TSNAXIP1_N domain-containing protein

Overview
NameTSNAXIP1_N domain-containing protein
Smed IDSMED30032616
Length (bp)2262
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TSNAXIP1_N domain-containing protein (SMED30032616) t-SNE clustered cells

Violin plots show distribution of expression levels for TSNAXIP1_N domain-containing protein (SMED30032616) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TSNAXIP1_N domain-containing protein (SMED30032616) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TSNAXIP1_N domain-containing protein (SMED30032616) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032616

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30032616SMESG000025884.1 SmedASXL_018388SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032616SMESG000025884.1 dd_Smed_v4_9605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30032616SMESG000025884.1 dd_Smed_v4_9605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30032616SMESG000025884.1 dd_Smed_v4_9605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30032616SMESG000025884.1 dd_Smed_v6_9605_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032616SMESG000025884.1 dd_Smed_v4_9605_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Human
Match: CLHC1 (clathrin heavy chain linker domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26453])

HSP 1 Score: 118.627 bits (296), Expect = 3.591e-27
Identity = 133/570 (23.33%), Postives = 248/570 (43.51%), Query Frame = 1
Query:  154 HKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK-SKIRRDLRR-LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-----KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN------PQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNL------ISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNES 1806
            ++  FD+++  +  Y+ +L  IK+EY+  I  + K ++ T  +  ++K  A+ PT +  + +   +L  K+ ++ +SNS +++   D   +C A       E   +E K     +D  + +P M L +  +L  +    + ++D+Y ++K+    KYVP   +  L  +++  + R D     V   + KK                  I      + VK+ +SS      + I++   + GD  I   +++   D+ R+    KE++ ++  I +F  L + G+Y+ A   A   PR +LRN  T+  FK +G       P +L +    + S      +D  L+ E + C L E R+DLV  W++Q R+  ++   D +  Y +    NK  CL LA  +Y                             S  G +  +IL C  K G+   V++ +            + K + TDDLL L+   P+ EL++ L  K L      +SF LA+  L  ++   V  +L+       G  +  E L+ +  S  + + W+E+ N  +++
Sbjct:   53 YRNVFDKVIEHITAYKSILTSIKKEYDAFIETIKKDRRTTFCLHGKLKGLAAEPTALVYYRKRTIQLEAKM-RIIESNSSKIQSQIDHIKQCRA-------EYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKADLDEEMIVLLKRRD-----VAENLNKKL---------QFCHQRLQIISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGI---VEELMEDDPRRA---KEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCLALAQIVY-----------------------------SECGLHKKAIL-CLCKQGQTHRVMEYI-----------QQLKDFTTDDLLQLLMSCPQVELIQCL-TKELNEKQPSLSFGLAILHLFSADMKKVGIKLL--QEINKGGIDAVESLMIN-DSFCSIEKWQEVANICSQN 549          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Human
Match: CLHC1 (clathrin heavy chain linker domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26453])

HSP 1 Score: 118.627 bits (296), Expect = 3.591e-27
Identity = 133/570 (23.33%), Postives = 248/570 (43.51%), Query Frame = 1
Query:  154 HKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK-SKIRRDLRR-LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-----KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN------PQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNL------ISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNES 1806
            ++  FD+++  +  Y+ +L  IK+EY+  I  + K ++ T  +  ++K  A+ PT +  + +   +L  K+ ++ +SNS +++   D   +C A       E   +E K     +D  + +P M L +  +L  +    + ++D+Y ++K+    KYVP   +  L  +++  + R D     V   + KK                  I      + VK+ +SS      + I++   + GD  I   +++   D+ R+    KE++ ++  I +F  L + G+Y+ A   A   PR +LRN  T+  FK +G       P +L +    + S      +D  L+ E + C L E R+DLV  W++Q R+  ++   D +  Y +    NK  CL LA  +Y                             S  G +  +IL C  K G+   V++ +            + K + TDDLL L+   P+ EL++ L  K L      +SF LA+  L  ++   V  +L+       G  +  E L+ +  S  + + W+E+ N  +++
Sbjct:   53 YRNVFDKVIEHITAYKSILTSIKKEYDAFIETIKKDRRTTFCLHGKLKGLAAEPTALVYYRKRTIQLEAKM-RIIESNSSKIQSQIDHIKQCRA-------EYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKADLDEEMIVLLKRRD-----VAENLNKKL---------QFCHQRLQIISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGI---VEELMEDDPRRA---KEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCLALAQIVY-----------------------------SECGLHKKAIL-CLCKQGQTHRVMEYI-----------QQLKDFTTDDLLQLLMSCPQVELIQCL-TKELNEKQPSLSFGLAILHLFSADMKKVGIKLL--QEINKGGIDAVESLMIN-DSFCSIEKWQEVANICSQN 549          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Human
Match: CLHC1 (clathrin heavy chain linker domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26453])

HSP 1 Score: 97.8265 bits (242), Expect = 9.010e-21
Identity = 106/452 (23.45%), Postives = 190/452 (42.04%), Query Frame = 1
Query:  502 RRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-----KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN------PQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNL------ISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNES 1806
            + +P M L +  +L  +    + ++D+Y ++K+    KYVP   +  L  +++  + R D     V   + KK                  I      + VK+ +SS      + I++   + GD  I   +++   D+ R+    KE++ ++  I +F  L + G+Y+ A   A   PR +LRN  T+  FK +G       P +L +    + S      +D  L+ E + C L E R+DLV  W++Q R+  ++   D +  Y +    NK  CL LA  +Y                             S  G +  +IL C  K G+   V++ +            + K + TDDLL L+   P+ EL++ L  K L      +SF LA+  L  ++   V  +L+       G  +  E L+ +  S  + + W+E+ N  +++
Sbjct:   41 KPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKADLDEEMIVLLKRRD-----VAENLNKKL---------QFCHQRLQIISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGI---VEELMEDDPRRA---KEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCLALAQIVY-----------------------------SECGLHKKAIL-CLCKQGQTHRVMEYI-----------QQLKDFTTDDLLQLLMSCPQVELIQCL-TKELNEKQPSLSFGLAILHLFSADMKKVGIKLL--QEINKGGIDAVESLMIN-DSFCSIEKWQEVANICSQN 427          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Celegans
Match: chc-1 (Probable clathrin heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:P34574])

