WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30032610
Length (bp)1468
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30032610) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30032610) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30032610) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30032610) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032610

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032610SMESG000060483.1 SmedASXL_010602SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30032610SMESG000060483.1 dd_Smed_v6_8615_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30032610SMESG000060483.1 OX_Smed_1.0.21682ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30032610SMESG000060483.1 dd_Smed_v4_8615_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: KATNB1 (katanin regulatory subunit B1 [Source:HGNC Symbol;Acc:HGNC:6217])

HSP 1 Score: 52.373 bits (124), Expect = 1.594e-6
Identity = 49/208 (23.56%), Postives = 83/208 (39.90%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYN 1256
            V G +   IRV+DL    E  K   T     + GH   IC++ +HP       Y     SG  D +I++WD R    +++Y G H      L   P+   +  ++   D   +++W     +++ EF  H             T P++             V ++  ++Y+L  GS+   ++  D   F  V  +   P  V SV +N
Sbjct:   79 VAGSQSGSIRVWDL----EAAKILRT-----LMGHKANICSLDFHP-------YGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HSQAVRCLRFSPDGKWLASAA---DDHTVKLWDLTAGKMMSEFPGH-------------TGPVN-------------VVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN 240          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Katnb1 (katanin p80 (WD40-containing) subunit B 1 [Source:MGI Symbol;Acc:MGI:1921437])

HSP 1 Score: 51.9878 bits (123), Expect = 1.326e-6
Identity = 49/208 (23.56%), Postives = 83/208 (39.90%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYN 1256
            V G +   IRV+DL    E  K   T     + GH   IC++ +HP       Y     SG  D +I++WD R    +++Y G H      L   P+   +  ++   D   +++W     +++ EF  H             T P++             V ++  ++Y+L  GS+   ++  D   F  V  +   P  V SV +N
Sbjct:   79 VAGSQSGSIRVWDL----EAAKILRT-----LMGHKANICSLDFHP-------YGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HSQAVRCLRFSPDGKWLASAA---DDHTVKLWDLTAGKMMSEFPGH-------------TGPVN-------------VVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN 240          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BVA0|KTNB1_HUMAN (Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 7.653e-6
Identity = 49/208 (23.56%), Postives = 83/208 (39.90%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYN 1256
            V G +   IRV+DL    E  K   T     + GH   IC++ +HP       Y     SG  D +I++WD R    +++Y G H      L   P+   +  ++   D   +++W     +++ EF  H             T P++             V ++  ++Y+L  GS+   ++  D   F  V  +   P  V SV +N
Sbjct:   79 VAGSQSGSIRVWDL----EAAKILRT-----LMGHKANICSLDFHP-------YGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HSQAVRCLRFSPDGKWLASAA---DDHTVKLWDLTAGKMMSEFPGH-------------TGPVN-------------VVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN 240          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BG40|KTNB1_MOUSE (Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.278e-6
