFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAEKRQKEKQLKEEEKTLRLQMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIAFNRFHDELREQERENERKSMKEEEEFFQKRIDATLSEDWVDPRSHPWRK 506          
BLAST of cilia- and flagella-associated protein 53 vs. Planmine SMEST
Match: SMESG000056471.1 (SMESG000056471.1)

HSP 1 Score: 58.5362 bits (140), Expect = 7.858e-9
Identity = 50/161 (31.06%), Postives = 90/161 (55.90%), Query Frame = 2
Query:  908 LKRHNREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQLKEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQQVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRNDLIQQIA 1390
            ++R ++++QEE+  D + +  L    E E  +Q  +K++  +D    ++ ++    +E  RE ELD +  EE  R W KR ++W +E  AR++L++EV+N RK QV+ ++      Q ++L +RE+    IER K+      +S  EK + +R+ L  Q A
Sbjct:  285 MRRKSQQIQEELESDIRFLSYLADRDEQENEIQTSRKEKAKEDLIWMQEAIEDQLRKEREREAELDSIFAEEAARLWSKRENEWAKEKQAREKLMEEVLNERKLQVQQKVLETRMMQVKSLQEREEILHEIERDKKIMNREIESAREKKSEFRSVLEDQKA 445          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CFAP536.018e-1925.35cilia and flagella associated protein 53 [Source:H... [more]
TCHP6.235e-731.39trichoplein keratin filament binding [Source:HGNC ... [more]
TCHP6.235e-731.39trichoplein keratin filament binding [Source:HGNC ... [more]
TCHP6.235e-731.39trichoplein keratin filament binding [Source:HGNC ... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap531.269e-4434.50cilia and flagella associated protein 53 [Source:N... [more]
tchp1.181e-929.17trichoplein, keratin filament binding [Source:NCBI... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st3gal2.12.918e-3830.12ST3 beta-galactoside alpha-2,3-sialyltransferase 2... [more]
ENSXETT00000035157.11.734e-1030.11trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000021681.12.376e-1030.11trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000035168.12.538e-1030.11trichoplein, keratin filament binding [Source:NCBI... [more]
ENSXETT00000035176.12.676e-1030.11trichoplein, keratin filament binding [Source:NCBI... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cfap531.353e-2329.57cilia and flagella associated protein 53 [Source:M... [more]
Tchp2.671e-933.33trichoplein, keratin filament binding [Source:MGI ... [more]
Tchp2.812e-932.86trichoplein, keratin filament binding [Source:MGI ... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0R4IFG5|CFA53_DANRE9.579e-4434.50Cilia- and flagella-associated protein 53 OS=Danio... [more]
sp|Q9D439|CFA53_MOUSE9.465e-2329.57Cilia- and flagella-associated protein 53 OS=Mus m... [more]
sp|Q96M91|CFA53_HUMAN2.890e-1825.35Cilia- and flagella-associated protein 53 OS=Homo ... [more]
sp|A0AUT1|TCHP_XENLA1.385e-1230.91Trichoplein keratin filament-binding protein OS=Xe... [more]
sp|Q1RM03|TCHP_DANRE8.919e-929.17Trichoplein keratin filament-binding protein OS=Da... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HHY11.585e-7637.15cilia- and flagella-associated protein 53-like OS=... [more]
A0A1S3IG991.388e-7536.96cilia- and flagella-associated protein 53 OS=Lingu... [more]
A0A267ECB02.196e-7337.15Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DKA71.137e-7236.96Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DJG81.202e-7236.96Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap535.504e-5335.01cilia and flagella associated protein 53 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap534.817e-2331.99cilia and flagella associated protein 53 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO362123.588e-2134.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358768.179e-727.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481301.388e-628.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000037913.13.002e-1330.46cilia and flagella associated protein 53 [Source:N... [more]
ENSORLT00000009185.22.114e-830.28trichoplein keratin filament binding [Source:NCBI ... [more]
back to top
BLAST of cilia- and flagella-associated protein 53 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004919.10.000e+0100.00SMESG000004919.1[more]
SMESG000056471.17.858e-931.06SMESG000056471.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032624 ID=SMED30032624|Name=cilia- and flagella-associated protein 53|organism=Schmidtea mediterranea sexual|type=transcript|length=1629bp
TTCAAAACGCACTTTTTAAATGATAACTTTACAAAAACATAAATATCAGA
CTAGGGAATTTAGAGGTCCTGCTCCTGGGTCAGTTGCAATCCTAGCTCGG
CCTCCAGGTTCCAGAGCATCAGATCAGATCATAAAAGATATGAAGAAACA
AGCAGATTACCGAGTACTGTGTGAAGAGCAGGCAAAGGATATTGAAACTG
CAACTATTCGAGGAGAATGGGAAAGAAATTCAAGACAAAAAATGCTACTA
GCGTCTACTTTTCGAGAATTTCAACATGCGAAATGTCAAATCCAGGAAGG
TATTGAAATACGCAGAGATCGTCTAAGACAAGTAATTACTGAGGAGCACG
AACAATTGCTTCAAGAAATGAATTCTGGTTACGAAACAGTAATTGAAAGA
CAGGCAAAACTGAGAGAAAAGGCAAGGAAATTAAAGGAAGAAAAAGCATT
AGACAATCAAATGGTAGCTCAAATGAAATATGACCAAATGTGGAGAGATC
AAAGTGAACAACTAAGAACAACACTTAGTAAAAAAACTGCTGCTGAAATA
GCAAAAGACAACCTTGAACTAATTAGATCTAAAGAATTAATGATCCAAGA
AAAAAAATACGAAGATGAATATTTTGCACGTCTCTGGAATGATGACATAA
GAAAGAAGGAAGAAAGAGAAAAACAAGACATGGATAAAGCTGTAGCTAGA
AATCAAGAAATGACAAAAATATTGATCGAGCAAAATTCTTTAATAGCAGA
AAAGAGACAAAAAGAGAAACAATTGAAGGAAGAAGAAAAGACATTAAGGT
TGCAAATGCTAGAATTAAAACAACTGGAAAACGATAATGCATATGAAGAG
AAACTGAAAAAACAACAAAAAACTCGAGACATTTTTGATGCAAATCTCAG
ACAAAAATTGAAGCGACACAATAGAGAAATGCAAGAAGAAATTGCTCTTG
ACACAAAGATAATGGAAAATCTTCTAGCTGGCTTTGAAGCAGAAGCAAAT
TTACAAATCGGAAAGAAAAAACAACTCATGGATGATTCCAGGCGGTATCG
AGATTATCTAAAGCAATTAAAAGAACAAGAATTAGTTCGAGAAAAAGAAT
TGGATGATATGATGAATGAAGAAATAAATAGATCCTGGCAGAAACGGGTT
GATCAATGGGACCGTGAAACGGATGCTCGAAAACAGCTTCTTCAGGAAGT
CATAAATATTAGAAAACAACAAGTTGAAGATAGATTAAGACTAAATGAAG
CGAATCAAAGGCAAGCATTAATTGACAGAGAGGATTTTGCGAAATTAATC
GAGAGGTACAAGCAAGAGGATGAAGGCCATAAGAAGTCTATTCACGAAAA
GAATGCTAACTATCGTAACGATCTCATTCAGCAAATTGCGTTCAACAGAT
TTCACGATGAACTTAGAGAACAAGAAAGAGAAAATGAAAGAAAGTCAATG
AAGGAAGAAGAGGAATTTTTTCAAAAACGAATTGATGCGACTTTGAGTGA
AGATTGGGTTGATCCTCGATCACATCCTTGGAGAAAATAAGAAAACTTAA
GAAGATAAATACGTTGATAAGGATTGCTGTTTATGATTAAATGATAAATA
TAAAATTGGTTTTTGAGTATCAATATTGG
back to top