HSP 1 Score: 51.6026 bits (122), Expect = 2.703e-6
Identity = 30/106 (28.30%), Postives = 56/106 (52.83%), Query Frame = 1
Query:  946 LSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL----GNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIAD 1251
            L +RKF  LF+ G++ ++  +A   P+G+LR  AT+ KF++       P  LL Y   L   L   +L+++ + E     L +GR +L+  W++  ++   + + D
Sbjct:  361 LFVRKFNLLFSNGQFGESAKVAASAPQGILRTPATIQKFQQCPSTGPGPSPLLQYFGIL---LDQGKLNKYETLELCRPVLAQGRKELITKWLNDQKLECCEELGD 463          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Xenopus
Match: clhc1 (clathrin heavy chain linker domain containing 1 [Source:NCBI gene;Acc:100145484])

HSP 1 Score: 93.5893 bits (231), Expect = 3.238e-19
Identity = 104/413 (25.18%), Postives = 187/413 (45.28%), Query Frame = 1
Query:  133 IHGRFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREG---KSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFK------ELGNPQILLYYCQQLV--STLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMN 1338
            I+GR      AFD+++     Y+ LL  IK EY+  I  + ++Q+    +Q +++  AS PTT+  + +   EL +KL ++ +++S R+E         + + KL   +S    G    S I+     +P M + D   +  +    +Q++ +   LK     KYV   E+ +L ++L   +   ++  +     + KK +L    K+     +   +  N   ++  A+   S+ I  +  +  D+   +  D+  P    +  SL E       + +F  LF   +Y  A   A   PRG+LRN  T+ KFK      E  +P +LLY+ + L+  S L    +   L+ E   CAL   +++LV  W++Q RI  ++ + D +  Y +    +K  CL LA  I+    N
Sbjct:   52 IYGR------AFDKVIEYCTDYKGLLSAIKCEYDEFIDVIKQSQRDAVHLQGKLRALASQPTTLVYNRKRAMELTKKL-EIIQNDSRRIE---------NQLEKLQTSKSLKTPGLEEPSDIKPS-SLIPGMTVEDSLSMEKLTQYQQQLEQKRDTLKADMKNKYVSVQEKIELEHKLSSALQDREEAEL-----LNKKLMLSYRQKRLVRDAIVAWMQSNKNVSLYDAV---SQAIANKNELKDDVCAAEVFDEHDPKKVSEGKSLLE------YVERFNELFLSRQYNAAAIHAANSPRGILRNMETMEKFKAAVVSDEDTSP-VLLYF-EALIGSSHLPKHPVSAELTLEGTKCALACEKLELVVHWVTQQRITYSEALGDVIYDYGEREPYHKPTCLALAHLIFKKCSN 431          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Mouse
Match: Clhc1 (clathrin heavy chain linker domain containing 1 [Source:MGI Symbol;Acc:MGI:1920574])

HSP 1 Score: 124.02 bits (310), Expect = 4.737e-29
Identity = 129/562 (22.95%), Postives = 255/562 (45.37%), Query Frame = 1
Query:  145 FQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK--SKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL----GNPQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKN-----LISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLN 1791
            +  ++  FD++++ V  Y+ +L  IK+EY+  I  + K ++    +  ++K+ A  PT +  H+R   +L  K+  +  +++        +Q++ D + +L   E   +E K  +  R+  + +P M L D  +L  +    + ++D+Y +LK+  ST YVP  ++ +L  +++  +NR D         I +        +   L  + + +   + + +  +     + I +  AI G  +I DEI   F D+    +  KE+  ++  I +F  L + G+Y+ A   A   P+ +L+N +T+ KFK +    G P  LL + + + +T +   + ++  L+ E + C L E R+DLV  W++Q ++  ++   D + +Y +    +K  CL LA  IY +   GL ++                             L C  K G+I E ++ +            + K   TDDL+ LI   P+ +L++ L  +       +SF LA+  +   +   V  +L+   S   G  ++ E L+ S     + + W+E+ N
Sbjct:   50 YTIYRNVFDKVIDYVSAYKSILTAIKKEYDAFIETIKKGRRTAFYLHGKLKVLAKEPTALVYHQRRAIQLEAKMRIIENNST-------AIQLQIDQMKQL-RMEYDKKEVKLCAPSRQLWKPIPGMTLQDSVNLEALNKHKQYLEDKYIKLKQDMSTMYVPAQKKAELDEEMVVLLNRRD---------IAENLKKDRQFRHQRLQVISHTLTPWMKQNMRISFQDVMERIRKTKAIYGYDNIVDEI---FEDDP---NKKKEAIVMLHYIERFNDLISLGEYERAACFAANSPKRILQNTSTMNKFKAIGKIRGKPLPLLLFFEAIFNTSQAFKRPINADLTMEGIKCGLSEERLDLVTHWVTQEKLTFSEKAGDIIFAYGEQHTYHKPRCLALAQIIYNEC--GLHRKA----------------------------LLCLCKQGQIHEAMEHI-----------QQSKDINTDDLIQLITACPQIDLIRCLTQERNEKPPFLSFGLAVLHMFSVDMKKVGMRLLQEVSK--GEKDVIEHLVMS-DLFCSLEKWQEIAN 544          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Mouse
Match: Clhc1 (clathrin heavy chain linker domain containing 1 [Source:MGI Symbol;Acc:MGI:1920574])

