Protein ovo

Overview
NameProtein ovo
Smed IDSMED30032592
Length (bp)1101
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein ovo (SMED30032592) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein ovo (SMED30032592) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein ovo (SMED30032592) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein ovo (SMED30032592) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032592

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30032592SMESG000016051.1 SmedASXL_007776SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30032592SMESG000016051.1 dd_Smed_v6_10673_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
midlineSMED30032592SMESG000016051.1 dd_Smed_v4_10673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal midlineSMED30032592SMESG000016051.1 dd_Smed_v4_10673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30032592SMESG000016051.1 dd_Smed_v4_10673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30032592SMESG000016051.1 dd_Smed_v4_10673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30032592SMESG000016051.1 dd_Smed_v4_10673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 164.081 bits (414), Expect = 1.929e-48
Identity = 75/138 (54.35%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT  R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:   49 DSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKK 186          
BLAST of Protein ovo vs. Ensembl Human
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 164.466 bits (415), Expect = 7.874e-48
Identity = 75/138 (54.35%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT  R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:  111 DSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKK 248          
BLAST of Protein ovo vs. Ensembl Human
Match: OVOL2 (ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:15804])

HSP 1 Score: 158.303 bits (399), Expect = 2.138e-45
Identity = 67/132 (50.76%), Postives = 96/132 (72.73%), Query Frame = 3
Query:  660 VLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            V  C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C  C K+FTQRCSLESHLKK+H +   Y YK+RR+K+++CE+CG++    +D + H++ +HP +   +K+  K
Sbjct:  118 VHSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249          
BLAST of Protein ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 154.066 bits (388), Expect = 8.708e-45
Identity = 70/170 (41.18%), Postives = 98/170 (57.65%), Query Frame = 3
Query:  531 NWISKP----SIEYVNNGAGIKNPLADEKNLI------SILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMS 1010
            NW   P       Y+ + + +  P A + + +                 R    L C  C K F   R+  RH+K HS +R++LC+ C KGF+D FDLKRH RTHTG+RP+ C  C K+FTQRCSLE+HL K+H     Y Y+ERREK+ +CE+CGF+S++ D + QH +
Sbjct:   16 NWGHLPDQLRGDAYIPDCSSLGGPPAQQSSSVRDPWTAQPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRA 185          
BLAST of Protein ovo vs. Ensembl Human
Match: OVOL3 (ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:14186])

HSP 1 Score: 153.68 bits (387), Expect = 2.072e-44
Identity = 64/121 (52.89%), Postives = 85/121 (70.25%), Query Frame = 3
Query:  648 RMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMS 1010
            R    L C  C K F   R+  RH+K HS +R++LC+ C KGF+D FDLKRH RTHTG+RP+ C  C K+FTQRCSLE+HL K+H     Y Y+ERREK+ +CE+CGF+S++ D + QH +
Sbjct:   89 RGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVRRHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDTYAQHRA 209          
BLAST of Protein ovo vs. Ensembl Celegans
Match: lin-48 (Putative zinc finger transcription factor [Source:UniProtKB/TrEMBL;Acc:G5EDU6])

HSP 1 Score: 189.504 bits (480), Expect = 9.110e-58
Identity = 91/177 (51.41%), Postives = 117/177 (66.10%), Query Frame = 3
Query:  537 ISKPSIEYVNNGAGIKNPLADEKNLISILDATK-------------NKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            I  P++E+VN G G+KNPLA    LIS  + T              +  D  +D L C  C K+F   RL NRHIK HS +++YLC +C KGFNDTFDLKRHTRTHTGVRPY C++C KSFTQRCSLESHL+K+H +   Y YKERR K+F+CE+CG++  K + +  H+   HP +
Sbjct:   81 IINPAVEFVNGGYGVKNPLAP---LISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQRLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLESHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFS 254          
BLAST of Protein ovo vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 76.6406 bits (187), Expect = 2.122e-15
Identity = 43/120 (35.83%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
             EC  C K F  S   + H+  HS  R Y C+YC K F+   D+K+HT  HTG +P+ C  C K+F+Q  +L +H +K H  F P          F C+ CG +  +  D  +H    HP
Sbjct:  154 FECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRK-HTGFKP----------FACDVCGRTFQRKVDRRRHRESHHP 262          
BLAST of Protein ovo vs. Ensembl Celegans
Match: F47E1.3 (pep chromosome:WBcel235:X:9046213:9054885:1 gene:WBGene00018567.1 transcript:F47E1.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F47E1.3)

HSP 1 Score: 72.0182 bits (175), Expect = 1.423e-13
Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLH 902
            CS C+K F+ S   N+H++ HS  R Y C +C K F  +  L+ H R H+G +P+ C  C K+F    + +SH+++ H
Sbjct:  526 CSVCQKSFSQSSSLNKHLRVHSGERPYKCSFCPKAFTASSILRTHVRQHSGEKPFKCAHCGKAFASHAAHDSHVRRSH 603          

HSP 2 Score: 59.6918 bits (143), Expect = 1.424e-9
Identity = 38/120 (31.67%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHI-KSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECG--FSSTKIDDFWQHMSDSH 1019
            C+ C + F        HI   H   R ++C  C K F+ +  L +H R H+G RPY C  C K+FT    L +H++           +   EK F C  CG  F+S    D   H+  SH
Sbjct:  497 CTICNRSFEKRDRLRIHILHVHENHRPHVCSVCQKSFSQSSSLNKHLRVHSGERPYKCSFCPKAFTASSILRTHVR-----------QHSGEKPFKCAHCGKAFASHAAHD--SHVRRSH 603          
BLAST of Protein ovo vs. Ensembl Celegans
Match: che-1 (Transcription factor che-1 [Source:UniProtKB/Swiss-Prot;Acc:Q966L8])

HSP 1 Score: 66.6254 bits (161), Expect = 1.155e-12
Identity = 36/115 (31.30%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
              C TC K F+ +     H + H+  + ++C  C + F+ +  L  H RTHTG RPY C +C K+FT   +L  HL + H    PY          +C  C    T+  +  +HM
Sbjct:  107 FRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHL-RTHTGHKPY----------VCSICMMKFTQSGNLHRHM 210          

HSP 2 Score: 65.4698 bits (158), Expect = 3.822e-12
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            C  C + F+ S     H ++H+  R Y C  C K F D+  L +H RTHTG +PY C  C   FTQ  +L  H+K
Sbjct:  137 CPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMK 211          

HSP 3 Score: 47.7506 bits (112), Expect = 3.922e-6
Identity = 17/49 (34.69%), Postives = 31/49 (63.27%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTH 815
            C+ C+K FT+S    +H+++H+  + Y+C  C+  F  + +L RH +TH
Sbjct:  165 CAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH 213          
BLAST of Protein ovo vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 69.3218 bits (168), Expect = 1.380e-12
Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
            C  C K F  +     H+++H+  R Y+CK+C K F    +L+ H RTHTG RPY CQ C ++F Q+  L +H
Sbjct:  248 CVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH 320          

HSP 2 Score: 60.077 bits (144), Expect = 1.147e-9
Identity = 30/78 (38.46%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLH 902
            C+ C K F+   +   H +SH+  + Y C +C K F     L+ H RTHTG RPY C+ C K+F Q  +   H K  H
Sbjct:  106 CTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAH 183          

HSP 3 Score: 49.2914 bits (116), Expect = 3.618e-6
Identity = 23/60 (38.33%), Postives = 38/60 (63.33%), Query Frame = 3
Query:  741 RKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY 920
            ++++C  C KGF+    L+ H R+HTG +PY+C  C K+F Q+ +L+ H ++ H    PY
Sbjct:  102 KRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVH-ERTHTGERPY 160          
BLAST of Protein ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070739)

HSP 1 Score: 166.392 bits (420), Expect = 4.605e-45
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            C  C K F+  RL NRH+K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESH +K+H++   Y YKERR K+++CEECG ++ + +  + H+ ++HP +
Sbjct: 1070 CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1189          
BLAST of Protein ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070738)

HSP 1 Score: 165.622 bits (418), Expect = 8.552e-45
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            C  C K F+  RL NRH+K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESH +K+H++   Y YKERR K+++CEECG ++ + +  + H+ ++HP +
Sbjct: 1199 CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1318          
BLAST of Protein ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0301914)

HSP 1 Score: 165.622 bits (418), Expect = 8.552e-45
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            C  C K F+  RL NRH+K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESH +K+H++   Y YKERR K+++CEECG ++ + +  + H+ ++HP +
Sbjct: 1199 CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 1318          
BLAST of Protein ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0070740)

HSP 1 Score: 161.384 bits (407), Expect = 2.506e-43
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            C  C K F+  RL NRH+K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESH +K+H++   Y YKERR K+++CEECG ++ + +  + H+ ++HP +
Sbjct:  823 CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 942          
BLAST of Protein ovo vs. Ensembl Fly
Match: ovo (gene:FBgn0003028 transcript:FBtr0100408)

HSP 1 Score: 160.999 bits (406), Expect = 2.911e-43
Identity = 70/120 (58.33%), Postives = 91/120 (75.83%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            C  C K F+  RL NRH+K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESH +K+H++   Y YKERR K+++CEECG ++ + +  + H+ ++HP +
Sbjct:  876 CRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFS 995          
BLAST of Protein ovo vs. Ensembl Zebrafish
Match: ovol1b (ovo-like zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-091204-357])