Identity = 49/208 (23.56%), Postives = 83/208 (39.90%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYN 1256
            V G +   IRV+DL    E  K   T     + GH   IC++ +HP       Y     SG  D +I++WD R    +++Y G H      L   P+   +  ++   D   +++W     +++ EF  H             T P++             V ++  ++Y+L  GS+   ++  D   F  V  +   P  V SV +N
Sbjct:   79 VAGSQSGSIRVWDL----EAAKILRT-----LMGHKANICSLDFHP-------YGEFVASGSQDTNIKLWDIRRKGCVFRYRG-HSQAVRCLRFSPDGKWLASAA---DDHTVKLWDLTAGKMMSEFPGH-------------TGPVN-------------VVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFN 240          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A5K4F1D3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 3.434e-119
Identity = 186/398 (46.73%), Postives = 264/398 (66.33%), Query Frame = 3
Query:  204 IPLGDENPLVTRISFDKQCYAVGLDSGAIKMY-TFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNE-PRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDH-------------REINRTQPSYQQYTKPISKLNQDK-NSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPET--ITEKRPVRMSFCSGTKLYLVKLEKK 1343
            +  G+ N +V RIS D + + +GL +G I +  T   +K    +  L +D +TL C+DLQ +P  +    +  H+++A Y SGH ++WHYT A   SRL+A+  EE+I  P++ P ++    + + +M   NQI++CS S DG R VTGG D  +RVYD+  +K +  C S+ + +KMDGHVMRICAV+YHPRG   E Y HIFI+GGWDD+IQIWDDR+  SLW YYGPH+CGSDAL+I+ E NHIL  SWRRDK+IL+VWKFNEE+++EF +              REI   Q     Y KP++++ QD  + PS GYVAKWLG  YI FGGS+ N+LK++ + T N VG V++L +G+YS+A+  P+T   + KR V+ +F SGT++Y+ + E+K
Sbjct:   34 LDFGNVNAMVVRISNDNKYWIIGLSNGTIVLLSTEESEKQTNNFYTLNADGETLPCSDLQPIPELNGRIQDNCHLILAVYVSGHARLWHYTGAMKSSRLLATITEERISNPSDAPLRT----NAENMM---NQILSCSCSYDGKRFVTGGVDCHLRVYDMKSRKRLQICSSSFTKEKMDGHVMRICAVKYHPRGAVYEDYVHIFITGGWDDTIQIWDDRYLHSLWIYYGPHICGSDALEIESESNHILSCSWRRDKSILQVWKFNEELMIEFYNSAEHQGDQLSIPSGREIINKQTGALYYCKPVAEIPQDTYDGPSKGYVAKWLGPYYIAFGGSDANILKLISRFTLNVVGSVTELTSGIYSLAFIEPKTNDSSNKRMVQFAFASGTRVYIAQYEQK 424          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A4E0R2S0 (WD_REPEATS_REGION domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_008643 PE=4 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.289e-112
Identity = 176/390 (45.13%), Postives = 251/390 (64.36%), Query Frame = 3
Query:  210 LGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHRE-----------INRTQPSYQQYTKPISKLNQDK-NSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
              D   +V R++ D+  + VGL +G IK+   +G+    +  L  +D ++ SC D++ VP+K   PSEK H L+A YASG+++IW+YT ATP+S+L+++  EE I R     KS T ++ K+     NQI+ACS SLDG R VTGG+D  IRVYD+  KK +    S+ S DK+DGHVMRICA+QYHPRG     Y H+FISGGWDD++QIWDDR   SLW Y GPH+ GSDALDI+P+ N+IL SSWR D TIL+VWKF ++ + + +   E           +N  Q       +PI+++ Q      S GYVAKWLG  +I FGGSN N+ ++  +    +   V+DLPNGV+SVA+   +T   +RP++++F +G ++YL ++E+K
Sbjct:   35 FADITVMVVRLTSDETFWIVGLRNGIIKLIPASGETPSNIQTLQVTD-ESSSCVDVKCVPHKPNEPSEKNHRLVAAYASGYVRIWYYTGATPESKLLSTMGEEFIPREEGNPKSATRKNKKM-----NQILACSCSLDGERFVTGGDDCFIRVYDINQKKVLRTLGSSFSVDKIDGHVMRICALQYHPRGGEFPEYKHVFISGGWDDTVQIWDDRFQHSLWVYAGPHISGSDALDIEPQSNYILTSSWRHDSTILQVWKFKDDAVAQLHAALESLPPGSDSFFRLNAEQIDVAFRERPIAEVPQQSFEMRSKGYVAKWLGPSFIAFGGSNANVFRVFTQNKAASTAAVTDLPNGVFSVAFAPSQTNDFQRPLQLAFAAGPRVYLARVERK 418          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A267GN11 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028217g2 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.861e-105
