HoxD-like protein

Overview
NameHoxD-like protein (ABW79873.1)
Smed IDSMED30032613
Length (bp)792
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HoxD-like protein (SMED30032613) t-SNE clustered cells

Violin plots show distribution of expression levels for HoxD-like protein (SMED30032613) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HoxD-like protein (SMED30032613) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HoxD-like protein (SMED30032613) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032613

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 35

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30032613SMESG000044469.1 SMESG000022667.1 SMED30032613smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 SMESG000022667.1 SMED30032613smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30032613SMESG000044469.1 SMESG000022667.1 SMED30032613smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30032613SMESG000044469.1 SmedASXL_008878SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 SmedASXL_008878SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30032613SMESG000044469.1 SmedASXL_008878SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cholinergic neuronSMED30032613SMESG000044469.1 SmedASXL_008878SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000022667.1 SmedASXL_066865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30032613SMESG000022667.1 SmedASXL_066865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30032613SMESG000044469.1 dd_Smed_v4_2442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032613SMESG000044469.1 Contig42541newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032613SMESG000044469.1 Contig42541uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30032613SMESG000044469.1 dd_Smed_v6_2442_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30032613SMESG000022667.1 dd_Smed_v6_13919_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30032613SMESG000044469.1 OX_Smed_1.0.12463ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
mouthSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30032613SMESG000044469.1 EU082824smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824smed_ncbi_20200123PMID:18287199
Iglesias et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30032613SMESG000044469.1 EU082824.1smed_ncbi_20200123PMID:20422023
Felix et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HoxD-like protein vs. Ensembl Human
Match: HOXB7 (homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118])

HSP 1 Score: 125.946 bits (315), Expect = 8.740e-35
Identity = 62/96 (64.58%), Postives = 73/96 (76.04%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQ 646
            NF  +PWM+ S T     DR    KR RQ Y+R QTLELEKEF+YN+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+   K  GPG+  Q
Sbjct:  123 NFRIYPWMRSSGT-----DR----KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTAGPGTTGQ 206          
BLAST of HoxD-like protein vs. Ensembl Human
Match: HOXC6 (homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128])

HSP 1 Score: 121.709 bits (304), Expect = 6.163e-34
Identity = 57/89 (64.04%), Postives = 69/89 (77.53%), Query Frame = 2
Query:  344 QKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHN 610
            Q  K +   +PWMQ+ N+        A+ +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N
Sbjct:   32 QDQKASIQIYPWMQRMNSHSG-VGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESN 119          
BLAST of HoxD-like protein vs. Ensembl Human
Match: HOXA4 (homeobox A4 [Source:HGNC Symbol;Acc:HGNC:5105])

HSP 1 Score: 120.168 bits (300), Expect = 1.515e-33
Identity = 55/83 (66.27%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  368 AFPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +    N S    E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQ+KIWFQNRRMKWKK+H +
Sbjct:   14 VYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKL 96          
BLAST of HoxD-like protein vs. Ensembl Human
Match: HOXC4 (homeobox C4 [Source:HGNC Symbol;Acc:HGNC:5126])

HSP 1 Score: 123.25 bits (308), Expect = 2.621e-33
Identity = 60/99 (60.61%), Postives = 74/99 (74.75%), Query Frame = 2
Query:  347 KPKPNFPA---------FPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            +P P+ P+         +PWM+K +    N +    E KRSR AY+RQQ LELEKEF+YN+YLTRRRRIEIA+S+CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  119 QPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRL 217          
BLAST of HoxD-like protein vs. Ensembl Human
Match: HOXC4 (homeobox C4 [Source:HGNC Symbol;Acc:HGNC:5126])

HSP 1 Score: 123.25 bits (308), Expect = 2.621e-33
Identity = 60/99 (60.61%), Postives = 74/99 (74.75%), Query Frame = 2
Query:  347 KPKPNFPA---------FPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            +P P+ P+         +PWM+K +    N +    E KRSR AY+RQQ LELEKEF+YN+YLTRRRRIEIA+S+CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  119 QPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRL 217          
BLAST of HoxD-like protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 109.383 bits (272), Expect = 3.995e-29
Identity = 65/137 (47.45%), Postives = 84/137 (61.31%), Query Frame = 2
Query:  254 LTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDK 664
              +NP  A  ++ NF +T  + P IS           P FPWM      K    +  E KR+RQ YSR QTLELEKEF+Y++YLTR+RR EI+ ++ L+ERQ+KIWFQNRRMK KKE   AK  G GS +  E S++
Sbjct:   77 FAYNPLQA--TSANFGETRTSMPAISQ----------PVFPWM------KMGGAKGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKE---AKGEG-GSNESDEESNQ 191          
BLAST of HoxD-like protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 99.3673 bits (246), Expect = 8.511e-25
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGP 631
             +PWM + ++    S      KR R AY+R Q LELEKEF+ ++YLTR+RRIE+A+S+ L+ERQ+KIWFQNRRMK KKE+    +T P
Sbjct:  148 VYPWMTRVHSTTGGSRGE---KRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPP 232          
BLAST of HoxD-like protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 99.3673 bits (246), Expect = 8.511e-25
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGP 631
             +PWM + ++    S      KR R AY+R Q LELEKEF+ ++YLTR+RRIE+A+S+ L+ERQ+KIWFQNRRMK KKE+    +T P
Sbjct:  148 VYPWMTRVHSTTGGSRGE---KRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPP 232          
BLAST of HoxD-like protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 77.411 bits (189), Expect = 1.633e-16
Identity = 34/62 (54.84%), Postives = 49/62 (79.03%), Query Frame = 2
Query:  419 SAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            S   ++ R+ Y++ QTLELEKEF YN Y+++++R E+A  + L+ERQ+KIWFQNRRMK KK+
Sbjct:  196 SHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQ 257          
BLAST of HoxD-like protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 77.411 bits (189), Expect = 1.633e-16
Identity = 34/62 (54.84%), Postives = 49/62 (79.03%), Query Frame = 2
Query:  419 SAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            S   ++ R+ Y++ QTLELEKEF YN Y+++++R E+A  + L+ERQ+KIWFQNRRMK KK+
Sbjct:  196 SHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQ 257          
BLAST of HoxD-like protein vs. Ensembl Fly
Match: Scr (gene:FBgn0003339 transcript:FBtr0081657)