HSP 1 Score: 163.31 bits (412), Expect = 1.976e-47
Identity = 73/156 (46.79%), Postives = 101/156 (64.74%), Query Frame = 3
Query:  606 NLISILDATKNKDDRMKDV------LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            N+ S   A+     ++ D+      L C  C+K FT +R+  RH+K HS+ +KY C++C KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLE+HLKK+H +   Y +KERR+K+++CEECG ++   +    H+   HP   +  K+  K
Sbjct:  112 NMPSHQPASPENARKIVDIPPADSGLSCQVCQKTFTTARMLKRHLKCHSETKKYSCEHCGKGFNDTFDLKRHVRTHTGVRPYKCTMCAKAFTQRCSLEAHLKKIHAVTQQYAFKERRDKLYVCEECGLTAQTRESLQNHLQAQHPHRLITTKTNQK 267          
BLAST of Protein ovo vs. Ensembl Zebrafish
Match: ovol1a (ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 160.614 bits (405), Expect = 4.953e-46
Identity = 69/129 (53.49%), Postives = 92/129 (71.32%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            C  C+K F   R+ NRH+K HS+ +++LC +C KGFNDTFDLKRH RTHTGVRPY C+ C K+FTQRCSLESH+KK+H +   Y YKERR K+++CEECG +++  D   +H+   HP +   R  G +
Sbjct:  161 CQVCQKVFQFQRMLNRHLKCHSEQKRHLCDFCGKGFNDTFDLKRHVRTHTGVRPYKCELCDKAFTQRCSLESHMKKIHGVTQQYAYKERRSKLYVCEECGHTASTQDALLRHLHTEHPNSAFLRAKGAR 289          
BLAST of Protein ovo vs. Ensembl Zebrafish
Match: zgc:171929 (zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19])

HSP 1 Score: 99.3673 bits (246), Expect = 3.002e-25
Identity = 41/74 (55.41%), Postives = 56/74 (75.68%), Query Frame = 3
Query:  801 HTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            HT THT +RPY C  C K+FTQRCSLESHL+K+H +   Y Y++RR KIF+CE+CGF+S++ D ++ H+   HP
Sbjct:    1 HTHTHTSIRPYRCDLCEKAFTQRCSLESHLRKIHGVQQQYAYRQRRSKIFVCEDCGFTSSRPDQYFLHVRQQHP 74          
BLAST of Protein ovo vs. Ensembl Zebrafish
Match: znf1162 (zinc finger protein 1162 [Source:ZFIN;Acc:ZDB-GENE-050220-5])

HSP 1 Score: 85.1149 bits (209), Expect = 4.479e-18
Identity = 48/126 (38.10%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKE-------------RREKIFICEECGFSSTKIDDFWQHM 1007
            C+ C K F N  L  RH+  H+  + Y C +C K FND+ +LK H RTHTG +PYHC  C KSFTQ  SL +H K  HN+       E              +E+ + C  CG S        QH 
Sbjct:   64 CTQCGKSFKNKHLLKRHVMIHTGEKPYQCSHCDKRFNDSGNLKTHARTHTGEKPYHCTACGKSFTQSSSLRTHTKHNHNLITKEEESEDLSEAKKVNFSVRMKEEPYSCSVCGKSFKHQSSLSQHQ 189          

HSP 2 Score: 50.8322 bits (120), Expect = 1.025e-6
Identity = 25/65 (38.46%), Postives = 35/65 (53.85%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFT 863
            C+ C K FT     + H K H+ +++++C  C K F     LKRH R HTG +PY C  C + F 
Sbjct:  256 CALCGKTFTRQSSLSLHEKIHTGVKEHVCFECGKTFFQAGYLKRHQRIHTGEKPYACSHCDRRFV 320          
BLAST of Protein ovo vs. Ensembl Zebrafish
Match: zbtb40 (zinc finger and BTB domain containing 40 [Source:ZFIN;Acc:ZDB-GENE-030131-1704])

HSP 1 Score: 83.9593 bits (206), Expect = 4.388e-17
Identity = 40/121 (33.06%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKS-HSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
              C  C   F+ +   + H K  H++ + Y C+YC   F  + +L RH RTHTG +PY C++C K F Q   L  HL+  HN+  P+           C++C  S + +D+  QH+   HP
Sbjct:  716 FHCKHCDMSFSVAAALSYHTKKKHAEGKMYCCQYCSASFAQSIELTRHVRTHTGDKPYVCRECGKGFKQANGLSVHLQNFHNITEPHD----------CQKCRVSFSSLDELRQHIQKVHP 826          

HSP 2 Score: 63.929 bits (154), Expect = 1.221e-10
Identity = 41/137 (29.93%), Postives = 60/137 (43.80%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKS-HSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP*ILN*C 1076
            C  C K F +S     H ++ H + R Y C+ C   F  T  LK H R HTG +P+HC+ C  SF+   +L  H KK H             K++ C+ C  S  +  +  +H         +   +GDKP +   C
Sbjct:  661 CDICDKTFKHSSGLLYHKRTEHFEERPYACEECGAKFAATSSLKNHMRLHTGEKPFHCKHCDMSFSVAAALSYHTKKKH----------AEGKMYCCQYCSASFAQSIELTRH---------VRTHTGDKPYVCREC 778          

HSP 3 Score: 52.7582 bits (125), Expect = 4.488e-7
Identity = 28/118 (23.73%), Postives = 49/118 (41.53%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
            +C  C+  F++     +HI+       + C  C K +N    L++H   H G +PY C+ C K++     L  H + +H            + +  CE C  S T  +   +H   +H
Sbjct:  803 DCQKCRVSFSSLDELRQHIQKVHPKELHQCPECSKIYNSEGALEKHMNVHDGNKPYSCKTCNKAYQTLSGLWYHNRTVHPEISTSQSNRSLKALLQCERCDKSFTSHNSLIKHQITNH 920          
BLAST of Protein ovo vs. Ensembl Xenopus
Match: ovol2 (ovo like zinc finger 2 [Source:NCBI gene;Acc:448478])

HSP 1 Score: 164.851 bits (416), Expect = 5.880e-48
Identity = 69/134 (51.49%), Postives = 99/134 (73.88%), Query Frame = 3
Query:  654 KDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            +++  C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+F+CE+CG++    +D + H+ DSHP +   +K+  K
Sbjct:  111 EEIYSCEICAKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKKTTKK 244          
BLAST of Protein ovo vs. Ensembl Xenopus
Match: ovol2 (ovo like zinc finger 2 [Source:NCBI gene;Acc:448478])

HSP 1 Score: 164.466 bits (415), Expect = 1.368e-47
Identity = 69/134 (51.49%), Postives = 99/134 (73.88%), Query Frame = 3
Query:  654 KDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            +++  C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+F+CE+CG++    +D + H+ DSHP +   +K+  K
Sbjct:  128 EEIYSCEICAKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGSAFLKKTTKK 261          
BLAST of Protein ovo vs. Ensembl Xenopus
Match: csf3r (colony stimulating factor 3 receptor [Source:Xenbase;Acc:XB-GENE-482176])

HSP 1 Score: 160.999 bits (406), Expect = 8.125e-47
Identity = 71/130 (54.62%), Postives = 96/130 (73.85%), Query Frame = 3
Query:  660 VLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN-YLNRKS 1046
            +  C+ C+K F+  R+ NRH+K HS+++++ C++C KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CE+CGF++   +    H+ D HP +  LNR S
Sbjct:   97 LFHCALCEKSFSFQRMLNRHMKCHSEVKRHRCEHCGKGFNDTFDLKRHVRTHTGVRPYKCHLCEKAFTQRCSLESHLKKIHGVQQNYAYKERRTKLYVCEDCGFTADSQESQLHHLQDQHPTSPLLNRTS 226          
BLAST of Protein ovo vs. Ensembl Xenopus
Match: ENSXETT00000009201.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460547.1:151386:173197:1 gene:ENSXETG00000001160.1 transcript:ENSXETT00000009201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 3.397e-26
Identity = 50/105 (47.62%), Postives = 70/105 (66.67%), Query Frame = 3
Query:  747 YLCKYCLKGFNDTFDLKRHTRTHTG--VRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            Y C+ C KGF+    +KRH  T  G  + PY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+F+CE+CG++    +D + H+ DSHP N   +K+  K
Sbjct:   54 YSCEICAKGFHQ---VKRHLCTFCGKGIHPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGNAFLKKTTKK 155          
BLAST of Protein ovo vs. Ensembl Xenopus
Match: ENSXETT00000009194.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460547.1:151249:173197:1 gene:ENSXETG00000001160.1 transcript:ENSXETT00000009194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 1.326e-25
Identity = 50/105 (47.62%), Postives = 70/105 (66.67%), Query Frame = 3
Query:  747 YLCKYCLKGFNDTFDLKRHTRTHTG--VRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            Y C+ C KGF+    +KRH  T  G  + PY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+F+CE+CG++    +D + H+ DSHP N   +K+  K
Sbjct:   70 YSCEICAKGFHQ---VKRHLCTFCGKGIHPYKCEICNKAFTQRCSLESHLKKIHGVQQGYAYKQRRDKLFVCEDCGYTGPSQEDLYLHVYDSHPGNAFLKKTTKK 171          
BLAST of Protein ovo vs. Ensembl Mouse
Match: Ovol1 (ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:1330290])