HSP 1 Score: 118.242 bits (295), Expect = 3.301e-27
Identity = 127/553 (22.97%), Postives = 250/553 (45.21%), Query Frame = 1
Query:  172 EIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK--SKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN----PQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKN-----LISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLN 1791
            ++++ V  Y+ +L  IK+EY+  I  + K ++    +  ++K+ A  PT +  H+R   +L  K+  +  +++        +Q++ D + +L   E   +E K  +  R+  + +P M L D  +L  +    + ++D+Y +LK+  ST YVP  ++ +L  +++  +NR D         I +        +   L  + + +   + + +  +     + I +  AI G  +I DEI   F D+    +  KE+  ++  I +F  L + G+Y+ A   A   P+ +L+N +T+ KFK +G     P  LL + + + +T +   + ++  L+ E + C L E R+DLV  W++Q ++  ++   D + +Y +    +K  CL LA  IY +   GL ++                             L C  K G+I E ++ +            + K   TDDL+ LI   P+ +L++ L  +       +SF LA+  +   +   V  +L+   S   G  ++ E L+ S     + + W+E+ N
Sbjct:   70 QVIDYVSAYKSILTAIKKEYDAFIETIKKGRRTAFYLHGKLKVLAKEPTALVYHQRRAIQLEAKMRIIENNST-------AIQLQIDQMKQL-RMEYDKKEVKLCAPSRQLWKPIPGMTLQDSVNLEALNKHKQYLEDKYIKLKQDMSTMYVPAQKKAELDEEMVVLLNRRD---------IAENLKKDRQFRHQRLQVISHTLTPWMKQNMRISFQDVMERIRKTKAIYGYDNIVDEI---FEDDP---NKKKEAIVMLHYIERFNDLISLGEYERAACFAANSPKRILQNTSTMNKFKAIGKIRGKPLPLLLFFEAIFNTSQAFKRPINADLTMEGIKCGLSEERLDLVTHWVTQEKLTFSEKAGDIIFAYGEQHTYHKPRCLALAQIIYNEC--GLHRKA----------------------------LLCLCKQGQIHEAMEHI-----------QQSKDINTDDLIQLITACPQIDLIRCLTQERNEKPPFLSFGLAVLHMFSVDMKKVGMRLLQEVSK--GEKDVIEHLVMS-DLFCSLEKWQEIAN 555          
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XIR8|CLHC1_RAT (Clathrin heavy chain linker domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Clhc1 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.877e-27
Identity = 121/561 (21.57%), Postives = 253/561 (45.10%), Query Frame = 1
Query:  145 FQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKL-INKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN----PQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKN-----LISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLN 1791
            +  ++  FD++++ V  Y+ +L  IK+EY+  I  V K ++    +  ++K+ A+ PT +  H+R   +L  K+ ++  +NS      + +Q++ D + +L +  E+   +  +  ++  + +P M L D  +L  + N  + ++D+ ++LK+  ST YV   ++  L  +++  + R D         I +        +   L  + + ++  + + +        + I+Q  AI G   +   +D+ F D+  +    KE+  ++  I +F  L + G+Y+ A   A   P+ +L+N  T+ KFK +G     P  LL + + + +T +   + ++  L+ E + C L E R+DLV  W++Q ++  ++ + D + +Y +    +K  CL LA  +Y                             +  G +  +IL C  + G+  E ++ +            + K   TDDL+ LI   P+ +L++ L  +       +SF L +  L   +   +  +L+   S      ++ E L+ S     + + W+EL N
Sbjct:   50 YTIYRNVFDKVIDYVNAYKSVLTSIKKEYDAFIETVKKGRRNAFYLHGKLKVLAAEPTALVYHQRRTIQLEAKM-RIIDNNS------KAIQLQIDQMKQLRMEYENTEVKLCASSKQLWKPIPGMTLQDSVNLDALNNHKQNLEDKCRKLKQDMSTMYVSAQKKADLDEEMIVLLKRRD---------IAENLNKDLRFRHQRLQVISHTLNSWMKQNMRIPFKDVLERIQQTKAIYGHAKV---VDELFEDDPNKT---KEAIVMLYYIERFHELISLGEYEKAACFAANSPKRILQNAGTMNKFKAIGKVRGKPLPLLLFFEAIFNTSQAFKRAINVDLTLEGIKCGLSEERLDLVTHWVTQAKLTFSEKVGDAICAYGEQHPYHKSKCLALAQIVY-----------------------------NECGLHKKAIL-CLCRQGQFHEAMEHI-----------QQSKDINTDDLIQLITACPQIDLIRGLTEERNGKPPFLSFGLTVLHLFSVDMKKIGMKLLQEVSK--AEKDVIEHLVMS-DLFCSIEKWQELAN 544          
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NHS4|CLHC1_HUMAN (Clathrin heavy chain linker domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CLHC1 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 1.725e-26
Identity = 133/570 (23.33%), Postives = 248/570 (43.51%), Query Frame = 1
Query:  154 HKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK-SKIRRDLRR-LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-----KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN------PQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNL------ISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNES 1806
            ++  FD+++  +  Y+ +L  IK+EY+  I  + K ++ T  +  ++K  A+ PT +  + +   +L  K+ ++ +SNS +++   D   +C A       E   +E K     +D  + +P M L +  +L  +    + ++D+Y ++K+    KYVP   +  L  +++  + R D     V   + KK                  I      + VK+ +SS      + I++   + GD  I   +++   D+ R+    KE++ ++  I +F  L + G+Y+ A   A   PR +LRN  T+  FK +G       P +L +    + S      +D  L+ E + C L E R+DLV  W++Q R+  ++   D +  Y +    NK  CL LA  +Y                             S  G +  +IL C  K G+   V++ +            + K + TDDLL L+   P+ EL++ L  K L      +SF LA+  L  ++   V  +L+       G  +  E L+ +  S  + + W+E+ N  +++
Sbjct:   53 YRNVFDKVIEHITAYKSILTSIKKEYDAFIETIKKDRRTTFCLHGKLKGLAAEPTALVYYRKRTIQLEAKM-RIIESNSSKIQSQIDHIKQCRA-------EYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKADLDEEMIVLLKRRD-----VAENLNKKL---------QFCHQRLQIISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGI---VEELMEDDPRRA---KEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCLALAQIVY-----------------------------SECGLHKKAIL-CLCKQGQTHRVMEYI-----------QQLKDFTTDDLLQLLMSCPQVELIQCL-TKELNEKQPSLSFGLAILHLFSADMKKVGIKLL--QEINKGGIDAVESLMIN-DSFCSIEKWQEVANICSQN 549          
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5M6W3|CLHC1_MOUSE (Clathrin heavy chain linker domain-containing protein 1 OS=Mus musculus OX=10090 GN=Clhc1 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.309e-26
Identity = 127/553 (22.97%), Postives = 250/553 (45.21%), Query Frame = 1
Query:  172 EIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGK--SKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN----PQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKN-----LISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLN 1791
            ++++ V  Y+ +L  IK+EY+  I  + K ++    +  ++K+ A  PT +  H+R   +L  K+  +  +++        +Q++ D + +L   E   +E K  +  R+  + +P M L D  +L  +    + ++D+Y +LK+  ST YVP  ++ +L  +++  +NR D         I +        +   L  + + +   + + +  +     + I +  AI G  +I DEI   F D+    +  KE+  ++  I +F  L + G+Y+ A   A   P+ +L+N +T+ KFK +G     P  LL + + + +T +   + ++  L+ E + C L E R+DLV  W++Q ++  ++   D + +Y +    +K  CL LA  IY +   GL ++                             L C  K G+I E ++ +            + K   TDDL+ LI   P+ +L++ L  +       +SF LA+  +   +   V  +L+   S   G  ++ E L+ S     + + W+E+ N
Sbjct:   70 QVIDYVSAYKSILTAIKKEYDAFIETIKKGRRTAFYLHGKLKVLAKEPTALVYHQRRAIQLEAKMRIIENNST-------AIQLQIDQMKQL-RMEYDKKEVKLCAPSRQLWKPIPGMTLQDSVNLEALNKHKQYLEDKYIKLKQDMSTMYVPAQKKAELDEEMVVLLNRRD---------IAENLKKDRQFRHQRLQVISHTLTPWMKQNMRISFQDVMERIRKTKAIYGYDNIVDEI---FEDDP---NKKKEAIVMLHYIERFNDLISLGEYERAACFAANSPKRILQNTSTMNKFKAIGKIRGKPLPLLLFFEAIFNTSQAFKRPINADLTMEGIKCGLSEERLDLVTHWVTQEKLTFSEKAGDIIFAYGEQHTYHKPRCLALAQIIYNEC--GLHRKA----------------------------LLCLCKQGQIHEAMEHI-----------QQSKDINTDDLIQLITACPQIDLIRCLTQERNEKPPFLSFGLAVLHMFSVDMKKVGMRLLQEVSK--GEKDVIEHLVMS-DLFCSLEKWQEIAN 555          
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R6I5|CLHC1_MACFA (Clathrin heavy chain linker domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=CLHC1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.821e-26
Identity = 130/568 (22.89%), Postives = 241/568 (42.43%), Query Frame = 1
Query:  154 HKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRR-LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-----KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN----PQILLYYCQQLVSTLKNQR--LDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLI-----AKNLISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNES 1806
            ++  FD+++  V  Y+ +L  IK+EY+  I  + K ++    +  ++K  A+ PT +  H +   +L  K+  +  ++S        +Q + D I +                +D  + +P M L +  +L  +    + ++D+Y ++K+    KYVP   ++ L  +++  + R D     V   + +K                  I      + VK+ +SS      + I++   + GD  I +E+ +  P  +      KE++ ++  I +F  L + G+Y+ A   A   PR +LRN  T+  FK +G     P  LL + + L  T    R  +D  L+ E + C L E R+DLV  W++Q R+  ++   D +  Y +    NK  CL LA  IY                             S  G +  +IL C  K G+   V++ +            + K + TDDLL L+   P+ EL++ L       +  +SF LA+  L   +   +  +L+       G  +  E L+ +  S  +T+ W+E+ N  +++
Sbjct:   53 YRNVFDKVIEHVTAYKSILTSIKKEYDAFIETIKKGRRTAFCLHGKLKGLAAEPTALVYHRKRTIQLEAKMRIIENNSS-------KIQSQIDQIKQSRAAYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALTKYMKHLEDKYAEIKQAMLIKYVPAQRKSDLDEEMIVLLKRRD-----VAENLNRKL---------QFCHQRLQIISQALTSWVKSDMSSPFQDFVEQIQKTKYLQGDQGIVEELMEDDPHRA------KEAEIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFRCPVDAALTLEGIKCGLSEKRLDLVINWVTQQRLTFSEEAGDVICDYGEQDTYNKAKCLALAQIIY-----------------------------SECGLHKKAIL-CLCKQGQTHRVMEYI-----------QQFKDFTTDDLLQLLMSCPQIELIQCLTKELNEKQTSLSFGLAILHLFSIDKKKIGIKLL--QEINKGGIDAVESLMIN-DSFCSTERWQEVANICSQN 549          
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Match: sp|Q10161|CLH_SCHPO (Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chc1 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 5.533e-6
Identity = 29/108 (26.85%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  946 LSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL-GNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSY 1266
            L +++F++L  +G Y +A  +A   PRG+LR    + +FK +   P  +    Q   + L    L+EH + E     L + R+ L++ W  + ++A T+ + D +  Y
Sbjct:  361 LYMQQFQQLMAQGNYSEAAKVAASSPRGILRTSQVIDQFKLIQAAPGQIAPILQYFGTLLDKGPLNEHETIELARPVLAQNRIQLLEKWYGENKLACTEALGDLVKPY 468          
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Match: A0A1S3HE44 (clathrin heavy chain linker domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106153785 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.021e-40