HSP 1 Score: 124.79 bits (312), Expect = 6.584e-33
Identity = 57/99 (57.58%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  329 STENFQKPKPNFP-AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKL 622
            S++N    K N P  +PWM++ +   +  + + E KR R +Y+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKEH +A +
Sbjct:  290 SSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM 388          
BLAST of HoxD-like protein vs. Ensembl Fly
Match: Scr (gene:FBgn0003339 transcript:FBtr0081658)

HSP 1 Score: 124.79 bits (312), Expect = 6.584e-33
Identity = 57/99 (57.58%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  329 STENFQKPKPNFP-AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKL 622
            S++N    K N P  +PWM++ +   +  + + E KR R +Y+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKEH +A +
Sbjct:  290 SSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM 388          
BLAST of HoxD-like protein vs. Ensembl Fly
Match: Scr (gene:FBgn0003339 transcript:FBtr0474172)

HSP 1 Score: 124.79 bits (312), Expect = 8.126e-33
Identity = 57/99 (57.58%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  329 STENFQKPKPNFP-AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKL 622
            S++N    K N P  +PWM++ +   +  + + E KR R +Y+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKEH +A +
Sbjct:  290 SSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM 388          
BLAST of HoxD-like protein vs. Ensembl Fly
Match: Scr (gene:FBgn0003339 transcript:FBtr0474171)

HSP 1 Score: 124.405 bits (311), Expect = 2.346e-32
Identity = 57/99 (57.58%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  329 STENFQKPKPNFP-AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKL 622
            S++N    K N P  +PWM++ +   +  + + E KR R +Y+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKEH +A +
Sbjct:  290 SSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM 388          
BLAST of HoxD-like protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081653)

HSP 1 Score: 120.168 bits (300), Expect = 1.293e-31
Identity = 57/102 (55.88%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  365 PAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGS-CDQIEASDKP 667
            P +PWM      +++  +  E KR RQ Y+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+      G G   D+I   + P
Sbjct:  269 PLYPWM------RSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSP 364          
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 129.413 bits (324), Expect = 2.027e-36
Identity = 66/110 (60.00%), Postives = 79/110 (71.82%), Query Frame = 2
Query:  347 KPKPNFPAFPWMQKSNTRKN---KSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAK-LTGPGSCDQIEASDK 664
            +PK +   +PWMQ+ N+       SDR    +R RQ YSR QTLELEKEF+YN+YLTRRRRIEIAN++CLSERQIKIWFQNRRMKWKKE N+   L   GS    + +DK
Sbjct:   95 EPKGSVQIYPWMQRMNSHSGVGYGSDR----RRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDK 200          
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 129.413 bits (324), Expect = 3.251e-36
Identity = 66/110 (60.00%), Postives = 79/110 (71.82%), Query Frame = 2
Query:  347 KPKPNFPAFPWMQKSNTRKN---KSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAK-LTGPGSCDQIEASDK 664
            +PK +   +PWMQ+ N+       SDR    +R RQ YSR QTLELEKEF+YN+YLTRRRRIEIAN++CLSERQIKIWFQNRRMKWKKE N+   L   GS    + +DK
Sbjct:  110 EPKGSVQIYPWMQRMNSHSGVGYGSDR----RRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDK 215          
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 129.413 bits (324), Expect = 3.413e-36
Identity = 63/107 (58.88%), Postives = 80/107 (74.77%), Query Frame = 2
Query:  347 KPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAK-LTGPGSCDQIEASDK 664
            +PK +   +PWMQ+ N+  ++    ++ +R RQ YSR QTLELEKEF+YN+YLTRRRRIEIAN++CLSERQIKIWFQNRRMKWKKE N+   L   GS    + +DK
Sbjct:  110 EPKGSVQIYPWMQRMNS--HRVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDK 214          
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Match: hoxc6a (homeobox C6a [Source:NCBI gene;Acc:30346])

HSP 1 Score: 122.865 bits (307), Expect = 5.383e-34
Identity = 61/96 (63.54%), Postives = 73/96 (76.04%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKN---KSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGS 637
            N   +PWMQ+ N+       SDR    +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N+   T PG+
Sbjct:   97 NIQIYPWMQRMNSHSGVGYGSDR----RRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKETNLTS-TVPGT 187          
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Match: hoxb4a (homeobox B4a [Source:NCBI gene;Acc:30340])

HSP 1 Score: 122.479 bits (306), Expect = 2.618e-33
Identity = 55/83 (66.27%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSA-EYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +      + S  E KRSR AY+RQQ LELEKEF+YN+YLTRRRR+EIA+++CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  130 VYPWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKDHKL 212          
BLAST of HoxD-like protein vs. Ensembl Xenopus
Match: zdhhc15 (zinc finger DHHC-type containing 15 [Source:Xenbase;Acc:XB-GENE-948859])

HSP 1 Score: 130.183 bits (326), Expect = 2.331e-36
Identity = 65/118 (55.08%), Postives = 81/118 (68.64%), Query Frame = 2
Query:  317 SPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKL--TGPGSCDQIEASDK 664
            S + S  N Q+ K +   +PWMQ+ N+        A+ +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N+      G G+     A DK
Sbjct:  105 SSEQSRGNGQEQKGSIQIYPWMQRMNSHSGVG-YGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGTGAAADSLAGDK 221          
BLAST of HoxD-like protein vs. Ensembl Xenopus
Match: HOXD4 (homeobox D4 [Source:HGNC Symbol;Acc:HGNC:5138])