HSP 1 Score: 164.851 bits (416), Expect = 4.099e-48
Identity = 75/138 (54.35%), Postives = 97/138 (70.29%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT+ R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:  111 DSPNGDLFTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDSPLLRKTSKK 248          
BLAST of Protein ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 158.303 bits (399), Expect = 6.472e-46
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+++CE+CG++    +D + H++  HP +   +K+  K
Sbjct:   87 CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 215          
BLAST of Protein ovo vs. Ensembl Mouse
Match: Ovol2 (ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:1338039])

HSP 1 Score: 158.303 bits (399), Expect = 1.313e-45
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+++CE+CG++    +D + H++  HP +   +K+  K
Sbjct:  120 CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248          
BLAST of Protein ovo vs. Ensembl Mouse
Match: Ovol3 (ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:2388075])

HSP 1 Score: 150.984 bits (380), Expect = 9.173e-44
Identity = 64/126 (50.79%), Postives = 84/126 (66.67%), Query Frame = 3
Query:  627 ATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
             T     +    L C  C K F   R+  RH+K HS  R+++C YC KGF+D FDLKRH RTHTG+RP+ C  C K+FTQRCSLE+HL K+H     Y Y+ERREK+ +CE+CGF+S++ D + QH
Sbjct:   57 GTLTSAPKGPGTLGCPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMRTHTGIRPFRCGACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFTSSRPDAYAQH 182          
BLAST of Protein ovo vs. Ensembl Mouse
Match: Mynn (myoneurin [Source:MGI Symbol;Acc:MGI:1931415])

HSP 1 Score: 88.9669 bits (219), Expect = 7.769e-19
Identity = 60/191 (31.41%), Postives = 86/191 (45.03%), Query Frame = 3
Query:  561 VNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY------------------GYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNY-LNRKSGDKP*ILN*C 1076
            ++N A +K+P   E N    LDA  +K   M     C+TC K F+ +    RH++ H  ++ Y+C  C K F     LK H RTHTG RPY C+ C K F Q+C L  H +  H    PY                    K   EK ++C+ CG          Q  + +  L Y + R +G+KP + + C
Sbjct:  274 MSNIASVKSPYELE-NAGEELDARFSKAKPM-----CNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGERPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCG----------QRFAQASTLTYHVRRHTGEKPYVCDTC 448          

HSP 2 Score: 63.5438 bits (153), Expect = 1.672e-10
Identity = 43/135 (31.85%), Postives = 57/135 (42.22%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY------------GYKERR------EKIFICEECGFSSTKIDDFWQHMSDSH 1019
            C  C  +F  S     H + HS  + Y+C  C + F     L  H R HTG +PY C  C K+F    SL +H +K H    PY            G   +       E+ FICE CG S T I +  +H +  H
Sbjct:  389 CDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRK-HTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVH 522          

HSP 3 Score: 60.077 bits (144), Expect = 2.439e-9
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHN 905
            C TC K F  S     H + H+  + Y+C  C K F  + +L +H R+HTG RP+ C+ C  S+T   +L+ H  K+H+
Sbjct:  445 CDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHS 523          
BLAST of Protein ovo vs. UniProt/SwissProt
Match: sp|Q9WTJ2|OVOL1_MOUSE (Putative transcription factor Ovo-like 1 OS=Mus musculus OX=10090 GN=Ovol1 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.867e-47
Identity = 75/138 (54.35%), Postives = 97/138 (70.29%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT+ R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:  111 DSPNGDLFTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKERHPDSPLLRKTSKK 248          
BLAST of Protein ovo vs. UniProt/SwissProt
Match: sp|O14753|OVOL1_HUMAN (Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3)

HSP 1 Score: 164.466 bits (415), Expect = 3.781e-47
Identity = 75/138 (54.35%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT  R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:  111 DSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKK 248          
BLAST of Protein ovo vs. UniProt/SwissProt
Match: sp|A2VDT4|OVOL1_BOVIN (Putative transcription factor Ovo-like 1 OS=Bos taurus OX=9913 GN=OVOL1 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.551e-47
Identity = 75/138 (54.35%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  642 DDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            D    D+  C  C+K FT  R+ NRH+K H+ ++++LC YC KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECG +S   +    H+ + HP + L RK+  K
Sbjct:  111 DGPSGDLFTCHICQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKK 248          
BLAST of Protein ovo vs. UniProt/SwissProt
Match: sp|Q8CIV7|OVOL2_MOUSE (Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=2 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 9.182e-45
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C+ C K+FTQRCSLESHLKK+H +   Y YK+RR+K+++CE+CG++    +D + H++  HP +   +K+  K
Sbjct:  120 CDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKK 248          
BLAST of Protein ovo vs. UniProt/SwissProt
Match: sp|Q9BRP0|OVOL2_HUMAN (Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.027e-44
Identity = 67/132 (50.76%), Postives = 96/132 (72.73%), Query Frame = 3
Query:  660 VLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            V  C  C K F   R+ NRH+K H++++++LC +C KGFNDTFDLKRH RTHTG+RPY C  C K+FTQRCSLESHLKK+H +   Y YK+RR+K+++CE+CG++    +D + H++ +HP +   +K+  K
Sbjct:  118 VHSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKK 249          
BLAST of Protein ovo vs. TrEMBL
Match: A0A0N5AD42 (Uncharacterized protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.269e-58
Identity = 108/240 (45.00%), Postives = 144/240 (60.00%), Query Frame = 3
Query:  324 KVNQMLPTENKSFCISNQLKFGIETILKKNETITYENIYSRCYGFPTQLSWLMNRPHFWPNTKFLDYGVNWISKPS-----IEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            K   +LP+EN +F   + L+ G   I K+ +              P++L  + N     P+T         +++P+     +E+VN G G+KNP+     +  + D T  K    K  L C TC K+F   RL NRH K HS I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESHL+K+H +   YGYKERR K+F+CE+CGF++T  DD+ QH+S  HP +
Sbjct:   45 KFPTLLPSENSAF---SSLQTGSPPIAKEPQ------------ADPSKLFLVEN---LLPSTN------EKVTRPASASTNVEFVNGGYGVKNPILHNSRITDV-DPTPAKSSDGK--LTCRTCGKKFALQRLLNRHSKCHSGIKRYLCTFCFKGFNDTFDLKRHTRTHTGVRPYKCTLCEKSFTQRCSLESHLRKVHGIQHNYGYKERRSKVFVCEDCGFTATVFDDYVQHLSHVHPFS 257          
BLAST of Protein ovo vs. TrEMBL
Match: A0A0B2VMY1 (Protein ovo OS=Toxocara canis OX=6265 GN=ovo PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 8.518e-56
Identity = 87/160 (54.37%), Postives = 112/160 (70.00%), Query Frame = 3
Query:  549 SIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            ++E+VN G G+KNP+      I +   T         +L C  C K+F   RL NRH K HS+I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C +C KSFTQRCSLESHL+K+H     YGYKERR K+F+CE+CGF+++  D++  H+S SHP +
Sbjct:   25 AVEWVNGGYGVKNPMLQSVRTIDV--DTSPAPSSEPGLLTCRICGKKFALQRLLNRHAKCHSEIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCDQCEKSFTQRCSLESHLRKVHGTHHQYGYKERRSKVFVCEDCGFTASLFDEYVSHLSLSHPFS 182          
BLAST of Protein ovo vs. TrEMBL
Match: A0A1I8CE43 (Uncharacterized protein OS=Rhabditophanes sp. KR3021 OX=114890 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.153e-55
Identity = 90/160 (56.25%), Postives = 113/160 (70.62%), Query Frame = 3
Query:  549 SIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            S+EYVN G G+KNPL         +D+T     R  + + C TC K+FT  RL NRH+K HS++++YLC  C KGFNDTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESHL+K+H     YGYK+RR K+F+CE+CG+S    DD+  H+  +HPL+
Sbjct:  105 SLEYVNGGYGVKNPLLSCSLNPPDVDSTPAPSARSGEFI-CRTCNKKFTLQRLLNRHVKCHSELKRYLCTVCAKGFNDTFDLKRHTRTHTGVRPYKCDHCEKSFTQRCSLESHLRKVHGQSHTYGYKQRRAKVFVCEDCGYSHANYDDYISHLRITHPLS 263          
BLAST of Protein ovo vs. TrEMBL
Match: A0A0K0DXC6 (Uncharacterized protein OS=Strongyloides stercoralis OX=6248 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.565e-55
Identity = 92/167 (55.09%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  534 WISKP--SIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLN 1028
            ++S P  SIEYVN G GIKNPL    N    +D T        + + C TC K+FT  RL NRH+K HS++++YLC +C KGF+DTFDLKRHTRTHTGVRPY C  C KSFTQRCSLESHL+K+H     Y YK+RR K+F+CE+CGF+S+  D++  H+  +HPL+
Sbjct:  103 YVSAPQTSIEYVNGGYGIKNPLLSHYNNPPDVDNTPAPTSSPGEFI-CRTCGKKFTLQRLLNRHVKCHSEVKRYLCTFCGKGFSDTFDLKRHTRTHTGVRPYKCHNCDKSFTQRCSLESHLRKVHGEIHNYAYKQRRSKVFVCEDCGFTSSNYDEYISHLRVTHPLS 268          
BLAST of Protein ovo vs. TrEMBL
Match: F1L8G3 (Protein ovo OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.990e-55
Identity = 93/170 (54.71%), Postives = 116/170 (68.24%), Query Frame = 3
Query:  552 IEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP----LNYLNRKSG 1049
            +E+VN G G+KNP+      + + D T         +L C  C K+F   RL NRH K HS+I++YLC +C KGFNDTFDLKRHTRTHTGVRPY C +C KSFTQRCSLESHL+K+H     YGYKERR K+F+CE+CGF++T  D++  H+S SHP    L  LN  SG
Sbjct:   85 VEWVNGGYGVKNPMLQSVRTVDV-DTTPAPTSE-PGLLTCRICGKKFALQRLLNRHAKCHSEIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCDQCEKSFTQRCSLESHLRKVHGTQHKYGYKERRSKVFVCEDCGFTATVFDEYISHLSLSHPFSPQLIKLNSSSG 252          
BLAST of Protein ovo vs. Ensembl Cavefish
Match: zgc:171929 (putative transcription factor ovo-like protein 3 [Source:NCBI gene;Acc:103025094])