Identity = 112/406 (27.59%), Postives = 209/406 (51.48%), Query Frame = 1
Query:  142 RFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSN---SHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNS---RQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL----GNPQILLYYCQQLVSTL--KNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIY 1323
            R+  HKAAFD ++  V  Y+PLL  +K EYE  I  +++ ++    +  +++  AS P+T  N+ +  +EL  +L  +++ N   + +L+ +R+ +++ D   +++  ++     K+ ++++ +R+P +     TD+  +     +++ Q ++L+  Q TKY  K+ +  L  QL ++++R D+L         K+  L+ AL  A  +     +H+ VG+A++ AL  +           GD  +   + +  P  S      +  KE++ ++  I KF  LF EG Y++A   A   P+G+LR   TL +FK+L    G    LL +C  L+S++     R  E +S ECV CAL+E R DL+  W++Q R+  T+ +   +T      + N    L LA S++
Sbjct:   97 RYTVHKAAFDRVIEHVTAYKPLLTAVKAEYEECIDTILRGKREAAFLSGKLRAMASEPSTRRNYRKRADELEHRLSIVKEDNERLAKQLQNLREARLERDKQERVMTNQTP----KNAVKKERQRVPGLTTEQATDIKYLSKELAKLEQQAKELEIAQKTKYTGKETKESLREQLSDKVSRRDELEQRGIMLKAKRQRLRTALDAAQHYLKFQPLHQTVGDAVMVALAQN----------KGDRGVSHTLVRDTPSTSFDDDDPTREKEAEMMLEYIEKFNELFEEGSYEEAAIHAANSPKGILRTLETLNRFKDLKTKVGGRSPLLAFCDALMSSVLAMGVRPSETISLECVRCALEENRFDLLSHWVTQERLTVTEELGSLITEQCSGKSKNH---LALAESVF 485          
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Match: V4CKN2 (TSNAXIP1_N domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_93131 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.171e-39
Identity = 118/409 (28.85%), Postives = 214/409 (52.32%), Query Frame = 1
Query:  142 RFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSH------RLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKF----KELGNPQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDL 1332
            ++  +KA F++++  V  Y+P+L  IK+EYE+ I  +I  QK    +Q ++K  AS P+TI N+ +  ++L E+++ ++++N +       L+++R  + K D   K I K+        ++++D+R LP ++L + TD   +     ++D Q ++L  +  T+Y+PK  + +L   L ++++  D L    K+F  K   L+ AL+ ++ +      H+ VG+A+           E   + SG+ S + E D    D +++    KE++ ++  I KF  LF +GK+++A   A   P+G+LR  ATL KF    K  G    LL +C  L+S++K    +    LS +CV CAL E ++DL+  WI+Q  ++ +  I   L  +       +  C  LA SI+  L
Sbjct:   39 KYLIYKAVFNKVIEHVTAYKPILTSIKKEYESTIDAIINGQKEAVFLQGKLKAMASTPSTIRNYRKRSDQLEERINFIKRNNKNLATELEELQRVRKERTKKDHEIKEIPKK--------QLKKDIRMLPGVSLEEQTDPRYLNKTLVKLDRQLRELNNSFKTRYLPKKNKDELKEYLYKKVSFRDHLLAQSKDFKTKSHRLKIALEASEAYNRAKPPHQTVGDALSS---------EGDNSNSGETSTQFEED----DPNKE----KEAEMMLEYIEKFNELFEDGKFEEAAVHAANSPKGILRTQATLAKFRVKLKYNGGRTPLLAFCDALMSSVKVCGNKPSIGLSIDCVQCALNENKLDLLSHWIAQDSLSLSRDIGVLLEDHCSCKIPCQCGCQALAQSIFTSL 422          
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Match: K1Q6I7 (Uncharacterized protein C2orf63-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10019583 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 4.789e-39
Identity = 119/437 (27.23%), Postives = 217/437 (49.66%), Query Frame = 1
Query:  142 RFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSL---------KESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKE-----------------------------LGNPQILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDL 1332
            R+  ++ AF++I+  V  Y+PLL  IK+EYE  I  + K Q+  + +  ++K  AS P+TI N+++  +EL E++  + K N    ++++D++ K     +L  + ++P   K ++++D R +P ++L + TDL  +      +D Q + L  +  T+YVPK ++    N+L  ++N  DQL      +  K++ L+ A++ A  +      H+ VG+A+  A+  ++ +  Q    +G    + E +K     S   ++          KE++ ++  I KF  LF +GKY++A   A   P+G+LR  ATL KF++                             L +   LL +C  +++++     +    LS ECV+CAL E R+DL+  WISQ R+  +  I D ++ +       K  C  LA ++Y  L
Sbjct:   73 RYIIYRNAFNKIIEYVTAYKPLLTAIKKEYEFTIDSIRKGQREADYLNGKLKAMASEPSTIRNYKKRADELEERISIIEKDNDKLQQQLQDLRSKRQRREELEREVAEP--PKRELKKDRRLIPGLSLEEATDLNLLYKNLDILDRQLKDLNISFRTRYVPKSQKVDFKNKLDTKVNTRDQLLRQGLIYRAKRYRLKIAVEAAQAYNRFKPPHQTVGDAVTFAIAQATGLQVQEKDAAGQEQNQGEGEKRDGSPSAVATTSFEDDDPNKEKEAEMMLEYIEKFNELFEDGKYEEAAIHAANSPKGILRTSATLAKFRDNNGLFMRKSYVNVLPVLLFSAENEDVKVRLSHRSPLLAFCDAIMASVGAVGCKPAGELSTECVECALNENRLDLLSHWISQDRLMLSRQIGDLISGHCGCKVPCKCGCQALAQNVYTKL 507          
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Match: A0A433SRM1 (TSNAXIP1_N domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_020324 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.708e-38
Identity = 105/404 (25.99%), Postives = 212/404 (52.48%), Query Frame = 1
Query:  142 RFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREG---KSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNP-----QILLYYCQQLVSTLK--NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIY 1323
            R+  +KA F+++++ V+ Y+P+L  IK+EYE+ I  + K Q+    +Q ++K  AS P+T+ N+++  +EL E+++ +RK N     ++ ++Q    AI K  ++E +P+     K ++++D R +P + L + TD+  +Q     +D Q +++  +   +++PK  + +L   L E++   D+L    + +  +   L+ AL+ A  +      H+ VG+A++ A   +S  +      +     E     F  D+  +    KE++ ++  I +F  LF +G ++ A   A   P+G+LR  ATL KF+++ +P       LL +C  L+S++K    + +E LS +C+  +L E R++L   W+SQ R+  +  +   +  +       +  C  LA +++
Sbjct:   53 RYMVYKAVFNKVIDHVRAYKPILTSIKKEYEDTIETIKKGQREANFLQGKLKAMASEPSTLRNYKKRADELEERVNLVRKENDSLQSELEEIQ----AIRK--DRERRPKTAETPKRQLKKDSRLIPGLTLEETTDMKILQKKFDTLDRQLKEVNISLKARFLPKSHKLQLKETLDEKVAYRDKLLWQSQVYKTRGQKLKIALEAAQAYNQMKPPHQTVGDAVIIAFHQASGTLRAEMEKADGEQSEATHASFEDDDPNK---EKEAEMMLEYIERFNELFEDGHFEQAAVHAANSPKGILRTQATLAKFRDVKSPVGSGRSPLLAFCDALMSSVKAAGNKPNEALSMDCMGASLGENRLELAYHWLSQDRLTLSHGLGRMIAEHCSCPVPCRCGCQALAQAVF 447          
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Match: R7ULM9 (TSNAXIP1_N domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225981 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 5.329e-37
Identity = 141/547 (25.78%), Postives = 257/547 (46.98%), Query Frame = 1
Query:  142 RFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRR----LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSS-KIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNP-------QILLYYCQQLVSTLKNQRL--DEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLM---NGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSL----IAKNLISFPLAMKSLLESESFGVAAQLM--IHSSATIG 1713
            RF  ++ AFD+I++ V  Y+PLL  IK EYE  I  +++ Q     +  ++K  A  P+T+ N+ R   +L+ K+  +   N  +L+  R+++   DA    + +E + RE   K +++++R    +P + L   TD+ T+  +  +++ Q + L  +  T++  K+ + ++   L +++   D L  + +    K+  L+ A++ A  +      H+ +G+A++ AL  SS      R+A   D             +    +  KE++ ++  I KF  L  E KY+ A   A   P+G+LR   TL +FKEL  P         LL +C  L+ST+    +   E+LS EC+ CALKE R+DL+  WISQ R A          SY  +    +     L T+    LM     + +      S L+  ++I   ++ ++  +   ++ C ++ GRI + ID              + K  + +D L +++  P  +L  +L    + + L+   +   +LL S++ GVA  L+  IH     G
Sbjct:   49 RFTVYRVAFDQIIDYVTAYKPLLTAIKAEYEECIETIVRGQTEAFYLSGKLKSMAHEPSTLHNYRRRGEDLQTKMSIIDADND-KLK--REIKQLADA---RVERERKARESVEKPQKEIKREKKPIPGLTLQQSTDIKTLTRMAEKVERQLKDLTLSHKTRFTLKEIKDQMKESLAQKVTDRDDLTEETEVLKVKRHKLKVAVEAAQAYLRIQPPHQTIGDAVIMALAQSSYSGAHDRSAGPEDFG--RGTPSTTTFDDDDPTREKEAEMMLEYIEKFNELMEEEKYESAAIHAANSPKGILRTPETLARFKELKTPLGTRSGRSPLLAFCDALMSTVLAYGVLPSEYLSMECIACALKEHRMDLLSHWISQDRFAR--------LSYTLISFSIRFKFCSLTTNEDLGLMIYNYSVKRAGHELKSGLALAQKI---FMDTQSVHL--VMMCMVRQGRISQGIDY------------GKSKGAEMEDYLQVLKECPTPQLAHALYTLSLGETLVPLGVITTTLLSSKAKGVALHLIEEIHKRNASG 562          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000020842.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:11432198:11440165:1 gene:ENSAMXG00000020193.2 transcript:ENSAMXT00000020842.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 6.443e-9
Identity = 45/148 (30.41%), Postives = 78/148 (52.70%), Query Frame = 1
Query:  916 SSLKESDYIVLS----IRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGN-----PQILLYYCQQLVSTLKNQRL-DEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIP--CLELATSIY 1323
            +SL + D ++L      R+F  LFN G+Y+ A   A   P GVLRN  T+ +FK +       P +LL++   ++S    +++  E +S E V CAL+   + L    ++Q R++ ++ + D + ++ D   D +I   CL LA  I+
Sbjct:  166 TSLNQRDALILENNRLQRRFSDLFNSGEYEAAAYHAAKSPHGVLRNMETMMRFKSVSVYERQLPPVLLFFQALMLSAQPGKQVPGERMSLEGVRCALQYNYIQLATFGVTQQRLSYSEELGDMICNHGD--KDPRIADTCLALAQIIF 311          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002753.1 (pep scaffold:Pmarinus_7.0:GL476453:156967:177750:-1 gene:ENSPMAG00000002509.1 transcript:ENSPMAT00000002753.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.214e-10
Identity = 78/373 (20.91%), Postives = 156/373 (41.82%), Query Frame = 1
Query:  196 YQPLLKDIKQEYENLIFHVIKA-QKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDL-----SIED----EIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL----GNPQILLYYCQQLVSTLKNQRL--DEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSY 1266
            Y+ +L     EYE L F V++A  +    +Q  ++  A  P  +  + R   EL+E++  + ++N+ +LE    +  +    + ++++   P    +     L+ +  ++L + TD   +     Q+  +  +L      ++VP      L  QL ++++   QL    +N   ++ LL   +++           +N+   I+       K  +  T +S  +      ++D    E++        ++    E   ++  I +F  L  +G Y+ A   A   P G+LR   T   F  L    G P  LL + Q L+ +    R   D   S E   C+L+E R+DL+  W++  R +   +I ++   Y
Sbjct:    8 YREVLMATMSEYEAL-FEVLRAGHQEAHSLQSTVRARAGQPVALAYYRRRSAELQERIALIEENNA-KLEA--QLHHRKSPTTSVLDQPI-PDAADTHAMPPLKPIHGLSLHEATDPEFLTERLHQLRAREAELCVANRERFVPVQLLRDLRQQLQQEMSTRSQLL--AENISSRRRLL---IRK-----------DNITVDIINKWGQLRKFSDLLTNVSTTIIHCNHGVDDLEQAEMEMVGGSGDDELGKGSEGAQVISYIDRFNELLQDGHYEQAAQHAASSPHGILRKEHTAHCFSTLHRQHGEPLPLLLWFQTLIGSATATRCLPDARTSLEATCCSLQEHRLDLLMHWVTHCRYSPVTIIHNHNNMY 359          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Nematostella
Match: EDO43489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYM9])