protein sequence of SMED30032624-orf-1

>SMED30032624-orf-1 ID=SMED30032624-orf-1|Name=SMED30032624-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MITLQKHKYQTREFRGPAPGSVAILARPPGSRASDQIIKDMKKQADYRVL
CEEQAKDIETATIRGEWERNSRQKMLLASTFREFQHAKCQIQEGIEIRRD
RLRQVITEEHEQLLQEMNSGYETVIERQAKLREKARKLKEEKALDNQMVA
QMKYDQMWRDQSEQLRTTLSKKTAAEIAKDNLELIRSKELMIQEKKYEDE
YFARLWNDDIRKKEEREKQDMDKAVARNQEMTKILIEQNSLIAEKRQKEK
QLKEEEKTLRLQMLELKQLENDNAYEEKLKKQQKTRDIFDANLRQKLKRH
NREMQEEIALDTKIMENLLAGFEAEANLQIGKKKQLMDDSRRYRDYLKQL
KEQELVREKELDDMMNEEINRSWQKRVDQWDRETDARKQLLQEVINIRKQ
QVEDRLRLNEANQRQALIDREDFAKLIERYKQEDEGHKKSIHEKNANYRN
DLIQQIAFNRFHDELREQERENERKSMKEEEEFFQKRIDATLSEDWVDPR
SHPWRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033365CFAP53
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 462..482
NoneNo IPR availableCOILSCoilCoilcoord: 121..141
NoneNo IPR availableCOILSCoilCoilcoord: 235..286
NoneNo IPR availableCOILSCoilCoilcoord: 333..367
NoneNo IPR availablePFAMPF13868TPHcoord: 158..490
e-value: 3.0E-12
score: 45.7
NoneNo IPR availablePANTHERPTHR31183FAMILY NOT NAMEDcoord: 26..505
IPR033365Cilia- and flagella-associated protein 53PANTHERPTHR31183:SF1CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 53coord: 26..505