HSP 1 Score: 157.532 bits (397), Expect = 2.721e-45
Identity = 72/147 (48.98%), Postives = 96/147 (65.31%), Query Frame = 3
Query:  582 KNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            ++P       +S     K       D L C  C K F   R+  RH+K HS I+++ C+YC KGFNDTFDLKRH RTHTG+RPY C  C K+FTQRCSLESHL+K+H +   Y Y++RR KIF+CE+CGF+S + D+++ H+   HP
Sbjct:   97 QSPFQPLPLPLSTASRIKTSPPSSNDFL-CPVCHKIFPLQRMLTRHLKCHSLIKRHPCRYCGKGFNDTFDLKRHMRTHTGIRPYRCDLCEKAFTQRCSLESHLRKIHGVRQQYAYRQRRSKIFVCEDCGFTSCRPDEYFLHVRQRHP 242          
BLAST of Protein ovo vs. Ensembl Cavefish
Match: ovol1a (ovo like transcriptional repressor 1 [Source:NCBI gene;Acc:103038355])

HSP 1 Score: 157.147 bits (396), Expect = 1.255e-44
Identity = 67/118 (56.78%), Postives = 86/118 (72.88%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            C  C+K F   R+ NRH+K HS+ +++LC +C KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESH+KK+H +   Y YKERR K+++CEECG ++   D   +H+   HP
Sbjct:  164 CQVCQKVFQFQRMLNRHLKCHSEQKRHLCTFCGKGFNDTFDLKRHVRTHTGVRPYKCNLCEKAFTQRCSLESHMKKIHGVTQQYAYKERRTKLYVCEECGHTAPTQDSLLRHLHTQHP 281          
BLAST of Protein ovo vs. Ensembl Cavefish
Match: ovol1b (putative transcription factor Ovo-like 1 [Source:NCBI gene;Acc:103034073])

HSP 1 Score: 153.295 bits (386), Expect = 1.163e-43
Identity = 63/121 (52.07%), Postives = 88/121 (72.73%), Query Frame = 3
Query:  660 VLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
             L C  C K ++N+RL  RH++SH+  ++Y C++C KGFND+FDLKRH RTHTGVRP+ C  C K+FTQRCSLE+HLKK+H +   Y +KERR+K+++CEECG ++   +    H+   HP
Sbjct:  127 TLSCPVCHKTYSNTRLVKRHLRSHNDSKRYSCEHCGKGFNDSFDLKRHVRTHTGVRPFKCSACDKAFTQRCSLETHLKKIHGVSQQYAFKERRDKLYVCEECGLTAPTQERLLNHLQAKHP 247          
BLAST of Protein ovo vs. Ensembl Cavefish
Match: ENSAMXT00000057905.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:34021632:34036547:1 gene:ENSAMXG00000042325.1 transcript:ENSAMXT00000057905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.405e-16
Identity = 37/99 (37.37%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEEC 965
            C  C K F N+    RH + HS +R + C  C K F+ T +LK+H RTH+G RP+ C +C KSFT   +L+ HL+  ++            K F C+ C
Sbjct:  480 CQECGKSFKNTSCLRRHSQLHSGLRPHACSVCGKSFSQTSNLKQHERTHSGERPFQCMQCHKSFTHSSNLQLHLRTHYS-----------RKDFKCQHC 567          

HSP 2 Score: 73.9442 bits (180), Expect = 6.782e-14
Identity = 38/112 (33.93%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
            C+ C K F  S L + H + H+ +R + C YC   F  +   + H R HTG RPY CQ+C KSF     L  H  +LH+   P+           C  CG S ++  +  QH
Sbjct:  424 CTECGKSFKRSSLLSIHQRVHTGVRAFQCSYCSLTFKWSSHYQYHLRQHTGERPYVCQECGKSFKNTSCLRRH-SQLHSGLRPHA----------CSVCGKSFSQTSNLKQH 524          

HSP 3 Score: 73.9442 bits (180), Expect = 7.031e-14
Identity = 37/115 (32.17%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
             +CS C   F  S  +  H++ H+  R Y+C+ C K F +T  L+RH++ H+G+RP+ C  C KSF+Q  +L+ H ++ H+           E+ F C +C  S T   +   H+
Sbjct:  450 FQCSYCSLTFKWSSHYQYHLRQHTGERPYVCQECGKSFKNTSCLRRHSQLHSGLRPHACSVCGKSFSQTSNLKQH-ERTHS----------GERPFQCMQCHKSFTHSSNLQLHL 553          

HSP 4 Score: 73.559 bits (179), Expect = 1.093e-13
Identity = 30/73 (41.10%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
            C +C K F NS    RH   H  ++ Y+C  C K F+ + +L++H R HTG RPY C +C +SFT   +L  H
Sbjct:  161 CDSCPKAFKNSSSLRRHKNVHLGVKPYVCVVCSKAFSQSTNLRQHMRIHTGERPYVCNECGRSFTHSSNLALH 233          

HSP 5 Score: 70.8626 bits (172), Expect = 7.668e-13
Identity = 38/119 (31.93%), Postives = 56/119 (47.06%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
             +C  C   F  S  +  H++ H+    Y C  C K F ++  L+RH   H GV+PY C  C K+F+Q  +L  H+ ++H    PY          +C ECG S T   +   H  +SH
Sbjct:  131 FQCPYCPLTFKWSSHYQYHLRQHTGECPYPCDSCPKAFKNSSSLRRHKNVHLGVKPYVCVVCSKAFSQSTNLRQHM-RIHTGERPY----------VCNECGRSFTHSSNLALH-RNSH 237          

HSP 6 Score: 65.855 bits (159), Expect = 3.297e-11
Identity = 33/102 (32.35%), Postives = 46/102 (45.10%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFS 974
            CS C K F  S     H++ H+  R Y C  C K F  +  L  H R HTGVR + C  C  +F      + HL+           +   E+ ++C+ECG S
Sbjct:  396 CSECGKSFKGSSGLRYHMRDHTGERPYRCTECGKSFKRSSLLSIHQRVHTGVRAFQCSYCSLTFKWSSHYQYHLR-----------QHTGERPYVCQECGKS 486          

HSP 7 Score: 64.6994 bits (156), Expect = 6.900e-11
Identity = 40/137 (29.20%), Postives = 57/137 (41.61%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP*ILN*C 1076
            +C  C K F  S L   H   H+ +R + C YC   F  +   + H R HTG  PY C  C K+F    SL  H K +H    PY          +C  C  + ++  +  QHM            +G++P + N C
Sbjct:  104 KCDDCGKAFKRSSLLQVHRSVHTGLRTFQCPYCPLTFKWSSHYQYHLRQHTGECPYPCDSCPKAFKNSSSLRRH-KNVHLGVKPY----------VCVVCSKAFSQSTNLRQHM---------RIHTGERPYVCNEC 220          

HSP 8 Score: 62.003 bits (149), Expect = 4.863e-10
Identity = 26/75 (34.67%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            CS C K F+ +    +H ++HS  R + C  C K F  + +L+ H RTH   + + CQ C K F     L+ HL+
Sbjct:  508 CSVCGKSFSQTSNLKQHERTHSGERPFQCMQCHKSFTHSSNLQLHLRTHYSRKDFKCQHCNKEFVMHSYLQRHLR 582          

HSP 9 Score: 60.8474 bits (146), Expect = 1.232e-9
Identity = 27/74 (36.49%), Postives = 37/74 (50.00%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
            +C  C K F  S     H +SH+  R Y C  C K F  +  L  H R+H+G +PY C  C K+F +   L+ H
Sbjct:   48 QCLDCGKSFKWSSRLAHHQRSHNNERPYRCNLCPKAFKGSSALLYHQRSHSGEKPYKCDDCGKAFKRSSLLQVH 121          
BLAST of Protein ovo vs. Ensembl Cavefish
Match: ENSAMXT00000030295.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:34021632:34036547:1 gene:ENSAMXG00000042325.1 transcript:ENSAMXT00000030295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.735e-16
Identity = 37/99 (37.37%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEEC 965
            C  C K F N+    RH + HS +R + C  C K F+ T +LK+H RTH+G RP+ C +C KSFT   +L+ HL+  ++            K F C+ C
Sbjct:  480 CQECGKSFKNTSCLRRHSQLHSGLRPHACSVCGKSFSQTSNLKQHERTHSGERPFQCMQCHKSFTHSSNLQLHLRTHYS-----------RKDFKCQHC 567          

HSP 2 Score: 73.9442 bits (180), Expect = 7.993e-14
Identity = 38/112 (33.93%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
            C+ C K F  S L + H + H+ +R + C YC   F  +   + H R HTG RPY CQ+C KSF     L  H  +LH+   P+           C  CG S ++  +  QH
Sbjct:  424 CTECGKSFKRSSLLSIHQRVHTGVRAFQCSYCSLTFKWSSHYQYHLRQHTGERPYVCQECGKSFKNTSCLRRH-SQLHSGLRPHA----------CSVCGKSFSQTSNLKQH 524          