HSP 1 Score: 123.635 bits (309), Expect = 8.010e-34
Identity = 59/93 (63.44%), Postives = 71/93 (76.34%), Query Frame = 2
Query:  353 KPNFPAFPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTG 628
            KP    +PWM+K +    N +    E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+S+CLSERQIKIWFQNRRMKWKK+H +    G
Sbjct:  121 KPPAIVYPWMKKVHCNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHKLPNTKG 213          
BLAST of HoxD-like protein vs. Ensembl Xenopus
Match: ppm1j (protein phosphatase, Mg2+/Mn2+ dependent 1J [Source:Xenbase;Acc:XB-GENE-941439])

HSP 1 Score: 123.635 bits (309), Expect = 1.529e-33
Identity = 62/116 (53.45%), Postives = 81/116 (69.83%), Query Frame = 2
Query:  284 SNLNFAQTPNNSPQISTENFQKPKPNFPA-----FPWMQKSNTRKNKSDRS-AEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            ++L  + TP + P  S        P+ P      +PWM+K++  +  S  S  E KRSR AY+RQQ LELEKEF+YN+YLTRRRR+EIA+++ LSERQIKIWFQNRRMKWKK+H +
Sbjct:  116 AHLESSITPTSPPSCSLIASDHKHPDSPGQDPVVYPWMKKAHISRASSTYSDGEAKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLRLSERQIKIWFQNRRMKWKKDHKL 231          
BLAST of HoxD-like protein vs. Ensembl Xenopus
Match: psmb7.2 (proteasome subunit beta 7 [Source:Xenbase;Acc:XB-GENE-479691])

HSP 1 Score: 124.02 bits (310), Expect = 1.586e-33
Identity = 60/109 (55.05%), Postives = 81/109 (74.31%), Query Frame = 2
Query:  305 TPNNSPQISTENFQKPKPNFP--AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLT 625
             P +S Q S++N Q P P+     +PWM+K +   +      E KR+R AY+R QTLELEKEF++N+YLTRRRRIEIA+++CLSERQIKIWFQNRRMKWKK++ +  ++
Sbjct:  157 APASSDQASSQNSQSPAPSVQPQIYPWMRKLHISHDNIG-GPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMS 264          
BLAST of HoxD-like protein vs. Ensembl Xenopus
Match: ENSXETT00000028740.1 (homeobox A4 [Source:NCBI gene;Acc:101734089])

HSP 1 Score: 120.553 bits (301), Expect = 2.175e-32
Identity = 54/83 (65.06%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  368 AFPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +    N +    E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQ+KIWFQNRRMKWKK+H +
Sbjct:  136 VYPWMKKIHVNTVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKL 218          
BLAST of HoxD-like protein vs. Ensembl Mouse
Match: Hoxb7 (homeobox B7 [Source:MGI Symbol;Acc:MGI:96188])

HSP 1 Score: 122.865 bits (307), Expect = 8.097e-34
Identity = 61/96 (63.54%), Postives = 73/96 (76.04%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQ 646
            NF  +PWM     R +  DR    KR RQ Y+R QTLELEKEF+YN+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+   K +GPG+  Q
Sbjct:  123 NFRIYPWM-----RSSGPDR----KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTSGPGTTGQ 206          
BLAST of HoxD-like protein vs. Ensembl Mouse
Match: Hoxa4 (homeobox A4 [Source:MGI Symbol;Acc:MGI:96176])

HSP 1 Score: 124.79 bits (312), Expect = 8.611e-34
Identity = 55/82 (67.07%), Postives = 68/82 (82.93%), Query Frame = 2
Query:  371 FPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            +PWM+K +    N S    E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQ+KIWFQNRRMKWKK+H +
Sbjct:  160 YPWMKKIHVSAVNSSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKL 241          
BLAST of HoxD-like protein vs. Ensembl Mouse
Match: Hoxc4 (homeobox C4 [Source:MGI Symbol;Acc:MGI:96195])

HSP 1 Score: 123.635 bits (309), Expect = 1.519e-33
Identity = 60/99 (60.61%), Postives = 74/99 (74.75%), Query Frame = 2
Query:  347 KPKPNFPA---------FPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            +P P+ P+         +PWM+K +    N +    E KRSR AY+RQQ LELEKEF+YN+YLTRRRRIEIA+S+CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  119 QPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRL 217          
BLAST of HoxD-like protein vs. Ensembl Mouse
Match: Hoxc6 (homeobox C6 [Source:MGI Symbol;Acc:MGI:96197])

HSP 1 Score: 122.479 bits (306), Expect = 2.002e-33
Identity = 57/89 (64.04%), Postives = 69/89 (77.53%), Query Frame = 2
Query:  344 QKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHN 610
            Q  K +   +PWMQ+ N+        A+ +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N
Sbjct:  114 QDQKASIQIYPWMQRMNSHSGVG-YGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESN 201          
BLAST of HoxD-like protein vs. Ensembl Mouse
Match: Hoxd4 (homeobox D4 [Source:MGI Symbol;Acc:MGI:96208])