Identity = 173/396 (43.69%), Postives = 242/396 (61.11%), Query Frame = 3
Query:  186 INPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSD-PDTLSCTDLQFVPYK-DYVPSEKKHILIATYASGHMKIWHYTA-ATPK--SRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRG-QTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQ---YTKPISKLNQDK-NSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
            +N + E P  DE  +V R+S DK  +AVGL SG I+   FT +   LVY L P +  +  + T L FVP       +E++H+++A YA+G +++WHYT  A P   +  V +  +E    P +  +    R GK    EN Q++  + S D  R V GG    IRVY+      I  C S+ S +++DGH  R+CA+ YHP G Q    Y H+F+SGGWD+++QIWDDR   SLW Y+GPHVCG+DALDIDP QNHIL SSW R + +L+VWKF +E          ++  +P  Q+     +P+ +L QD   +PSMGYVA+WLG QY+LF GSN N+LKI+D+ T N V  VSDLP GVYSVA  +P++   ++P ++S CSG +LY  + E+K
Sbjct:   50 LNSVVEFP--DEECMVVRLSHDKALWAVGLSSGKIQF--FTTESCTLVYSLDPPERKENETVTGLVFVPPDPSSQKTERQHLILACYATGQVRLWHYTGVANPLLWTLQVEALPQEGESHPQQQSEKSRQRGGKAKESENQQLLCLACSPDSQRFVVGGVGGEIRVYEFRRHNLINVCQSSYSVNRVDGHRNRVCALLYHPLGRQMPADYGHVFLSGGWDNTVQIWDDRRGHSLWVYFGPHVCGTDALDIDPLQNHILTSSWERHRALLQVWKFQDEAA-----RGRVDLDEPGVQEDMLKGRPLGELQQDPLTAPSMGYVAQWLGDQYMLFAGSNANLLKIVDRGTLNMVASVSDLPKGVYSVAPLLPDSSDSRKPAKLSVCSGNRLYTFRFERK 436          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A267GJT9 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028217g3 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.032e-105
Identity = 173/393 (44.02%), Postives = 241/393 (61.32%), Query Frame = 3
Query:  186 INPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSD-PDTLSCTDLQFVPYK-DYVPSEKKHILIATYASGHMKIWHYTA-ATPK--SRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRG-QTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDK-NSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
            +N + E P  DE  +V R+S DK  +AVGL SG I+   FT +   LVY L P +  +  + T L FVP       +E++H+++A YA+G +++WHYT  A P   +  V +  +E    P +  +    R GK    EN Q++  + S D  R V GG    IRVY+      I  C S+ S +++DGH  R+CA+ YHP G Q    Y H+F+SGGWD+++QIWDDR   SLW Y+GPHVCG+DALDIDP QNHIL SSW R + +L+VWKF +E      D  E+   +   +   +P+ +L QD   +PSMGYVA+WLG QY+LF GSN N+LKI+D+ T N V  VSDLP GVYSVA  +P++   ++P ++S CSG +LY  + E+K
Sbjct:   50 LNSVVEFP--DEECMVVRLSHDKALWAVGLSSGKIQF--FTTESCTLVYSLDPPERKENETVTGLVFVPPDPSSQKTERQHLILACYATGQVRLWHYTGVANPLLWTLQVEALPQEGESHPQQQSEKSRQRGGKAKESENQQLLCLACSPDSQRFVVGGVGGEIRVYEFRRHNLINVCQSSYSVNRVDGHRNRVCALLYHPLGRQMPADYGHVFLSGGWDNTVQIWDDRRGHSLWVYFGPHVCGTDALDIDPLQNHILTSSWERHRALLQVWKFQDEAARGRVDLDELGVQEDMLK--GRPLGELQQDPLTAPSMGYVAQWLGDQYMLFAGSNANLLKIVDRGTLNMVASVSDLPKGVYSVAPLLPDSSDSRKPAKLSVCSGNRLYTFRFERK 436          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A267GX91 (WD_REPEATS_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028217g1 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 4.443e-105
Identity = 173/396 (43.69%), Postives = 242/396 (61.11%), Query Frame = 3