HSP 3 Score: 73.559 bits (179), Expect = 8.286e-14
Identity = 37/115 (32.17%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
             +CS C   F  S  +  H++ H+  R Y+C+ C K F +T  L+RH++ H+G+RP+ C  C KSF+Q  +L+ H ++ H+           E+ F C +C  S T   +   H+
Sbjct:  450 FQCSYCSLTFKWSSHYQYHLRQHTGERPYVCQECGKSFKNTSCLRRHSQLHSGLRPHACSVCGKSFSQTSNLKQH-ERTHS----------GERPFQCMQCHKSFTHSSNLQLHL 553          

HSP 4 Score: 73.1738 bits (178), Expect = 1.265e-13
Identity = 30/73 (41.10%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
            C +C K F NS    RH   H  ++ Y+C  C K F+ + +L++H R HTG RPY C +C +SFT   +L  H
Sbjct:  161 CDSCPKAFKNSSSLRRHKNVHLGVKPYVCVVCSKAFSQSTNLRQHMRIHTGERPYVCNECGRSFTHSSNLALH 233          

HSP 5 Score: 70.4774 bits (171), Expect = 8.560e-13
Identity = 38/119 (31.93%), Postives = 56/119 (47.06%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
             +C  C   F  S  +  H++ H+    Y C  C K F ++  L+RH   H GV+PY C  C K+F+Q  +L  H+ ++H    PY          +C ECG S T   +   H  +SH
Sbjct:  131 FQCPYCPLTFKWSSHYQYHLRQHTGECPYPCDSCPKAFKNSSSLRRHKNVHLGVKPYVCVVCSKAFSQSTNLRQHM-RIHTGERPY----------VCNECGRSFTHSSNLALH-RNSH 237          

HSP 6 Score: 65.4698 bits (158), Expect = 3.779e-11
Identity = 33/102 (32.35%), Postives = 46/102 (45.10%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFS 974
            CS C K F  S     H++ H+  R Y C  C K F  +  L  H R HTGVR + C  C  +F      + HL+           +   E+ ++C+ECG S
Sbjct:  396 CSECGKSFKGSSGLRYHMRDHTGERPYRCTECGKSFKRSSLLSIHQRVHTGVRAFQCSYCSLTFKWSSHYQYHLR-----------QHTGERPYVCQECGKS 486          

HSP 7 Score: 64.6994 bits (156), Expect = 7.907e-11
Identity = 40/137 (29.20%), Postives = 57/137 (41.61%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP*ILN*C 1076
            +C  C K F  S L   H   H+ +R + C YC   F  +   + H R HTG  PY C  C K+F    SL  H K +H    PY          +C  C  + ++  +  QHM            +G++P + N C
Sbjct:  104 KCDDCGKAFKRSSLLQVHRSVHTGLRTFQCPYCPLTFKWSSHYQYHLRQHTGECPYPCDSCPKAFKNSSSLRRH-KNVHLGVKPY----------VCVVCSKAFSQSTNLRQHM---------RIHTGERPYVCNEC 220          

HSP 8 Score: 62.003 bits (149), Expect = 5.377e-10
Identity = 26/75 (34.67%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            CS C K F+ +    +H ++HS  R + C  C K F  + +L+ H RTH   + + CQ C K F     L+ HL+
Sbjct:  508 CSVCGKSFSQTSNLKQHERTHSGERPFQCMQCHKSFTHSSNLQLHLRTHYSRKDFKCQHCNKEFVMHSYLQRHLR 582          

HSP 9 Score: 60.4622 bits (145), Expect = 1.374e-9
Identity = 27/74 (36.49%), Postives = 37/74 (50.00%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
            +C  C K F  S     H +SH+  R Y C  C K F  +  L  H R+H+G +PY C  C K+F +   L+ H
Sbjct:   48 QCLDCGKSFKWSSRLAHHQRSHNNERPYRCNLCPKAFKGSSALLYHQRSHSGEKPYKCDDCGKAFKRSSLLQVH 121          
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Match: OVOL1 (ovo like transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:8525])

HSP 1 Score: 165.236 bits (417), Expect = 8.712e-51
Identity = 75/132 (56.82%), Postives = 96/132 (72.73%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP 1058
            L C  C K F   R+ NRH+K HS I+K++C +C KGFNDTFDLKRH RTHTGVRPY C+ C K+FTQRCSLESHLKK+H +   Y YKERR K+++CEECGF+++  + F  H+ +SHP +   RK   +P
Sbjct:    7 LSCHLCGKAFHLVRMLNRHMKCHSDIKKHVCNFCGKGFNDTFDLKRHVRTHTGVRPYKCEACSKAFTQRCSLESHLKKIHGVSQRYAYKERRTKLYVCEECGFTASSQEAFVVHLRESHPDSAQLRKVTRRP 138          
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.602e-16
Identity = 42/129 (32.56%), Postives = 62/129 (48.06%), Query Frame = 3
Query:  633 KNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
            K   DR      C  C K F       RHI+ H+  R + C+ C + FN    L+ H   HTG RPY C  C  +F+QR +L +H++++H+   P G     + +F CE+C     K+     H+S  H
Sbjct:  153 KRNIDRSGFSHRCEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGG----EQPVFQCEDCSCVFKKLGSLNAHISRMH 277          

HSP 2 Score: 73.1738 bits (178), Expect = 3.044e-14
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLH 902
            +C  C K F       RH + H+  R Y+C+ C K FN T  L+ H + HTG +PY CQ C  +F+Q+ +++ H+K+ H
Sbjct: 1692 KCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 3 Score: 70.0922 bits (170), Expect = 3.048e-13
Identity = 39/125 (31.20%), Postives = 57/125 (45.60%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSH--------SKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
            C  C K F  +     H+++H         K R Y C +C K F     L+RH R HTG RPY CQ C K+F Q  +L+ H+K           K   EK + C+ C  + ++  +   H+  +H
Sbjct: 1657 CPLCSKSFKRATHLKEHMQTHEPGSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMK-----------KHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 4 Score: 63.1586 bits (152), Expect = 5.141e-11
Identity = 34/98 (34.69%), Postives = 47/98 (47.96%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEE 962
            C  C K F  S    +H++SH+  + + C  C +GF  +  LK H RTHTG + Y C  C  +FT   SL  H+  +H    P+       K   CEE
Sbjct:  957 CGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHM-VMHTSMHPF-------KCPFCEE 1046          

HSP 5 Score: 62.003 bits (149), Expect = 1.091e-10
Identity = 28/74 (37.84%), Postives = 39/74 (52.70%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHL 890
            C  C K F  S    +HI+SH+  + Y C  C + F  +  LK H RTH G++ Y C  C  +FT   SL+ H+
Sbjct:  637 CGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHM 710          

HSP 6 Score: 60.8474 bits (146), Expect = 2.761e-10
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            C  C + F +S +   HI++H  ++ Y C  C   F     LKRH  TH+  RP+ C  C K+F    + + H+K
Sbjct:  665 CGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMK 739          

HSP 7 Score: 59.6918 bits (143), Expect = 6.442e-10
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY 920
            C  C KEF       RHI+ H+  + Y C  C + F     L  H +THTG++ + C  C K F+ + SL+ H+ +LH    P+
Sbjct:  458 CPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHI-RLHTGAKPF 540          

HSP 8 Score: 58.151 bits (139), Expect = 1.744e-9
Identity = 31/101 (30.69%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  732 SKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM---SDSHPL 1025
            S  R Y C YC KGF  +  LK+H R+HTG +P+ C +C + F     L++H++               EK + C+ C  + T      +HM   +  HP 
Sbjct:  950 STRRSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMR-----------THTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPF 1039          

HSP 9 Score: 57.3806 bits (137), Expect = 3.403e-9
Identity = 24/75 (32.00%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHL 890
            +C+ C + F        H K+H+ +++++C  C K F+    LK H R HTG +P+ C  C K F      +SH+
Sbjct:  485 KCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHI 559          

HSP 10 Score: 56.6102 bits (135), Expect = 6.297e-9
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 3
Query:  738 IRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEEC 965
            +R ++C YC K F    DL RH R HT  +PY C +CF++F  + +L +H +K H      G KE     F+C  C
Sbjct:  453 VRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAH-RKTHT-----GLKE-----FMCPLC 517          

HSP 11 Score: 55.8398 bits (133), Expect = 1.066e-8
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  741 RKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            R Y C YC K F  +  LK+H R+HTG +PY C +C +SF     L++H++
Sbjct:  633 RPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIR 683          

HSP 12 Score: 51.6026 bits (122), Expect = 1.918e-7
Identity = 21/77 (27.27%), Postives = 36/77 (46.75%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
             +C+ C + F +S +   H+++H+  + Y C  C   F     L RH   HT + P+ C  C +SF        H++
Sbjct:  983 FKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFRTSLHCRKHMR 1059          

HSP 13 Score: 49.2914 bits (116), Expect = 1.070e-6
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTH 815
            +C  C   FT +    RH+ +HS+ R ++C YC K F  + + K+H +TH
Sbjct:  692 KCVMCDGTFTTNGSLKRHMSTHSETRPFMCPYCQKTFKTSVNCKKHMKTH 741          