HSP 1 Score: 107.842 bits (268), Expect = 2.105e-24
Identity = 103/408 (25.25%), Postives = 186/408 (45.59%), Query Frame = 1
Query:  145 FQAHKAAFDEIM-NLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRR-LPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQV-EYHIHEN----VGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNP---QILLYYCQQLVSTLK-NQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADN-KIPCLELATSIYWDL 1332
            +  +K AFD+++ +   +Y+P+L ++K EYE+ I  + K Q  +  +Q  +K      +T+    R  +EL EK+  L   N +   KI+D++ +     +   K S   +    + +D R  +P M+L +LTDL T++   +++  Q  + +    TK V K ++  L  +L                          A K+  L  V E H        V + ++KAL    KI +  TA        +++ +    +       KE++ ++     F  LF+ G+++ A   A   P G+LRNY TL +FK++  P     LL YC+ L++T    Q + + +S E V CAL+   +D    W++QG ++ +  + D +  +           CL+LA +IY  +
Sbjct:   40 YTVYKHAFDQLVEDKTAIYKPILSNLKGEYEDCIEALEKGQSQSVYLQGMVKALLVEKSTLRQFIRRGDELEEKIQYLITHNQNLASKIQDLRDR-----RAERKASLESKSMQSLDKDTRMVIPGMSLEELTDLPTLRKTLQRLQIQASETEEACKTKLVVKSQKGVLKEKL--------------------------AAKEVALHHVTEQHNKTKKRCEVLKVVMKALKDYGKIEDSTTA--------EQLHQLVNFDEDDPIKKKEAERLIEYCDHFNSLFDFGQFEAAAIHAANSPYGILRNYETLIRFKQVNAPVDENPLLMYCEALMATSSAAQPVSQAMSVEVVRCALEANHLDFATHWLAQGSLSYSIPLGDIIKKHCKCSGGRCTCTCLQLAQTIYMKI 408          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Nematostella
Match: EDO44618 (Clathrin heavy chain [Source:UniProtKB/TrEMBL;Acc:A7RVC0])