Query:  186 INPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSD-PDTLSCTDLQFVPYK-DYVPSEKKHILIATYASGHMKIWHYTA-ATPK--SRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRG-QTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQ---YTKPISKLNQDK-NSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
            +N + E P  DE  +V R+S DK  +AVGL SG I+   FT +   LVY L P +  +  + T L FVP       +E++H+++A YA+G +++WHYT  A P   +  V +  +E    P +  +    R GK    EN Q++  + S D  R V GG    IRVY+      I  C S+ S +++DGH  R+CA+ YHP G Q    Y H+F+SGGWD+++QIWDDR   SLW Y+GPHVCG+DALDIDP QNHIL SSW R + +L+VWKF +E          ++  +P  Q+     +P+ +L QD   +PSMGYVA+WLG QY+LF GSN N+LKI+D+ T N V  VSDLP GVYSVA  +P++   ++P ++S CSG +LY  + E+K
Sbjct:   50 LNSVVEFP--DEECMVVRLSHDKALWAVGLSSGKIQF--FTTESCTLVYSLDPPERKENETVTGLVFVPPDPSSQKTERQHLILACYATGQVRLWHYTGVANPLLWTLQVEALPQEGESHPQQQSEKSRQRGGKAKESENQQLLCLACSPDSQRFVVGGVGGEIRVYEFRRHNLINVCQSSYSVNRVDGHRNRVCALLYHPLGRQMPADYGHVFLSGGWDNTVQIWDDRRGHSLWVYFGPHVCGTDALDIDPLQNHILTSSWERHRALLQVWKFQDEAA-----RGRVDLDEPGVQEDMLKGRPLGELQQDPLTAPSMGYVAQWLGDQYMLFAGSNANLLKIVDRGTLNMVASVSDLPKGVYSVAPLLPDSSDSRKPAKLSVCSGNRLYTFRFERK 436          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044062.1 (WD repeat-containing protein 5B-like [Source:NCBI gene;Acc:103035992])

HSP 1 Score: 164.081 bits (414), Expect = 2.647e-45
Identity = 109/339 (32.15%), Postives = 160/339 (47.20%), Query Frame = 3
Query:  228 LVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYS 1244
            +  + S D    AVGL +G IK+Y+    ++    +   S    L  T L+F            H+L+ATYASG ++ W+         L  S   E+   P +PR+S                +  S SL G R VTGG D+ + +YDL   + +  C ++ S   MDGH  RI AV +HP  +TE      FI+GGWD+++Q WD R   S+   YGPHVCG DAL I+P  N IL  SWRR  T LEVW ++                        + +S++ QD +  S  Y   W G  +++ GG   N+L++++  +      + DL + VYS
Sbjct:   82 MTCQFSTDGSLLAVGLCNGTIKVYSTDSGELTQTLRDNSSVISGLPVTGLRFT-----CSGNLHHLLLATYASGCVRCWYVWGGQCVWWLKESKDSEEDEDP-QPRES----------------LCLSTSLSGERAVTGGSDATVHLYDLNTCQRLQVCRASASKAVMDGHRFRIFAVSFHPERETE------FITGGWDNTVQFWDTRMQHSIRMLYGPHVCG-DALHINPASNQILSGSWRRYNT-LEVWDYDS----------------------GRKVSEVPQDPHENSRIYTCYWSGQDHLIGGGGQANILRVVNHHSLETESRLFDLSSAVYS 368          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 50.447 bits (119), Expect = 3.986e-6
Identity = 48/193 (24.87%), Postives = 80/193 (41.45%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVG 1211
            V G E   +RV+DL    E  K   T     + GH   IC++ +HP G+      HI  SG  D +I++WD R    +++Y G H      +   P+   +  +S   D + +++W     ++I EF  H                 S +N          V ++  ++Y+L  GS    +K+ D   F  +G
Sbjct:   78 VAGSESGSLRVWDL----EAAKILRT-----LMGHKANICSLDFHPFGE------HI-ASGSVDTNIKLWDVRRKGCVFRYKG-HTQAVRCISFSPDGKWLASAS---DDSTIKLWDLTAGKLITEFTAH----------------TSAVN----------VVQFHPNEYLLASGSADRTVKLWDLEKFKLIG 224          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 50.0618 bits (118), Expect = 4.953e-6
Identity = 48/193 (24.87%), Postives = 80/193 (41.45%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVG 1211
            V G E   +RV+DL    E  K   T     + GH   IC++ +HP G+      HI  SG  D +I++WD R    +++Y G H      +   P+   +  +S   D + +++W     ++I EF  H                 S +N          V ++  ++Y+L  GS    +K+ D   F  +G