HSP 1 Score: 122.865 bits (307), Expect = 2.240e-33
Identity = 56/88 (63.64%), Postives = 69/88 (78.41%), Query Frame = 2
Query:  368 AFPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTG 628
             +PWM+K +    N +    E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQIKIWFQNRRMKWKK+H +    G
Sbjct:  131 VYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKG 218          
BLAST of HoxD-like protein vs. UniProt/SwissProt
Match: sp|O42504|HXC6A_TAKRU (Homeobox protein Hox-C6a OS=Takifugu rubripes OX=31033 GN=hoxc6a PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 5.487e-35
Identity = 60/96 (62.50%), Postives = 75/96 (78.12%), Query Frame = 2
Query:  344 QKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI-AKLTG 628
            Q+ K N P +PWMQ+ N+         + +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N+ + +TG
Sbjct:  113 QEQKSNIPIYPWMQRMNSHSGVG-YGTDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTVTG 207          
BLAST of HoxD-like protein vs. UniProt/SwissProt
Match: sp|Q9PWM5|HXC6B_DANRE (Homeobox protein Hox-C6b OS=Danio rerio OX=7955 GN=hoxc6b PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 5.925e-35
Identity = 63/107 (58.88%), Postives = 79/107 (73.83%), Query Frame = 2
Query:  347 KPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAK-LTGPGSCDQIEASDK 664
            +PK     +PWMQ+ N+  ++    ++ +R RQ YSR QTLELEKEF+YN+YLTRRRRIEIAN++CLSERQIKIWFQNRRMKWKKE N+   L   GS    + +DK
Sbjct:  110 EPKGVVQIYPWMQRMNS--HRVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDK 214          
BLAST of HoxD-like protein vs. UniProt/SwissProt
Match: sp|P18864|HXB7_RAT (Homeobox protein Hox-B7 OS=Rattus norvegicus OX=10116 GN=Hoxb7 PE=2 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 2.118e-34
Identity = 62/99 (62.63%), Postives = 75/99 (75.76%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEA 655
            NF  +PWM+ S T         E KR RQ Y+R QTLELEKEF+YN+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+   K +GPG+  Q +A
Sbjct:  123 NFRIYPWMRSSGT---------ERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN---KTSGPGTTGQDKA 209          
BLAST of HoxD-like protein vs. UniProt/SwissProt
Match: sp|Q9TT89|HXB7_BOVIN (Homeobox protein Hox-B7 OS=Bos taurus OX=9913 GN=HOXB7 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.652e-34
Identity = 62/96 (64.58%), Postives = 74/96 (77.08%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQ 646
            NF  +PWM+ S T     DR    KR RQ Y+R QTLELEKEF+YN+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+   K +GPG+  Q
Sbjct:  123 NFRIYPWMRSSGT-----DR----KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN---KTSGPGTTGQ 206          
BLAST of HoxD-like protein vs. UniProt/SwissProt
Match: sp|Q5YLH5|HXA6_CHICK (Homeobox protein Hox-A6 OS=Gallus gallus OX=9031 GN=HOXA6 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.117e-34
Identity = 68/138 (49.28%), Postives = 87/138 (63.04%), Query Frame = 2
Query:  251 YLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDK 664
            YL F+P+    SN           +I  +     K   P +PWMQ+ N+    +   A  +R RQ Y+R QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE+     T PGS +  E S +
Sbjct:  102 YLHFSPEQQYKSN-------GVQSKIVNDEGTDRKYTSPVYPWMQRMNSCAG-TVYGAHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKFINSTQPGSDETEEKSGE 231          
BLAST of HoxD-like protein vs. TrEMBL
Match: B1NTA5 (HoxD-like protein OS=Schmidtea mediterranea OX=79327 GN=hoxD PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 2.591e-114
Identity = 182/184 (98.91%), Postives = 184/184 (100.00%), Query Frame = 2
Query:   53 MLDKSSQNSFYHFNPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTNKXXXXXXXXXXXXXXXYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            MLDKSSQNSFYHFNPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTNKPPPGNGFSSPPSTSSYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMK+KK+
Sbjct:   22 MLDKSSQNSFYHFNPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTNKPPPGNGFSSPPSTSSYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 205          
BLAST of HoxD-like protein vs. TrEMBL
Match: D3J1K1 (HoxD (Fragment) OS=Schmidtea polychroa OX=50054 GN=hoxD PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.490e-70
Identity = 132/140 (94.29%), Postives = 133/140 (95.00%), Query Frame = 2
Query:  167 FPNSNPTSADTNKXXXXXXXXXXXXXXXYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRR 586
            FPNSNPT ADTNKPPPGNGFSSPPSTSSY TFNPDT IMSNLNFAQTPNNSPQIS+EN  KPK NFPAFPWMQKSNTRKNKSDRS EYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRR
Sbjct:    1 FPNSNPTLADTNKPPPGNGFSSPPSTSSYSTFNPDTTIMSNLNFAQTPNNSPQISSENPAKPKTNFPAFPWMQKSNTRKNKSDRSIEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRR 140          
BLAST of HoxD-like protein vs. TrEMBL
Match: Q9XY01 (PLOX4-Dj (Fragment) OS=Dugesia japonica OX=6161 GN=Plox4-Dj PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.340e-68
Identity = 120/177 (67.80%), Postives = 140/177 (79.10%), Query Frame = 2
Query:   80 FYHFNPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTNKXXXXXXXXXXXXXXXYLTFNPDTAIMSNLNFAQTPN--NSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            FY FN PD +Y MK+L++DYS+YSQ+QT FPN N   ++ NK       S P + S Y TFN D  +++N++F Q+ N  N P I T N  K KPNFPAFPWMQKSNTRKNK+D+S E+KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMK+KK+
Sbjct:    1 FYSFNLPDYQYTMKDLNIDYSIYSQLQT-FPNLNQLPSENNKINGNIFSSPPSTNS-YSTFNSDNGMLNNVSFNQSQNLENQP-IQTNNSSKNKPNFPAFPWMQKSNTRKNKTDKSIEFKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 174          
BLAST of HoxD-like protein vs. TrEMBL
Match: O76938 (Homeodomain protein OS=Girardia tigrina OX=6162 GN=DthoxD PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 8.285e-58
Identity = 112/188 (59.57%), Postives = 128/188 (68.09%), Query Frame = 2
Query:   53 MLDKSSQNSFYHF--NPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTNKXXXXXXXXXXXXXXXYLTFNPDTAIMSNLNFAQTPN--NSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            MLD SSQNSF ++     +C+Y +K+ +VDYS+ S  QT F N    S D+N        S           N D  I++N +  QT N  +    S     K KPNFPAFPWMQKSN RKNKSD+S EYKR RQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMK+KK+
Sbjct:    1 MLDTSSQNSFVNYCTTIQECQYTIKDFNVDYSIPSNHQT-FSNVTYIS-DSNVHGHVFSSSPST--------NSDCQIINNPSLIQTQNLDHDTLESNGGLSKSKPNFPAFPWMQKSNMRKNKSDKSVEYKRCRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 178          
BLAST of HoxD-like protein vs. TrEMBL
Match: Q9XY02 (PLOX5-Dj (Fragment) OS=Dugesia japonica OX=6161 GN=Plox5-Dj PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 8.721e-55
Identity = 86/101 (85.15%), Postives = 95/101 (94.06%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDKPTISRCSTISPEQEIEKCDNEPN 733
            KR+RQ Y+R QTLELEKEF++N+YLTRRRRIEIA+S+ L+ERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEAS+KPTISR STISPE EIEKCDNE N
Sbjct:  188 KRTRQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASEKPTISRSSTISPEHEIEKCDNEQN 288          
BLAST of HoxD-like protein vs. Ensembl Cavefish
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:103034651])