HSP 14 Score: 47.7506 bits (112), Expect = 3.319e-6
Identity = 33/119 (27.73%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRK-YLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
            +C  C + F       +H++ H +  K + C  C   FN  ++L  H  TH+ V    C  C ++F++  SL++H+  LH           +E+  +C ECG   T      +HM D H
Sbjct:    3 QCDICNQLFHKHSQLQKHLRQHQENDKPHRCDQCPASFNVEYNLLLHRATHS-VDQTACPDCGRTFSRIASLKAHI-MLH----------EKEENLMCTECGDEFTLQSQLERHM-DMH 108          

HSP 15 Score: 46.595 bits (109), Expect = 7.716e-6
Identity = 20/74 (27.03%), Postives = 36/74 (48.65%), Query Frame = 3
Query:  672 STCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            ++  +  T     + H+K+H+  + + C  C   F+    LK H R HTG +P+ C  C + F      +SH++
Sbjct: 1177 TSLPRSITVKSTLDCHVKTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQ 1250          
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Match: znf366 (zinc finger protein 366 [Source:ZFIN;Acc:ZDB-GENE-110408-46])

HSP 1 Score: 71.2478 bits (173), Expect = 3.787e-14
Identity = 47/199 (23.62%), Postives = 83/199 (41.71%), Query Frame = 3
Query:  432 NIYSRCYGFPTQLSWLMNRPHFWPNTKFLDYGVNWIS-------KPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
             +  R + +P++L    +R       +    GV + S       K ++   + G  +++       +          + R  D   C  C  EF  S    +H+  H  I+++ C  C +GF    ++KRH  THT VR YHC  C K+FTQ+ +L++H+     +  P G+         C  CG    ++ +   H+
Sbjct:  112 GVCGRGFAYPSELRAHQSRHVAGSERRCAACGVAFASAALLRMHKAAVHQQHRGRAVRHHHHHGGGIQHHGQHGAPAEPR--DGFPCGECGMEFVQSHHLKQHMLIHKGIKEHKCSVCGRGFTLQANMKRHQLTHTNVRAYHCHLCHKAFTQKQTLKAHMI----VHSPKGHTR-------CPICGKQFNRLHNLMGHL 297          

HSP 2 Score: 55.8398 bits (133), Expect = 4.822e-9
Identity = 29/85 (34.12%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY 920
            +C  C+K +T+      H+  HS ++ + C  C K F     L  H  TH G RP+ C  C ++FTQ   L+ HL + H+   PY
Sbjct:   26 QCRLCEKSYTSKYNLVTHLLGHSGVKPHACTQCGKLFKQLSHLNTHRLTHAGARPHRCHVCGRAFTQTSHLKRHLMQ-HSAVRPY 109          

HSP 3 Score: 53.5286 bits (127), Expect = 2.469e-8
Identity = 34/118 (28.81%), Postives = 46/118 (38.98%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSH 1019
             C+ C K F      N H  +H+  R + C  C + F  T  LKRH   H+ VRPY+C  C + F     L +H  +           ERR     C  CG +         H +  H
Sbjct:   54 ACTQCGKLFKQLSHLNTHRLTHAGARPHRCHVCGRAFTQTSHLKRHLMQHSAVRPYNCGVCGRGFAYPSELRAHQSR------HVAGSERR-----CAACGVAFASAALLRMHKAAVH 160          

HSP 4 Score: 48.521 bits (114), Expect = 1.163e-6
Identity = 33/133 (24.81%), Postives = 45/133 (33.83%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYK-------------------ERREKIFICEECGFSSTKIDDFWQHM 1007
             C  C + FT +    RH+  HS +R Y C  C +GF    +L+ H   H       C  C  +F     L  H   +H        +                   E R+  F C ECG    +     QHM
Sbjct:   82 RCHVCGRAFTQTSHLKRHLMQHSAVRPYNCGVCGRGFAYPSELRAHQSRHVAGSERRCAACGVAFASAALLRMHKAAVHQQHRGRAVRHHHHHGGGIQHHGQHGAPAEPRDG-FPCGECGMEFVQSHHLKQHM 213          
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003016.1 (pep scaffold:Pmarinus_7.0:GL477497:34499:46557:1 gene:ENSPMAG00000002746.1 transcript:ENSPMAT00000003016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.369e-13
Identity = 34/86 (39.53%), Postives = 45/86 (52.33%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPY 920
             +C +C + FT  R    H ++H+  R Y C  C K F  + DL RHTRTHTG RPY CQ C + F  +  L  HL+       P+
Sbjct:    4 FQCQSCGQTFTQRRYLQIHGRTHTGDRPYACATCGKRFLQSSDLVRHTRTHTGERPYACQHCGRGFRLKHHLRDHLRTHAGARHPH 89          

HSP 2 Score: 50.447 bits (119), Expect = 1.578e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVR-PYHCQKCFKSFT 863
            C+TC K F  S    RH ++H+  R Y C++C +GF     L+ H RTH G R P+   +C  + T
Sbjct:   34 CATCGKRFLQSSDLVRHTRTHTGERPYACQHCGRGFRLKHHLRDHLRTHAGARHPHRLFQCHGAVT 99          

HSP 3 Score: 48.9062 bits (115), Expect = 5.357e-7
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  747 YLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
            + C+ C K F+    L  H R HTG +P+ C +C  +F  +  L  H +K H+           EK+FICEECG   + I    QH
Sbjct:  147 FRCQDCGKEFSQRSHLMGHRRMHTGEKPFACTECGMTFKLKHHLRRH-QKTHSG----------EKLFICEECGIGFSHIGTLAQH 221          
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Match: ZNF436 (zinc finger protein 436 [Source:HGNC Symbol;Acc:HGNC:20814])

HSP 1 Score: 68.1662 bits (165), Expect = 4.837e-13
Identity = 38/136 (27.94%), Postives = 62/136 (45.59%), Query Frame = 3
Query:  606 NLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSD 1013
            N+I  L A   KD        CS C + F + R   +H ++H+  R ++C  C + F     L++H RTHTG RP+ C +C ++FT   +L +H +          +  +R     C +CG    +     +H S 
Sbjct:  218 NVIKHLRADTAKDKNKPHA--CSECGRRFLSVRELAQHARTHTGERPHVCAECGRAFAAVSTLRKHARTHTGERPHVCPQCGRAFTSSSNLRAHAR---------AHAGQRRPQHACTQCGCRFARAGALRKHQSS 342          

HSP 2 Score: 58.151 bits (139), Expect = 9.902e-10
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHS-------KIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C+TC K F++     +H K+H+       K R++ C+ C   F D    +RH  THTG RP+ C+ C K+F+   +L  H +  H+   P+          +CE CG +     +  QH+
Sbjct:   89 CATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKH-QSTHSGDRPH----------VCELCGKAFPHATNLKQHL 197          

HSP 3 Score: 56.6102 bits (135), Expect = 2.509e-9
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  669 CSTCKKEFTNSR--LFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYG 923
            C  C + F  SR     +H ++H+  R Y C  C + F+    L +H R HTG RPY C  C ++F+Q  SL+ H  + H+   P+ 
Sbjct:    3 CPQCGRCFAESRDLRLTKHARTHTGERPYACAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGR-HSAEKPHA 88          

HSP 4 Score: 55.4546 bits (132), Expect = 5.854e-9
Identity = 40/161 (24.84%), Postives = 65/161 (40.37%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERR-------------------------EKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP*ILN*C 1076
            C+ C + F+ +    +H + H+  R Y C  C + F+    L++H   H+  +P+ C  C K+F+ R  L  H +K H   +    KERR                         E+ F+CE CG + +      +H S           SGD+P +   C
Sbjct:   33 CAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKH-EKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQST---------HSGDRPHVCELC 183          

HSP 5 Score: 51.2174 bits (121), Expect = 1.624e-7
Identity = 26/76 (34.21%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKK 896
            C  C   F +++   RH  +H+  R ++C+ C K F+    L++H  TH+G RP+ C+ C K+F    +L+ HLK+
Sbjct:  124 CERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKR 199          

HSP 6 Score: 45.8246 bits (107), Expect = 7.896e-6
Identity = 51/232 (21.98%), Postives = 87/232 (37.50%), Query Frame = 3
Query:  363 CISNQLKFGIETILKKNETI-TYENIYS--RCYGFPTQLSWL--------MNRPHFWPNTKFLDYGVNWISKPSIEYVNNGAGI--KNPLADEKNLISILDATKNKDDRMKDVLE----CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C +    F + + L K+  + T E  Y+   C    +QL+ L          +PH             ++ K    +    AG+  +   A E+   +  D    +  +     E    C  C K F++     +H  +HS  R ++C+ C K F    +LK+H + HTG R      C   F+  C++  HL+            + + K   C ECG     + +  QH 
Sbjct:   33 CAACGRSFSVASSLVKHRRVHTGERPYACAACGRAFSQLTSLQKHQGRHSAEKPHACATCGKAFSHRAFLRKHEKTHAERVAGLVKERRFACERCCATFFDNQSRQRHQTTHTGERPFVCELCGKAFSHHSTLRKHQSTHSGDRPHVCELCGKAFPHATNLKQHLKRHTGERSAAAACCL--FSACCNVIKHLR--------ADTAKDKNKPHACSECGRRFLSVRELAQHA 254          
BLAST of Protein ovo vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 65.855 bits (159), Expect = 4.037e-12
Identity = 39/130 (30.00%), Postives = 63/130 (48.46%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFIC--EECGFSSTKIDDFWQHMSDSH--PLNYLNRK 1043
            EC  C + F+ +     H++SH   + ++C YC K F    +L+ H R HTG +PY C  C K F+++ +L +HL              ++ K F+C  E C  + T++ +   H +  H   LN L  K
Sbjct:  594 ECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL-----------VTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALTAK 712          
BLAST of Protein ovo vs. Ensembl Yeast
Match: YGR067C_mRNA (Putative protein of unknown function; contains a zinc finger motif similar to that of Adr1p [Source:SGD;Acc:S000003299])