Sbjct:  115 VAGSESGSLRVWDL----EAAKILRT-----LMGHKANICSLDFHPFGE------HI-ASGSVDTNIKLWDVRRKGCVFRYKG-HTQAVRCISFSPDGKWLASAS---DDSTIKLWDLTAGKLITEFTAH----------------TSAVN----------VVQFHPNEYLLASGSADRTVKLWDLEKFKLIG 261          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: katnb1 (katanin regulatory subunit B1 [Source:NCBI gene;Acc:103029566])

HSP 1 Score: 49.2914 bits (116), Expect = 8.400e-6
Identity = 48/193 (24.87%), Postives = 80/193 (41.45%), Query Frame = 3
Query:  636 VTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNE-EVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVG 1211
            V G E   +RV+DL    E  K   T     + GH   IC++ +HP G+      HI  SG  D +I++WD R    +++Y G H      +   P+   +  +S   D + +++W     ++I EF  H                 S +N          V ++  ++Y+L  GS    +K+ D   F  +G
Sbjct:   78 VAGSESGSLRVWDL----EAAKILRT-----LMGHKANICSLDFHPFGE------HI-ASGSVDTNIKLWDVRRKGCVFRYKG-HTQAVRCISFSPDGKWLASAS---DDSTIKLWDLTAGKLITEFTAH----------------TSAVN----------VVQFHPNEYLLASGSADRTVKLWDLEKFKLIG 224          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 48.521 bits (114), Expect = 1.816e-6
Identity = 53/228 (23.25%), Postives = 97/228 (42.54%), Query Frame = 3
Query:  594 QIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNL-------NMLKILDKATFNAVGMVSDLPNGVYSVAYN 1256
             ++ C +  +    +TG +D +IRVYD + KK ++         ++ GH   + A++Y   G        I +SG  D ++++WD +       + G H      LDI   +N   + +  RD T L VWK  +E  +   DH E         ++  P+     ++N   +G +   + S   + G  N+       N L + D A    + ++S   + +YS  Y+
Sbjct:  383 SVITC-LQFEDNYVITGADDKMIRVYDSINKKFLL---------QLSGHDGGVWALKYAHGG--------ILVSGSTDRTVRVWDIKKGCCTHVFKG-HNSTVRCLDIVEYKNIKYIVTGSRDNT-LHVWKLPKESSVP--DHGE---------EHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYD 579          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO44597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV80])

HSP 1 Score: 165.236 bits (417), Expect = 6.593e-47
Identity = 119/370 (32.16%), Postives = 181/370 (48.92%), Query Frame = 3
Query:  150 PTKLGNPIYTGIINPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTL-SCTDLQFVPYKDYVPSEK-KHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDR--HSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSV 1247
            P+  GN     ++   +E+       +  R + D    AVGL +G +K+Y    +    VY L   D +TL S   +  + +K    +E   +IL+ATYA G +K WH + +   S                              KE  Q++ACS++    R VT G D+ I +YD   K+ +     + S   MDGH+ R+ +VQ+ P G+      H+F+SGGWDD++Q WD R     S+ + +GPH+CG DALDI P   +IL  SWR+D T L++W +                         K I  +  D NS SM Y  +W GS+ I+ GGS+ NM++++D+AT++ +G V DLP  VY+V
Sbjct:    3 PSAEGNVKILNVVETSSEV-------MCCRFNLDGSLIAVGLANGTVKVYL--AENGNCVYSL--HDQETLNSHLPVTCLRWKAAGANEDFGNILLATYADGCVKHWHASTSKCLS----------------------------TQKEGRQVLACSINFSADRFVTSGSDTKIFLYDEKTKQTVSTFQPSTSHLVMDGHMSRVFSVQFVP-GE-----DHVFLSGGWDDTVQYWDTRVDAKHSIRKIFGPHICG-DALDIHPMNFNILTGSWRKDDT-LQIWDYGS----------------------GKMIKSIQHDYNS-SMLYSVQWQGSEGIIAGGSDNNMMRLIDQATYHTLGRVVDLPRAVYTV 302          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO48733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIL3])