HSP 1 Score: 125.176 bits (313), Expect = 1.519e-34
Identity = 62/99 (62.63%), Postives = 75/99 (75.76%), Query Frame = 2
Query:  344 QKPKPNFPAFPWMQKSNTRKN---KSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI-AKLTG 628
            Q  K N   +PWMQ+ N+       SDR    +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N+ + +TG
Sbjct:  114 QDQKGNIQIYPWMQRMNSHSGVGYGSDR----RRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTVTG 208          
BLAST of HoxD-like protein vs. Ensembl Cavefish
Match: hoxd4a (homeobox D4 [Source:NCBI gene;Acc:103034735])

HSP 1 Score: 122.865 bits (307), Expect = 2.031e-33
Identity = 57/88 (64.77%), Postives = 69/88 (78.41%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSD-RSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTG 628
             +PWM+K +      D   AE KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQIKIWFQNRRMKWKK+H +    G
Sbjct:  145 VYPWMKKVHVNTVNPDYTGAEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKG 232          
BLAST of HoxD-like protein vs. Ensembl Cavefish
Match: hoxb4a (homeobox B4 [Source:NCBI gene;Acc:103046378])

HSP 1 Score: 122.094 bits (305), Expect = 2.301e-33
Identity = 55/83 (66.27%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSA-EYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +      + S  E KRSR AY+RQQ LELEKEF+YN+YLTRRRR+EIA+++CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  129 VYPWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKDHKL 211          
BLAST of HoxD-like protein vs. Ensembl Cavefish
Match: hoxb7a (homeobox B7 [Source:NCBI gene;Acc:103045369])

HSP 1 Score: 121.709 bits (304), Expect = 2.720e-33
Identity = 61/125 (48.80%), Postives = 84/125 (67.20%), Query Frame = 2
Query:  263 NPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGS 637
            +P  ++M  ++ ++T +   +      Q+ + N   +PWM     R   +DR    KR RQ YSR QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKKE+  A  + P +
Sbjct:  101 HPSLSVMCAIDPSKTTSCGKEEQRSCTQRNEDNLRIYPWM-----RSTGADR----KRGRQTYSRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTAHPSSPAA 216          
BLAST of HoxD-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000057181.1 (homeobox protein Hox-A4a [Source:NCBI gene;Acc:103023568])

HSP 1 Score: 120.939 bits (302), Expect = 8.178e-33
Identity = 61/121 (50.41%), Postives = 80/121 (66.12%), Query Frame = 2
Query:  308 PNNSPQISTENFQK-----------------PKPNFPA-FPWMQKSNTRKNKSDRSAEY-KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            PN+ P +STE+                    PK   P  +PWM+K +     ++ S    KRSR AY+RQQ LELEKEF++N+YLTRRRR+EIA+++CLSERQ+KIWFQNRRMKWKK+H +
Sbjct:   86 PNHGPHLSTESCAGTTASKDCSLATEALPTPPKGKEPVVYPWMKKVHVNTVTANYSGGVPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLSERQVKIWFQNRRMKWKKDHKL 206          
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 112.079 bits (279), Expect = 5.506e-32
Identity = 51/63 (80.95%), Postives = 59/63 (93.65%), Query Frame = 2
Query:  425 EYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+S+CLSERQIKIWFQNRRMKWKK+H +
Sbjct:    1 ESKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHKL 63          
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 105.145 bits (261), Expect = 1.335e-29
Identity = 48/58 (82.76%), Postives = 55/58 (94.83%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            KR RQ YSR QTLELEKEF++N+YLTRRRR+EIA+S+CL+ERQIKIWFQNRRMKWKKE
Sbjct:    5 KRGRQTYSRYQTLELEKEFHFNRYLTRRRRVEIAHSLCLTERQIKIWFQNRRMKWKKE 62          
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 1.214e-26
Identity = 48/81 (59.26%), Postives = 59/81 (72.84%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHN 610
             FPWM+     +         +R RQ YSR QTLELEKEF +N YLTR+RRIE+++ + LSERQ+KIWFQNRRMKWKKE+N
Sbjct:   16 VFPWMRPQGPAR---------RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKENN 87          
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 3.072e-24
Identity = 43/58 (74.14%), Postives = 55/58 (94.83%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            ++ R++YSR Q+LELEKEF++N+YL RRRR+EIA+S+CLSERQ+KIWFQNRRMKWKKE
Sbjct:    2 RKGRRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWFQNRRMKWKKE 59          
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.500e-19
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKK 601
            ++ R  YS+QQTLELEKEF +N YLTR RR E+A  + L+ERQ+KIWFQNRRMK KK
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKK 58          
BLAST of HoxD-like protein vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 45.4394 bits (106), Expect = 4.052e-6
Identity = 22/66 (33.33%), Postives = 39/66 (59.09%), Query Frame = 2
Query:  407 KSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            K D +   +R R+  S Q+   L+ EF      ++ +RIE+A S  ++E+ ++IWFQN+R   K++
Sbjct:  169 KIDNAPLARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQ 234          
BLAST of HoxD-like protein vs. Ensembl Nematostella
Match: ANTHOX7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S272])