HSP 1 Score: 49.6766 bits (117), Expect = 5.526e-6
Identity = 31/106 (29.25%), Postives = 56/106 (52.83%), Query Frame = 1
Query:  946 LSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL----GNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIAD 1251
            L +RKF  LFN  +Y +A  +A   P+GVLR   T+ +F+++    G    LL Y   L   L   +L++  S E     L++G+  L++ W+ + ++  ++ + D
Sbjct:  363 LFVRKFNTLFNNMQYSEAAKVAANAPKGVLRTPQTIQRFQQVPAQPGQTSPLLQYFGIL---LDQGKLNKFESLELCKPVLQQGKKQLLEKWLKEEKLECSEELGD 465          
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036334.1 (clathrin heavy chain linker domain containing 1 [Source:NCBI gene;Acc:101169135])

HSP 1 Score: 76.6406 bits (187), Expect = 2.506e-14
Identity = 75/241 (31.12%), Postives = 116/241 (48.13%), Query Frame = 1
Query:  619 VPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKF-FPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKEL-----GNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIY 1323
            VP + +T+L  +L E   R D+LR D    +Q + LL   LK A   +++    E     + + LVS+ K      +IS DL  E E D        ++    +  DY++    +F +LF+ G+YKDA   A   P G+LRN   +  F  L       P  LL++   LV+     R+   LS + V CAL+ GR+ LV   ++Q +++ T+ + D L+ +A         CL LAT IY
Sbjct:  175 VPLEVQTRLEAELQEAQRRRDRLRAD---NVQLR-LLHKRLKFAS-DRLKCWTDEGQVVPLEELLVSTMK------SISSDLLHEAEDDACSIATELQEDKEQRVDDYLL----RFLQLFDSGQYKDAALHAARSPGGILRNLDVMEMFAGLRAPTDAAPPPLLFFQALLVTAAAGHRMSSPLSLQGVRCALQHGRLQLVVHAVTQNKVSFTEGLGDLLSGHAQKDQGKVDLCLALATLIY 400          
BLAST of TSNAXIP1_N domain-containing protein vs. Planmine SMEST
Match: SMESG000025884.1 (SMESG000025884.1)