HSP 1 Score: 63.1586 bits (152), Expect = 2.766e-11
Identity = 26/64 (40.62%), Postives = 39/64 (60.94%), Query Frame = 3
Query:  741 RKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKE 932
            +KY+C +CLK F+ +    RH R+H GV+P+ CQ C  SF +R  L+ H++ +H  FL   Y  
Sbjct:    6 KKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRTFLLSSYAS 69          
BLAST of Protein ovo vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 60.077 bits (144), Expect = 2.355e-10
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            +C TCK+ F++     +H ++HS  + Y C  C K F  +  LK H RTHTG +P  C+ C K F +  +L  H+K
Sbjct:  769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844          

HSP 2 Score: 59.3066 bits (142), Expect = 3.901e-10
Identity = 34/97 (35.05%), Postives = 47/97 (48.45%), Query Frame = 3
Query:  678 CKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECG 968
            C + F   +   RH+K HSK + Y CK C + F+    L +HTRTH+G +PY C  C K F    SL+ H++               EK   C+ CG
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR-----------THTGEKPLQCKICG 830          

HSP 3 Score: 47.3654 bits (111), Expect = 2.912e-6
Identity = 26/73 (35.62%), Postives = 38/73 (52.05%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLES 884
            +C  C K+F  S     HI++H+  +   CK C K FN++ +L +H +TH   + Y C  C KSF     L S
Sbjct:  797 KCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ--KKYKCSDCSKSFDDLGKLNS 867          
BLAST of Protein ovo vs. Ensembl Yeast
Match: ADR1 (Carbon source-responsive zinc-finger transcription factor; required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization [Source:SGD;Acc:S000002624])

HSP 1 Score: 52.373 bits (124), Expect = 8.296e-8
Identity = 23/56 (41.07%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  735 KIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLH 902
            K+R ++C+ C + F     LKRH R+HT  +PY C  C + FT+R  L  H +K+H
Sbjct:  100 KLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155          
BLAST of Protein ovo vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 49.2914 bits (116), Expect = 5.558e-7
Identity = 27/84 (32.14%), Postives = 37/84 (44.05%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQ---------KCFKSFTQRCSLESHLK 893
            C  C K+FT       H+++H+  R ++C  C K F    D KRH   HTG + Y C           C K F +  +L  H K
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          
BLAST of Protein ovo vs. Ensembl Nematostella
Match: EDO45255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE8])

HSP 1 Score: 145.206 bits (365), Expect = 6.580e-43
Identity = 61/119 (51.26%), Postives = 91/119 (76.47%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            +C  C+  F+  RL NRH+K+HS  ++Y C++C KGFNDTFDLKRH RTHTG++P+ C +C K+FTQRCSLE+HL ++H++   YG++ERR+K+F+CE+CG +     +F +H+ + HP
Sbjct:    9 KCEICQSSFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKDSPEFMKHVHELHP 127          
BLAST of Protein ovo vs. Ensembl Nematostella
Match: EDO45199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE9])

HSP 1 Score: 141.739 bits (356), Expect = 1.040e-41
Identity = 61/120 (50.83%), Postives = 90/120 (75.00%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFS-STKIDDFWQHMSDSHP 1022
            +C  C   F+  RL NRH+K+HS  ++Y C++C KGFNDTFDLKRH RTHTG++P+ C +C K+FTQRCSLE+HL ++H++   YG++ERR+K+F+CE+CG +      ++ QH++  HP
Sbjct:    2 KCGLCNASFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIRTHTGIKPFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKENQAEYRQHVASHHP 121          
BLAST of Protein ovo vs. Ensembl Nematostella
Match: EDO39560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S0])

HSP 1 Score: 74.7146 bits (182), Expect = 2.299e-16
Identity = 46/114 (40.35%), Postives = 60/114 (52.63%), Query Frame = 3
Query:  618 ILDATKNKDDRMK-DVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFIC 956
             L A+  +D R K    +C  C K F  S     HI++H+  R + C+YC K F    +L+ HTR HTG +P+ CQ C KSFTQ  +L SH  + H    PY  K R  K F C
Sbjct:    5 ALAASHEEDRRPKTKRFQCVHCDKSFGKSSHLRDHIRTHTGDRPFRCQYCNKAFTQYSNLRTHTRIHTGEKPFKCQHCSKSFTQAVTLRSHT-RTHTGAKPYNCK-RCSKSFSC 116          

HSP 2 Score: 58.9214 bits (141), Expect = 8.983e-11
Identity = 28/75 (37.33%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESH 887
              C  C K FT       H + H+  + + C++C K F     L+ HTRTHTG +PY+C++C KSF+    L  H
Sbjct:   49 FRCQYCNKAFTQYSNLRTHTRIHTGEKPFKCQHCSKSFTQAVTLRSHTRTHTGAKPYNCKRCSKSFSCFSGLRGH 123          
BLAST of Protein ovo vs. Ensembl Nematostella
Match: EDO48956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI19])

HSP 1 Score: 75.8702 bits (185), Expect = 4.344e-16
Identity = 47/131 (35.88%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  591 LADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTK 983
             A +  L+S +    N+ +      +C TC K FT+     RH   HS  R Y C+ C K F  T DLKRH+R HTG+RPY C  C KSFT   +L  HL+               E+ ++C+ CG + T+
Sbjct:   96 FALQSPLMSHMKTHSNEKN-----FKCETCGKAFTHRNTLARHQLIHSGTRPYKCEECGKTFTQTNDLKRHSRIHTGIRPYKCHVCSKSFTVEFTLVCHLR-----------THTGERPYVCDHCGKTFTQ 210          

HSP 2 Score: 70.0922 bits (170), Expect = 3.872e-14
Identity = 41/114 (35.96%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            +C TC KEFT  +   RH   H+  + Y C  C + F+    L+ H+RTHTG++PY CQ C ++F  +  L SH+K   N           EK F CE CG + T  +   +H 
Sbjct:   32 KCETCGKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAHSRTHTGIKPYKCQICGRAFALQSPLMSHMKTHSN-----------EKNFKCETCGKAFTHRNTLARHQ 134          
BLAST of Protein ovo vs. Ensembl Nematostella
Match: EDO46333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB7])

HSP 1 Score: 76.6406 bits (187), Expect = 1.044e-15
Identity = 37/101 (36.63%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECG 968
            EC  CKK F+ S   N+H++ HS  R Y C YC K F  +  L+ H R H+G +P+ C+ C ++F    + +SH+++ H           +EK  ICE CG
Sbjct:  218 ECHVCKKRFSQSSSLNKHMRVHSGERPYKCTYCDKAFTASSILRTHIRQHSGEKPFKCKHCGRAFASHAAHDSHVRRTHT----------KEKPCICEYCG 308          

HSP 2 Score: 54.6842 bits (130), Expect = 2.031e-8
Identity = 37/120 (30.83%), Postives = 53/120 (44.17%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHI-KSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECG--FSSTKIDDFWQHMSDSH 1019
            C  C + F        H+   H K R + C  C K F+ +  L +H R H+G RPY C  C K+FT    L +H+++              EK F C+ CG  F+S    D   H+  +H
Sbjct:  190 CEQCDRSFDKRDRLRIHVLHVHEKHRPHECHVCKKRFSQSSSLNKHMRVHSGERPYKCTYCDKAFTASSILRTHIRQHSG-----------EKPFKCKHCGRAFASHAAHD--SHVRRTH 296          

HSP 3 Score: 50.447 bits (119), Expect = 4.075e-7
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTR-THTGVRPYHCQKCFKSFTQRCSLESHL 890
            +C+ C K FT S +   HI+ HS  + + CK+C + F        H R THT  +P  C+ C K+F Q   L+ H+
Sbjct:  246 KCTYCDKAFTASSILRTHIRQHSGEKPFKCKHCGRAFASHAAHDSHVRRTHTKEKPCICEYCGKAFAQSYELKFHI 321          
BLAST of Protein ovo vs. Ensembl Medaka
Match: ovol1a (ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 155.606 bits (392), Expect = 1.921e-45
Identity = 68/116 (58.62%), Postives = 86/116 (74.14%), Query Frame = 3
Query:  675 TCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
             C+K F   R+ NRHIK H++ +++LC +C KGFNDTFDLKRH RTHTGVRPY C  C K+FTQRCSLESH+KK+H + L Y YKERR K+++CEECG ++   DD   H+   HP
Sbjct:   45 VCQKTFHYQRMLNRHIKCHNETKRHLCSFCGKGFNDTFDLKRHVRTHTGVRPYKCGLCDKAFTQRCSLESHMKKIHGVTLKYAYKERRNKLYVCEECGHTAGTQDDLALHLHTLHP 160          
BLAST of Protein ovo vs. Ensembl Medaka
Match: zgc:171929 (zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19])