HSP 1 Score: 88.5817 bits (218), Expect = 3.348e-21
Identity = 45/88 (51.14%), Postives = 62/88 (70.45%), Query Frame = 2
Query:  356 PNF---PAFPWM--QKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            PN+   P +PWM  +KS +R      +   KR R +Y+ +Q LELEKEF+YN+YL   RR E+AN++ L+ERQ+K+WFQNRRMK KK+
Sbjct:   73 PNYLLQPIYPWMRTKKSGSRGIGGKHT---KRYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWFQNRRMKLKKD 157          
BLAST of HoxD-like protein vs. Ensembl Nematostella
Match: EDO45896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW6])

HSP 1 Score: 82.8037 bits (203), Expect = 7.556e-21
Identity = 39/60 (65.00%), Postives = 51/60 (85.00%), Query Frame = 2
Query:  434 RSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            ++R  YS +Q +ELEKEF+YN+YL R RRIEIA S+ L+E+Q+KIWFQNRRMKWKKE+ +
Sbjct:    3 KNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQNRRMKWKKENKL 62          
BLAST of HoxD-like protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 83.1889 bits (204), Expect = 5.820e-20
Identity = 37/57 (64.91%), Postives = 47/57 (82.46%), Query Frame = 2
Query:  434 RSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            R R AY+R Q LELEKEF++ +YLT+ RR E+A  + L+ERQ+KIWFQNRRMKWKK+
Sbjct:   81 RKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRMKWKKD 137          
BLAST of HoxD-like protein vs. Ensembl Nematostella
Match: HOX2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS10])

HSP 1 Score: 82.8037 bits (203), Expect = 2.985e-19
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAK 619
            KR R AY+  Q LELEKEF  N+YL+R RRI+IA  + LSE+Q+KIWFQNRR+KWKK+   A+
Sbjct:  124 KRIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRVKWKKDKKAAQ 186          
BLAST of HoxD-like protein vs. Ensembl Nematostella
Match: EDO42187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S274])

HSP 1 Score: 78.1814 bits (191), Expect = 5.292e-19
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 2
Query:  431 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            KR R +Y+ +Q LELEKEF++N+YL   RR EI+ ++ L+ERQ+KIWFQNRRMKWKK+
Sbjct:    2 KRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWFQNRRMKWKKD 59          
BLAST of HoxD-like protein vs. Ensembl Medaka
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:101173938])

HSP 1 Score: 132.109 bits (331), Expect = 3.007e-37
Identity = 60/96 (62.50%), Postives = 75/96 (78.12%), Query Frame = 2
Query:  344 QKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI-AKLTG 628
            Q+ K N P +PWMQ+ N+         + +R RQ YSR QTLELEKEF++N+YLTRRRRIEIAN++CL+ERQIKIWFQNRRMKWKKE N+ + +TG
Sbjct:  113 QEQKSNIPIYPWMQRMNSHSAGVGYGTDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTVTG 208          
BLAST of HoxD-like protein vs. Ensembl Medaka
Match: hoxb4a (homeobox protein Hox-B4a [Source:NCBI gene;Acc:101170024])

HSP 1 Score: 123.635 bits (309), Expect = 8.483e-34
Identity = 56/83 (67.47%), Postives = 68/83 (81.93%), Query Frame = 2
Query:  368 AFPWMQKSNTR-KNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +    N S    E KRSR AY+RQQ LELEKEF+YN+YLTRRRR+EIA+++CLSERQIKIWFQNRRMKWKK+H +
Sbjct:  142 VYPWMKKVHVNIVNSSYTGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKDHKL 224          
BLAST of HoxD-like protein vs. Ensembl Medaka
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 122.865 bits (307), Expect = 2.039e-33
Identity = 57/88 (64.77%), Postives = 70/88 (79.55%), Query Frame = 2
Query:  368 AFPWMQKSN-TRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTG 628
             +PWM+K + T  N     +E KRSR AY+RQQ LELEKEF++N+YLTRRRRIEIA+++CLSERQIKIWFQNRRMKWKK+H +    G
Sbjct:  145 VYPWMKKVHVTTVNPDYTGSEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKG 232          
BLAST of HoxD-like protein vs. Ensembl Medaka
Match: ENSORLT00000021320.2 (homeobox protein Hox-B5a [Source:NCBI gene;Acc:101169786])

HSP 1 Score: 122.865 bits (307), Expect = 6.643e-33
Identity = 59/116 (50.86%), Postives = 81/116 (69.83%), Query Frame = 2
Query:  299 AQTPNNSPQISTENFQKPKPNFP-AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI--AKLTGPGS 637
            A+T    P  +        P+ P  FPWM+K +   + +    + KR+R AY+R QTLELEKEF++N+YLTRRRRIEIA+++CL+ERQIKIWFQNRRMKWKK++ +    +T PG+
Sbjct:  193 AKTQEGEPAGTAGGGTDSDPHTPQIFPWMRKLHISHDMT--GPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKDNKVKSMSITAPGA 306          
BLAST of HoxD-like protein vs. Ensembl Medaka
Match: ENSORLT00000006333.2 (homeobox protein Hox-A4 [Source:NCBI gene;Acc:101172830])

HSP 1 Score: 120.553 bits (301), Expect = 9.709e-33
Identity = 54/83 (65.06%), Postives = 67/83 (80.72%), Query Frame = 2
Query:  368 AFPWMQKSNTRK-NKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
             +PWM+K +    N S      KRSR AY+RQQ LELEKEF++N+YLTRRRR+EIA+++CLSERQ+KIWFQNRRMKWKKEH +
Sbjct:  128 VYPWMKKVHVSTVNASYNGGVPKRSRTAYTRQQALELEKEFHFNRYLTRRRRVEIAHTMCLSERQVKIWFQNRRMKWKKEHKL 210          
BLAST of HoxD-like protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 291.582 bits (745), Expect = 8.887e-101
Identity = 161/163 (98.77%), Postives = 163/163 (100.00%), Query Frame = 2
Query:  116 MKNLSVDYSLYSQIQTQFPNSNPTSADTNKXXXXXXXXXXXXXXXYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKE 604
            MKNLSVDYSLYSQIQTQFPNSNPTSADTNKPPPGNGFSSPPSTSSYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMK+KK+
Sbjct:    1 MKNLSVDYSLYSQIQTQFPNSNPTSADTNKPPPGNGFSSPPSTSSYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKPKPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 163          
BLAST of HoxD-like protein vs. Planmine SMEST
Match: SMESG000022667.1 (SMESG000022667.1)