HSP 1 Score: 76.6406 bits (187), Expect = 2.553e-15
Identity = 84/358 (23.46%), Postives = 145/358 (40.50%), Query Frame = 3
Query:  186 INPITEIPLGD-ENPLVTRISFDKQCYAVGLDSGAIKMYTF-TGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADK----------MDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSD 1223
            +  I ++  GD        +S   Q  A G  +GA+++Y+  TG K +    L       L  T ++F P+KD         L++T + G +  W               L+   H              K + + +N+I     S DG    T G+D  +RVYD     +I   F+ + A +            GH  ++  +++HP         ++F++GGWD  ++IWD R    +   +GP++CG D +DI   Q+ ++ SSW   K  L++W +    ++E       N   P  +                   YV +++ SQ ++ GGS    +KIL +     V  + D
Sbjct:   19 VTAIKDLDFGDIMGVFSVHLSPRDQYLAAGCGNGAVQVYSCDTGKKRR---PLKHGSLYGLPVTTVKFFPFKD-------DRLMSTTSDGTITCWD--------------LDNWSHM-------------KSVDEPHNEISTLDFSHDGKIFATAGKDRKVRVYD-SDTMQIKLTFAGSEATEPARDVSMIVPEGGHGKKVFGLRFHP------FDDNVFLTGGWDRCLKIWDVRVDHVIRSIHGPYICG-DGIDI--CQDEVMTSSWLHQKA-LQIWDYGSGELIE-------NVPFPCGEH--------------GEFLYVGRFVNSQVVVAGGSGTKDVKILTRKPHKVVASIDD 307          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T527])

HSP 1 Score: 62.003 bits (149), Expect = 1.932e-10
Identity = 41/164 (25.00%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  735 GHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDL 1226
            GH  ++  +++HP         ++F++GGWD  ++IWD R    +   +GP++CG D +DI   Q+ ++ +SW   K  L++W +    ++E       N   P  +                   YV +++ SQ ++ GGS    +KIL +        ++DL
Sbjct:  269 GHGKKVFGLRFHP------FDDNVFLTGGWDRCLKIWDVRVDHVIRSIHGPYICG-DGIDI--CQDEVMTASWLHQKA-LQIWDYGSGELIE-------NVPFPCGEH--------------GEFLYVGRFVNSQVVVAGGSGTKDVKILTRKPHKWYMTINDL 401          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000060483.1 (SMESG000060483.1)

HSP 1 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 415/415 (100.00%), Postives = 415/415 (100.00%), Query Frame = 3
Query:   99 MNSRHDKHDNQSETDGWPTKLGNPIYTGIINPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
            MNSRHDKHDNQSETDGWPTKLGNPIYTGIINPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK
Sbjct:    1 MNSRHDKHDNQSETDGWPTKLGNPIYTGIINPITEIPLGDENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIMKCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 415          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000047063.1 (SMESG000047063.1)

HSP 1 Score: 263.848 bits (673), Expect = 1.229e-82
Identity = 143/389 (36.76%), Postives = 228/389 (58.61%), Query Frame = 3
Query:  219 ENPLVTRISFDKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKDYVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRKSITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVG--------KKEIMKCFSTNSADKM---DGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEEVI-LEFNDHREINRTQPSYQQYTKPISKLNQD-KNSPSMGYVAKW-LGSQYILFGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMSFCSGTKLYLVKLEKK 1343
            EN    R + D   +AVGL +G I  Y+    +   +   L +  +T   T ++F+ ++    +E KH L+A+YASG +++WHYT+A  +SRL+  + E       +P+++ T         + NQI+  S+S D  R VTGG+D +I+VY++          K E     +  ++D +   D H +RI A++YHP G+T+  Y+HIFIS  WD++IQIWDDR   SLWQY GPHVCG+D +DIDP  N I+  SW+R+K +L+VWKFNE V+     D R +      Y Q++ P ++  QD  N PS GYV ++ +G QYI++GGSN N+ +I++ + F  +G + ++ + V S + +I    T+KR V+++  S  +L +  ++ K
Sbjct:   83 ENVFCIRTTPDHTLWAVGLQNGNINFYSTDNVENSYLVNNLKASSETYPVTHMEFMTFEKQGANETKHFLLASYASGFIRLWHYTSANIRSRLIREWKEYFFTSTKDPKQTET---------KLNQILCLSISGDSQRFVTGGDDCIIKVYEITSRTVARYLHKGETHTLQTGRASDAVLNADFHTLRITAIKYHPLGKTDAKYTHIFISASWDNTIQIWDDRKLGSLWQYLGPHVCGADGIDIDPFTNTIISCSWKREKAVLQVWKFNEYVLNASPIDGRAL------YGQFSVPTAEYYQDTSNIPSQGYVTQYIMGGQYIMYGGSNHNVFRIVESSNFIPLGAMFNIKSAVISASISIN---TDKRKVKVAIASAKQLLIFNVDLK 453          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000023048.1 (SMESG000023048.1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.212e-13
Identity = 45/150 (30.00%), Postives = 69/150 (46.00%), Query Frame = 3
Query:  576 IMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKK--------EIMKCFSTNSAD---KMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWDDRHS-RSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKF 989
            I+ E N+  A  +S DG    T G D  IR+Y               ++  F   + D   +  GH M I AV++HP    +       +S GWD+ +++WD R     +W+  GPHVC  D +DI  +   I  +SWR  +  L++W  
Sbjct:  130 IITEQNETYAFDISADGMELATCGRDRNIRIYRFANAGFCEETRLGSLIPKFIQMAVDEDMREMGHGMTIHAVKFHPDNSCQ------IVSAGWDNIVKMWDTRAKINPIWKISGPHVCSPDGIDI--KGYEIFTASWRA-RNALQIWDL 270          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KATNB11.594e-623.56katanin regulatory subunit B1 [Source:HGNC Symbol;... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Katnb11.326e-623.56katanin p80 (WD40-containing) subunit B 1 [Source:... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9BVA0|KTNB1_HUMAN7.653e-623.56Katanin p80 WD40 repeat-containing subunit B1 OS=H... [more]
sp|Q8BG40|KTNB1_MOUSE9.278e-623.56Katanin p80 WD40 repeat-containing subunit B1 OS=M... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F1D33.434e-11946.73Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0R2S01.289e-11245.13WD_REPEATS_REGION domain-containing protein OS=Fas... [more]
A0A267GN113.861e-10543.69WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
A0A267GJT94.032e-10544.02WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
A0A267GX914.443e-10543.69WD_REPEATS_REGION domain-containing protein OS=Mac... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000044062.12.647e-4532.15WD repeat-containing protein 5B-like [Source:NCBI ... [more]
katnb13.986e-624.87katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb14.953e-624.87katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
katnb18.400e-624.87katanin regulatory subunit B1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC41.816e-623.25F-box protein required for both the G1/S and G2/M ... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO445976.593e-4732.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487332.553e-1523.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289371.932e-1025.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060483.10.000e+0100.00SMESG000060483.1[more]
SMESG000047063.11.229e-8236.76SMESG000047063.1[more]