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 617/617 (100.00%), Postives = 617/617 (100.00%), Query Frame = 1
Query:   52 MVSLYQNEIXXXXXXXXXXXXXXXXXDIHGRFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNLISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNESDEKFIIEMAASYLVQISIEKSFMALQDYGIAE 1902
            MVSLYQNEIKKIEFNLNKELNLIEKNDIHGRFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNLISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNESDEKFIIEMAASYLVQISIEKSFMALQDYGIAE
Sbjct:    1 MVSLYQNEIKKIEFNLNKELNLIEKNDIHGRFQAHKAAFDEIMNLVKVYQPLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNELREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDLRRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTNQLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAIVKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLSIRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNPQILLYYCQQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIADNLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINPRWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTDDLLLLIQFYPKFELVKSLIAKNLISFPLAMKSLLESESFGVAAQLMIHSSATIGIAEMTEQLIASISSGIATDVWEELLNFVNESDEKFIIEMAASYLVQISIEKSFMALQDYGIAE 617          
The following BLAST results are available for this feature:
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CLHC13.591e-2723.33clathrin heavy chain linker domain containing 1 [S... [more]
CLHC13.591e-2723.33clathrin heavy chain linker domain containing 1 [S... [more]
CLHC19.010e-2123.45clathrin heavy chain linker domain containing 1 [S... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chc-12.703e-628.30Probable clathrin heavy chain 1 [Source:UniProtKB... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clhc13.238e-1925.18clathrin heavy chain linker domain containing 1 [S... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Clhc14.737e-2922.95clathrin heavy chain linker domain containing 1 [S... [more]
Clhc13.301e-2722.97clathrin heavy chain linker domain containing 1 [S... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XIR8|CLHC1_RAT3.877e-2721.57Clathrin heavy chain linker domain-containing prot... [more]
sp|Q8NHS4|CLHC1_HUMAN1.725e-2623.33Clathrin heavy chain linker domain-containing prot... [more]
sp|Q5M6W3|CLHC1_MOUSE2.309e-2622.97Clathrin heavy chain linker domain-containing prot... [more]
sp|Q4R6I5|CLHC1_MACFA4.821e-2622.89Clathrin heavy chain linker domain-containing prot... [more]
sp|Q10161|CLH_SCHPO5.533e-626.85Probable clathrin heavy chain OS=Schizosaccharomyc... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HE441.021e-4027.59clathrin heavy chain linker domain-containing prot... [more]
V4CKN22.171e-3928.85TSNAXIP1_N domain-containing protein (Fragment) OS... [more]
K1Q6I74.789e-3927.23Uncharacterized protein C2orf63-like protein OS=Cr... [more]
A0A433SRM11.708e-3825.99TSNAXIP1_N domain-containing protein OS=Elysia chl... [more]
R7ULM95.329e-3725.78TSNAXIP1_N domain-containing protein OS=Capitella ... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000020842.26.443e-930.41pep primary_assembly:Astyanax_mexicanus-2.0:21:114... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002753.11.214e-1020.91pep scaffold:Pmarinus_7.0:GL476453:156967:177750:-... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434892.105e-2425.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446185.526e-629.25Clathrin heavy chain [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000036334.12.506e-1431.12clathrin heavy chain linker domain containing 1 [S... [more]
back to top
BLAST of TSNAXIP1_N domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025884.10.000e+0100.00SMESG000025884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032616 ID=SMED30032616|Name=TSNAXIP1_N domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2262bp
TTCTAATTGAAAGTTTAAGTATTTTTCATTAAACAAATAATTTTTTGAAT
TATGGTTTCATTATATCAAAATGAAATTAAAAAAATTGAATTTAACCTAA
ATAAAGAATTAAACTTAATTGAGAAAAACGATATTCATGGACGATTCCAA
GCTCACAAAGCAGCATTTGACGAAATTATGAATTTGGTAAAAGTCTACCA
ACCTTTACTAAAAGATATTAAACAAGAATATGAAAATCTAATTTTTCATG
TGATAAAAGCTCAAAAGTACACCGAAAAAATGCAAGATGAAATTAAGATA
GCGGCTTCCTATCCAACAACAATAGAAAATCATGAACGTTACTGTAATGA
ATTGAGAGAAAAACTTCACCAATTGCGAAAATCCAATAGTCATCGTTTGG
AAAAGATTCGAGATGTACAAATGAAATGCGATGCCATATCGAAATTAATT
AATAAAGAATCCCAACCGAGGGAGGGTAAATCAAAAATCCGCCGTGACCT
TCGTCGACTGCCCAACATGAATTTGACGGATTTGACTGATTTAGCCACAA
TGCAAAATCTCTGCCGACAAATAGACGATCAATATCAACAACTGAAGCGA
ACACAAAGCACGAAATATGTTCCAAAGGATGAAGAGACAAAGTTAACAAA
TCAATTACTGGAACAAATCAATCGTCACGATCAGTTAAGAATCGACGTGA
AGAACTTTATTCAGAAAAAATTCCTTTTACAAGCTGCACTGAAGCAGGCC
GACTTGTTCCAAGTTGAATATCATATTCACGAGAATGTTGGTGAAGCTAT
AGTCAAAGCGCTTGTCAGCAGCTCCAAAATCATAGAACAACGAACCGCTA
TTTCTGGGGACTTGTCAATAGAGGATGAAATAGATAAATTTTTCCCAGAT
AATTCGCGCCAGATTAGCTCATTGAAAGAATCGGATTATATTGTTTTAAG
TATTCGCAAATTTGAACGCTTATTTAATGAAGGCAAGTACAAAGACGCTG
TCGATTTGGCGATTGTGGTACCAAGAGGGGTACTTCGGAACTATGCAACG
TTATGTAAATTTAAAGAATTAGGAAACCCTCAAATCCTGCTTTATTATTG
TCAGCAGTTGGTGAGTACGTTGAAAAATCAAAGATTAGATGAACATTTAA
GCTTTGAATGCGTCGATTGTGCTTTGAAAGAAGGCCGAGTTGATTTGGTA
AAGGTTTGGATTTCGCAAGGCAGAATCGCGTCAACTGATTTGATTGCTGA
CAACCTGACAAGCTATGCAGATTTAATGGCAGATAATAAGATTCCTTGTC
TGGAGTTAGCGACATCAATCTATTGGGATCTAATGAACGGCCTGGCCCAG
CAGCCGGAATCAGACAGTTCCCAACTATCTTCTCCCCGTCAGATAAATCC
TCGATGGGTTTCGTCTCGCGGTAGATATTTTGACAGCATCCTAGAATGCC
AAATTAAATCCGGCCGGATTGAAGAAGTCATCGACATGCTGACCAATGAA
AATTCGACTCCGCTATCGTCAAGGTCGCGGAAAAAAATGTATAAAACCGA
CGATTTGTTATTGTTAATTCAGTTCTATCCGAAATTTGAGCTCGTGAAAA
GTTTAATTGCAAAAAATCTCATTTCATTTCCATTAGCCATGAAGTCATTG
TTAGAGTCGGAATCTTTTGGAGTGGCGGCACAGCTCATGATTCACAGTTC
AGCGACGATCGGTATTGCTGAAATGACAGAACAATTAATTGCCTCCATCT
CTTCGGGAATCGCCACTGATGTTTGGGAGGAATTGTTAAACTTTGTCAAT
GAATCAGACGAGAAATTTATTATCGAAATGGCGGCTTCCTATTTAGTACA
AATATCTATTGAGAAATCATTCATGGCATTACAAGACTATGGGATAGCAG
AATAATAATATCAAGATTTCACAATTTATATTTTAGATATTTCTTAACAA
GTTTGTACCCTTTTTCACCTCGAAGGTCATTGCAACCCTTGATGGATTGT
AATCAATCTCCTGTGAGAGAACTGACATCAAGGAGAGGTATTGGAAATTT
CCAAACGTATAATCCAAATTTAAAATGTGTTAAGCTTGCTTGAATTTCAT
TGTAATTCCTCTGAAGTCTCGCTTTTAAATACTTGGATTTCCAAACTGAG
TTTGCATATTTCCTATTTTGTTTATTTACAAAACGTGTTCCATCACAATA
GAATCCTACAATTGTTTATCGATGTAAAATAACTATAGATGAAGAATGAT
GTACAAAAATAC
back to top