HSP 1 Score: 200.29 bits (508), Expect = 1.692e-63
Identity = 95/125 (76.00%), Postives = 107/125 (85.60%), Query Frame = 2
Query:  359 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDKPTISRCSTISPEQEIEKCDNEPN 733
            N   + WM   +   N +  S+  KR+RQ Y+R QTLELEKEF++N+YLTRRRRIEIA+S+ L+ERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDKPTISRCSTISPEQEIEKCDNEPN
Sbjct:  142 NVMLYSWMNPKSGADNPN--SSNNKRTRQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIEASDKPTISRCSTISPEQEIEKCDNEPN 264          
BLAST of HoxD-like protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.061e-37
Identity = 62/95 (65.26%), Postives = 78/95 (82.11%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIE 652
             +PWM      K  S+ S+++KRSRQ Y+R QTLELEKEF++N+YLTRRRRIEIA+++ L+ERQIKIWFQNRRMKWKK+HNI KL GPG+ +Q E
Sbjct:  200 VYPWMNP----KMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYE 290          
BLAST of HoxD-like protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.093e-37
Identity = 62/95 (65.26%), Postives = 78/95 (82.11%), Query Frame = 2
Query:  368 AFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIE 652
             +PWM      K  S+ S+++KRSRQ Y+R QTLELEKEF++N+YLTRRRRIEIA+++ L+ERQIKIWFQNRRMKWKK+HNI KL GPG+ +Q E
Sbjct:  197 VYPWMNP----KMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYE 287          
BLAST of HoxD-like protein vs. Planmine SMEST
Match: SMESG000071019.1 (SMESG000071019.1)