SMESG000023048.18.212e-1330.00SMESG000023048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032610 ID=SMED30032610|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1468bp
CAATCAATGCGAATGTTAAGGCAGCTAGTGACAATTAGAATTGTTAATAA
AATTATTTGTATTTAAATTAAATAAATTCTAATTTGCGATTGCATCAAAT
GAATTCTCGACATGATAAGCACGACAACCAGTCAGAAACTGACGGTTGGC
CAACAAAACTAGGAAATCCGATCTACACCGGCATCATCAATCCCATCACA
GAAATCCCCCTTGGTGATGAGAATCCATTGGTTACTCGGATTTCGTTTGA
TAAACAGTGCTACGCAGTTGGGCTCGACAGCGGTGCGATAAAGATGTACA
CGTTCACGGGAGATAAGGTTCAATTAGTTTATAAACTATTGCCTTCCGAT
CCGGACACTCTCTCGTGTACAGATTTGCAATTTGTCCCCTACAAGGATTA
CGTGCCTTCCGAGAAGAAACATATATTAATAGCAACTTATGCTAGCGGAC
ATATGAAAATTTGGCATTACACTGCAGCGACTCCTAAATCGAGATTAGTG
GCATCATTCCTCGAAGAAAAGATTCATCGACCAAACGAGCCCAGAAAATC
GATAACCGGGAGAGATGGGAAAATAATAATGAAAGAAAACAATCAAATAA
TGGCATGTTCAGTGTCATTGGATGGAGGAAGATGCGTGACAGGTGGAGAG
GATTCAGTCATTCGCGTGTACGATCTGGTAGGGAAAAAGGAAATTATGAA
ATGTTTTTCAACGAATTCTGCAGACAAGATGGACGGCCATGTAATGAGAA
TCTGTGCGGTCCAATACCACCCTCGTGGACAAACTGAAGAACTCTATTCC
CATATATTTATCTCAGGAGGTTGGGATGACAGCATCCAGATATGGGATGA
TAGACATTCCCGATCTTTATGGCAGTATTATGGACCTCATGTGTGCGGCT
CAGACGCCTTGGATATTGACCCGGAACAGAACCATATACTTGTATCGTCT
TGGCGACGTGACAAAACAATATTAGAGGTCTGGAAATTCAACGAAGAGGT
GATCCTAGAATTTAACGACCATCGAGAAATAAACCGAACCCAGCCGAGCT
ATCAGCAGTACACAAAACCCATCTCAAAACTCAATCAAGATAAAAACTCT
CCGAGCATGGGCTACGTTGCAAAATGGCTTGGTAGTCAATACATATTATT
TGGCGGCAGTAACTTGAACATGTTGAAGATCCTTGATAAAGCTACATTTA
ATGCGGTAGGAATGGTTTCTGATCTTCCAAATGGAGTCTACTCAGTTGCC
TATAACATTCCTGAAACAATTACAGAAAAACGGCCAGTTCGAATGTCATT
TTGTTCCGGGACAAAGTTATATCTCGTCAAGCTGGAGAAAAAATAGCAAC
AAGAAATGATTGAGCCTGGATCTTGAAGGAGGCATCAAATTTATTGCCAT
GTCTAGATCAATTTTTAATACATTTTTATGTTATATTATTTAATTAATAA
ATTTGTAACGAGTAAAAA
back to top

protein sequence of SMED30032610-orf-1

>SMED30032610-orf-1 ID=SMED30032610-orf-1|Name=SMED30032610-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=416bp
MNSRHDKHDNQSETDGWPTKLGNPIYTGIINPITEIPLGDENPLVTRISF
DKQCYAVGLDSGAIKMYTFTGDKVQLVYKLLPSDPDTLSCTDLQFVPYKD
YVPSEKKHILIATYASGHMKIWHYTAATPKSRLVASFLEEKIHRPNEPRK
SITGRDGKIIMKENNQIMACSVSLDGGRCVTGGEDSVIRVYDLVGKKEIM
KCFSTNSADKMDGHVMRICAVQYHPRGQTEELYSHIFISGGWDDSIQIWD
DRHSRSLWQYYGPHVCGSDALDIDPEQNHILVSSWRRDKTILEVWKFNEE
VILEFNDHREINRTQPSYQQYTKPISKLNQDKNSPSMGYVAKWLGSQYIL
FGGSNLNMLKILDKATFNAVGMVSDLPNGVYSVAYNIPETITEKRPVRMS
FCSGTKLYLVKLEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
GO:0006874cellular calcium ion homeostasis
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 153..192
e-value: 0.058
score: 22.5
coord: 204..250
e-value: 4.0E-4
score: 29.7
coord: 73..123
e-value: 110.0
score: 4.0
IPR001680WD40 repeatPFAMPF00400WD40coord: 212..250
e-value: 0.01
score: 16.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 211..250
score: 9.305
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 40..393
e-value: 9.7E-23
score: 82.6
NoneNo IPR availablePANTHERPTHR47822:SF2coord: 158..388
NoneNo IPR availablePANTHERPTHR47822:SF2coord: 46..126
NoneNo IPR availablePANTHERPTHR47822FAMILY NOT NAMEDcoord: 158..388
coord: 46..126
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 160..259
score: 11.787
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 42..386