protein sequence of SMED30032616-orf-1

>SMED30032616-orf-1 ID=SMED30032616-orf-1|Name=SMED30032616-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=618bp
MVSLYQNEIKKIEFNLNKELNLIEKNDIHGRFQAHKAAFDEIMNLVKVYQ
PLLKDIKQEYENLIFHVIKAQKYTEKMQDEIKIAASYPTTIENHERYCNE
LREKLHQLRKSNSHRLEKIRDVQMKCDAISKLINKESQPREGKSKIRRDL
RRLPNMNLTDLTDLATMQNLCRQIDDQYQQLKRTQSTKYVPKDEETKLTN
QLLEQINRHDQLRIDVKNFIQKKFLLQAALKQADLFQVEYHIHENVGEAI
VKALVSSSKIIEQRTAISGDLSIEDEIDKFFPDNSRQISSLKESDYIVLS
IRKFERLFNEGKYKDAVDLAIVVPRGVLRNYATLCKFKELGNPQILLYYC
QQLVSTLKNQRLDEHLSFECVDCALKEGRVDLVKVWISQGRIASTDLIAD
NLTSYADLMADNKIPCLELATSIYWDLMNGLAQQPESDSSQLSSPRQINP
RWVSSRGRYFDSILECQIKSGRIEEVIDMLTNENSTPLSSRSRKKMYKTD
DLLLLIQFYPKFELVKSLIAKNLISFPLAMKSLLESESFGVAAQLMIHSS
ATIGIAEMTEQLIASISSGIATDVWEELLNFVNESDEKFIIEMAASYLVQ
ISIEKSFMALQDYGIAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017212CLHC1
IPR032755TSNAXIP1_N
IPR012331Clathrin_H-chain_linker
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 164..187
NoneNo IPR availableCOILSCoilCoilcoord: 91..111
NoneNo IPR availablePFAMPF13838Clathrin_H_linkcoord: 299..349
e-value: 7.4E-10
score: 38.6
NoneNo IPR availablePANTHERPTHR10292CLATHRIN HEAVY CHAIN RELATEDcoord: 8..425
IPR032755Translin-associated factor X-interacting protein 1, N-terminalPFAMPF15739TSNAXIP1_Ncoord: 16..121
e-value: 2.7E-11
score: 43.8
IPR012331Clathrin, heavy chain, linkerGENE3DG3DSA:1.25.40.30coord: 286..424
e-value: 1.9E-22
score: 81.7
IPR017212Clathrin heavy chain linker domain-containing protein 1PANTHERPTHR10292:SF11CLATHRIN HEAVY CHAIN LINKER DOMAIN-CONTAINING PROTEIN 1coord: 8..425
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 299..410