HSP 1 Score: 105.916 bits (263), Expect = 1.861e-26
Identity = 46/64 (71.88%), Postives = 59/64 (92.19%), Query Frame = 2
Query:  422 AEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNI 613
            ++ KR+R AY+RQQ LELEKEF++N+YLTR+RRIEIA S+ LSERQ+KIWFQNRRMKWKK+H++
Sbjct:  223 SDSKRNRTAYTRQQILELEKEFHFNKYLTRKRRIEIAQSLQLSERQVKIWFQNRRMKWKKDHHL 286          
The following BLAST results are available for this feature:
BLAST of HoxD-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXB78.740e-3564.58homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118][more]
HOXC66.163e-3464.04homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128][more]
HOXA41.515e-3366.27homeobox A4 [Source:HGNC Symbol;Acc:HGNC:5105][more]
HOXC42.621e-3360.61homeobox C4 [Source:HGNC Symbol;Acc:HGNC:5126][more]
HOXC42.621e-3360.61homeobox C4 [Source:HGNC Symbol;Acc:HGNC:5126][more]
back to top
BLAST of HoxD-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab-53.995e-2947.45Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
lin-398.511e-2553.41Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-398.511e-2553.41Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
php-31.633e-1654.84Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-31.633e-1654.84Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scr6.584e-3357.58gene:FBgn0003339 transcript:FBtr0081657[more]
Scr6.584e-3357.58gene:FBgn0003339 transcript:FBtr0081658[more]
Scr8.126e-3357.58gene:FBgn0003339 transcript:FBtr0474172[more]
Scr2.346e-3257.58gene:FBgn0003339 transcript:FBtr0474171[more]
Antp1.293e-3155.88gene:FBgn0260642 transcript:FBtr0081653[more]
back to top
BLAST of HoxD-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc6b2.027e-3660.00homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxc6b3.251e-3660.00homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxc6b3.413e-3658.88homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxc6a5.383e-3463.54homeobox C6a [Source:NCBI gene;Acc:30346][more]
hoxb4a2.618e-3366.27homeobox B4a [Source:NCBI gene;Acc:30340][more]
back to top
BLAST of HoxD-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc152.331e-3655.08zinc finger DHHC-type containing 15 [Source:Xenbas... [more]
HOXD48.010e-3463.44homeobox D4 [Source:HGNC Symbol;Acc:HGNC:5138][more]
ppm1j1.529e-3353.45protein phosphatase, Mg2+/Mn2+ dependent 1J [Sourc... [more]
psmb7.21.586e-3355.05proteasome subunit beta 7 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000028740.12.175e-3265.06homeobox A4 [Source:NCBI gene;Acc:101734089][more]
back to top
BLAST of HoxD-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxb78.097e-3463.54homeobox B7 [Source:MGI Symbol;Acc:MGI:96188][more]
Hoxa48.611e-3467.07homeobox A4 [Source:MGI Symbol;Acc:MGI:96176][more]
Hoxc41.519e-3360.61homeobox C4 [Source:MGI Symbol;Acc:MGI:96195][more]
Hoxc62.002e-3364.04homeobox C6 [Source:MGI Symbol;Acc:MGI:96197][more]
Hoxd42.240e-3363.64homeobox D4 [Source:MGI Symbol;Acc:MGI:96208][more]
back to top
BLAST of HoxD-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O42504|HXC6A_TAKRU5.487e-3562.50Homeobox protein Hox-C6a OS=Takifugu rubripes OX=3... [more]
sp|Q9PWM5|HXC6B_DANRE5.925e-3558.88Homeobox protein Hox-C6b OS=Danio rerio OX=7955 GN... [more]
sp|P18864|HXB7_RAT2.118e-3462.63Homeobox protein Hox-B7 OS=Rattus norvegicus OX=10... [more]
sp|Q9TT89|HXB7_BOVIN2.652e-3464.58Homeobox protein Hox-B7 OS=Bos taurus OX=9913 GN=H... [more]
sp|Q5YLH5|HXA6_CHICK3.117e-3449.28Homeobox protein Hox-A6 OS=Gallus gallus OX=9031 G... [more]
back to top
BLAST of HoxD-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B1NTA52.591e-11498.91HoxD-like protein OS=Schmidtea mediterranea OX=793... [more]
D3J1K11.490e-7094.29HoxD (Fragment) OS=Schmidtea polychroa OX=50054 GN... [more]
Q9XY011.340e-6867.80PLOX4-Dj (Fragment) OS=Dugesia japonica OX=6161 GN... [more]
O769388.285e-5859.57Homeodomain protein OS=Girardia tigrina OX=6162 GN... [more]
Q9XY028.721e-5585.15PLOX5-Dj (Fragment) OS=Dugesia japonica OX=6161 GN... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc6a1.519e-3462.63homeobox C6 [Source:NCBI gene;Acc:103034651][more]
hoxd4a2.031e-3364.77homeobox D4 [Source:NCBI gene;Acc:103034735][more]
hoxb4a2.301e-3366.27homeobox B4 [Source:NCBI gene;Acc:103046378][more]
hoxb7a2.720e-3348.80homeobox B7 [Source:NCBI gene;Acc:103045369][more]
ENSAMXT00000057181.18.178e-3350.41homeobox protein Hox-A4a [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd4a5.506e-3280.95homeobox D4a [Source:NCBI gene;Acc:30329][more]
hoxb7a1.335e-2982.76homeobox B7a [Source:NCBI gene;Acc:58044][more]
ENSPMAT00000005057.11.214e-2659.26pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
ENSPMAT00000011116.13.072e-2474.14pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
ENSPMAT00000011242.11.500e-1966.67pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX14.052e-633.33Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ANTHOX73.348e-2151.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458967.556e-2165.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX1A.NV5.820e-2064.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX22.985e-1961.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421875.292e-1962.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HoxD-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc6a3.007e-3762.50homeobox C6 [Source:NCBI gene;Acc:101173938][more]
hoxb4a8.483e-3467.47homeobox protein Hox-B4a [Source:NCBI gene;Acc:101... [more]
hoxd4a2.039e-3364.77homeobox D4a [Source:NCBI gene;Acc:30329][more]
ENSORLT00000021320.26.643e-3350.86homeobox protein Hox-B5a [Source:NCBI gene;Acc:101... [more]
ENSORLT00000006333.29.709e-3365.06homeobox protein Hox-A4 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of HoxD-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044469.18.887e-10198.77SMESG000044469.1[more]
SMESG000022667.11.692e-6376.00SMESG000022667.1[more]
SMESG000079807.11.061e-3765.26SMESG000079807.1[more]
SMESG000079807.11.093e-3765.26SMESG000079807.1[more]
SMESG000071019.11.861e-2671.88SMESG000071019.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032613
GenBankABW79873.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032613 ID=SMED30032613|Name=HoxD-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=792bp
GTTGTAGATTTTTTTATTATTATTATTCAAATTTAGCTCACTGAGTTTGC
GTATGCTTGACAAGTCTTCCCAGAATTCCTTCTATCATTTCAATCCGCCC
GACTGTAGATATGTAATGAAAAATCTCAGTGTCGATTATTCTCTATATTC
ACAAATACAAACCCAGTTTCCGAATTCGAATCCAACATCGGCCGACACCA
ACAAACCGCCTCCCGGAAACGGTTTCAGCTCACCGCCTTCAACCAGCTCA
TATTTGACTTTCAATCCCGACACGGCAATTATGAGCAATTTAAATTTCGC
TCAAACTCCGAACAATTCGCCGCAGATTTCAACGGAAAATTTCCAAAAGC
CCAAACCGAATTTTCCCGCTTTTCCATGGATGCAGAAATCTAATACGAGA
AAAAACAAATCAGACAGATCAGCCGAATACAAACGAAGTCGGCAAGCGTA
TTCTCGCCAGCAGACTTTGGAATTGGAAAAAGAATTTTATTATAACCAGT
ACCTCACGCGTCGGAGACGTATTGAAATAGCCAACTCAGTTTGTTTGTCC
GAACGTCAGATAAAAATTTGGTTTCAGAACCGTCGGATGAAATGGAAAAA
AGAGCACAACATTGCCAAACTGACAGGCCCCGGTTCCTGTGATCAGATTG
AAGCCAGCGATAAGCCGACCATTTCCCGCTGCAGCACAATCAGTCCCGAA
CAGGAAATTGAGAAATGTGATAACGAACCCAATTGAATTCGACTTTGTAA
ATTTATTCCTAAAAGTAACCGAAATTTAGATCGAAATGTGAT
back to top

protein sequence of SMED30032613-orf-1

>SMED30032613-orf-1 ID=SMED30032613-orf-1|Name=SMED30032613-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
MLDKSSQNSFYHFNPPDCRYVMKNLSVDYSLYSQIQTQFPNSNPTSADTN
KPPPGNGFSSPPSTSSYLTFNPDTAIMSNLNFAQTPNNSPQISTENFQKP
KPNFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQY
LTRRRRIEIANSVCLSERQIKIWFQNRRMKWKKEHNIAKLTGPGSCDQIE
ASDKPTISRCSTISPEQEIEKCDNEPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000072mouth
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 173..178
score: 57.75
coord: 163..173
score: 55.78
coord: 148..159
score: 49.96
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 126..178
e-value: 1.4E-9
score: 47.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 127..178
e-value: 2.3E-17
score: 62.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 124..178
score: 19.273
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 127..178
e-value: 1.11208E-17
score: 70.7352
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 101..178
e-value: 6.9E-25
score: 88.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 115..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 40..62
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 114..134
NoneNo IPR availablePANTHERPTHR45659FAMILY NOT NAMEDcoord: 49..178
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 112..178