HSP 1 Score: 87.0409 bits (214), Expect = 5.838e-21
Identity = 34/67 (50.75%), Postives = 53/67 (79.10%), Query Frame = 3
Query:  822 VRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            +RPY C+ C K+FTQRCSLESH++K+H +   Y Y++RR KIF+CE+CG++S++ D+++ H+   HP
Sbjct:    1 IRPYKCELCEKAFTQRCSLESHMRKIHGVHQQYAYRQRRSKIFVCEDCGYTSSRPDEYFLHVRQRHP 67          
BLAST of Protein ovo vs. Ensembl Medaka
Match: ENSORLT00000043766.1 (pep primary_assembly:ASM223467v1:2:477676:522067:1 gene:ENSORLG00000024174.1 transcript:ENSORLT00000043766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.298e-16
Identity = 47/121 (38.84%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERR--------EKIFICEECGFSSTKIDDFWQHM 1007
            C  C+K F      NRH+++H+  R + CKYC K   D +DLK H RTHTG  P+ C+ C K F     L +H+ ++H    P+  KE +        EK F C+ECG S ++I D  +HM
Sbjct:  211 CKECEKSFNQISHLNRHMRTHTGERHFSCKYCGKCIRDEYDLKIHMRTHTGEGPFSCKYCDKCFRDVLHLNTHM-RIHTEEKPFSCKECKKYFRFHTGEKQFSCKECGGSFSQISDLKRHM 330          

HSP 2 Score: 70.4774 bits (171), Expect = 8.019e-13
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C  C   F+      RH+++H+  + + C  C KGF+D   LK HTRTHTG +P+ C++C KSF +   L++H+ + H            EK F CEEC  S ++I     HM
Sbjct:  313 CKECGGSFSQISDLKRHMRTHTGEKPFSCIECAKGFSDLSSLKTHTRTHTGEKPFSCKECDKSFNRISHLKTHM-RTHTG----------EKPFSCEECKQSFSQISHLKTHM 414          

HSP 3 Score: 69.3218 bits (168), Expect = 2.024e-12
Identity = 43/131 (32.82%), Postives = 65/131 (49.62%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKE------------------RREKIFICEECGFSSTKIDDFWQHM 1007
            C  CKK F+ S    +H+++H+  + + CK C K F+  F LK H RTHTG +P+ C++C K F+Q   L+SH+ + H    P+   E                    EK F C+EC  S + +    +HM
Sbjct:  480 CKECKKSFSCSSALKKHMRTHTGEKPFSCKECKKCFSQIFHLKTHMRTHTGEKPFSCKECKKCFSQISHLKSHM-RTHTGEKPFSCIECNKSFSRSSSLKTHMRIHTGEKPFSCKECKKSFSDVSALKKHM 609          

HSP 4 Score: 65.855 bits (159), Expect = 2.720e-11
Identity = 43/131 (32.82%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERR------------------EKIFICEECGFSSTKIDDFWQHM 1007
            C  CK+ F+       H+++H+  + + C  C KGF+D   LK+HTRTHTG + + C++C KSF +R SL++H+ + H    P+  KE +                  EK F C+EC    ++I     HM
Sbjct:  397 CEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKHTRTHTGEK-FSCEECNKSFRRRSSLKTHM-RTHTGEKPFSCKECKKSFSCSSALKKHMRTHTGEKPFSCKECKKCFSQIFHLKTHM 525          

HSP 5 Score: 64.3142 bits (155), Expect = 7.465e-11
Identity = 42/131 (32.06%), Postives = 66/131 (50.38%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERR------------------EKIFICEECGFSSTKIDDFWQHM 1007
            C  CKK F+       H+++H+  + + CK C K F+    LK H RTHTG +P+ C +C KSF++  SL++H+ ++H    P+  KE +                  EK F C+EC    ++I +   HM
Sbjct:  508 CKECKKCFSQIFHLKTHMRTHTGEKPFSCKECKKCFSQISHLKSHMRTHTGEKPFSCIECNKSFSRSSSLKTHM-RIHTGEKPFSCKECKKSFSDVSALKKHMRTHTGEKPFSCKECKKCFSQISNLKTHM 637          

HSP 6 Score: 62.7734 bits (151), Expect = 2.444e-10
Identity = 29/75 (38.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            C  C K F+ S     H++ H+  + + CK C K F+D   LK+H RTHTG +P+ C++C K F+Q  +L++H++
Sbjct:  564 CIECNKSFSRSSSLKTHMRIHTGEKPFSCKECKKSFSDVSALKKHMRTHTGEKPFSCKECKKCFSQISNLKTHMR 638          

HSP 7 Score: 61.2326 bits (147), Expect = 6.335e-10
Identity = 37/113 (32.74%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C  C K F        H+++H+  + + CK C K F+ +  LK+H RTHTG +P+ C++C K F+Q   L++H+ + H            EK F C+EC    ++I     HM
Sbjct:  452 CEECNKSFRRRSSLKTHMRTHTGEKPFSCKECKKSFSCSSALKKHMRTHTGEKPFSCKECKKCFSQIFHLKTHM-RTHTG----------EKPFSCKECKKCFSQISHLKSHM 553          

HSP 8 Score: 56.225 bits (134), Expect = 2.650e-8
Identity = 26/57 (45.61%), Postives = 39/57 (68.42%), Query Frame = 3
Query:  723 KSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            ++H++ + Y CK C KGF+   +LKRH RTHTG +P+ C++C KSF Q   L  H++
Sbjct:  173 RTHTENKPYSCKECDKGFSRISNLKRHMRTHTGEKPFSCKECEKSFNQISHLNRHMR 229          

HSP 9 Score: 54.299 bits (129), Expect = 1.254e-7
Identity = 35/113 (30.97%), Postives = 51/113 (45.13%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C  C K F        H+++H+  + + C+ C + F+    LK H RTHTG +P+ C +C K F+   SL+ H +         G K      F CEEC  S  +      HM
Sbjct:  369 CKECDKSFNRISHLKTHMRTHTGEKPFSCEECKQSFSQISHLKTHMRTHTGEKPFSCIECAKGFSDLSSLKKHTR------THTGEK------FSCEECNKSFRRRSSLKTHM 469          
BLAST of Protein ovo vs. Ensembl Medaka
Match: ENSORLT00000044974.1 (ras-responsive element-binding protein 1 [Source:NCBI gene;Acc:101166659])

HSP 1 Score: 81.6481 bits (200), Expect = 2.221e-16
Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            C  C K F N+    RH + HS +R + C  C K F+ T +LK+H RTH+G RP+ C  C KSFT   +L+ HL+
Sbjct:  591 CKECGKSFKNTSCLRRHSQMHSGLRPHTCSICSKSFSQTSNLKQHERTHSGERPFQCTHCTKSFTHSSNLQLHLR 665          

HSP 2 Score: 75.8702 bits (185), Expect = 1.979e-14
Identity = 43/129 (33.33%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDK 1055
            C  C   F  S  +  H++ H+    Y C  C K F ++  L+RH   H G++PY C  C KSFTQ  +L  H+ ++H    PY          IC ECG S T   +   H +    LN   +K G K
Sbjct:   33 CPYCPLTFKWSSHYQYHLRQHTGECPYPCDTCPKAFKNSSSLRRHKNVHLGLKPYTCSVCNKSFTQSTNLRQHM-RIHTGERPY----------ICGECGRSFTHSSNLALHKNSHSSLN-AGQKEGKK 149          

HSP 3 Score: 73.9442 bits (180), Expect = 7.923e-14
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
             +C  C   F  S  +  H++ H+  R Y+CK C K F +T  L+RH++ H+G+RP+ C  C KSF+Q  +L+ H ++ H+           E+ F C  C  S T   +   H+
Sbjct:  561 FQCPHCPLTFKWSSHYQYHLRQHTGERPYVCKECGKSFKNTSCLRRHSQMHSGLRPHTCSICSKSFSQTSNLKQH-ERTHS----------GERPFQCTHCTKSFTHSSNLQLHL 664          

HSP 4 Score: 66.6254 bits (161), Expect = 1.723e-11
Identity = 34/112 (30.36%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
            C+ C K F  S L + H + H+ +R + C +C   F  +   + H R HTG RPY C++C KSF     L  H  ++H+   P+           C  C  S ++  +  QH
Sbjct:  535 CTECGKSFKRSSLLSIHQRVHTGVRAFQCPHCPLTFKWSSHYQYHLRQHTGERPYVCKECGKSFKNTSCLRRH-SQMHSGLRPH----------TCSICSKSFSQTSNLKQH 635          

HSP 5 Score: 62.3882 bits (150), Expect = 3.443e-10
Identity = 25/75 (33.33%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLK 893
            CS C K F+ +    +H ++HS  R + C +C K F  + +L+ H RTH+  + Y C  C K F     L+ H++
Sbjct:  619 CSICSKSFSQTSNLKQHERTHSGERPFQCTHCTKSFTHSSNLQLHLRTHSLRKDYKCPYCSKEFVMHSYLQRHIR 693          

HSP 6 Score: 61.2326 bits (147), Expect = 1.014e-9
Identity = 31/102 (30.39%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFS 974
            C  C K F  S     H++ H+  + Y C  C K F  +  L  H R HTGVR + C  C  +F      + HL+           +   E+ ++C+ECG S
Sbjct:  507 CLECGKAFKGSSGLKYHMRDHTGEKPYRCTECGKSFKRSSLLSIHQRVHTGVRAFQCPHCPLTFKWSSHYQYHLR-----------QHTGERPYVCKECGKS 597          

HSP 7 Score: 48.9062 bits (115), Expect = 8.073e-6
Identity = 21/51 (41.18%), Postives = 29/51 (56.86%), Query Frame = 3
Query:  663 LECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTH 815
             +C+ C K FT+S     H+++HS  + Y C YC K F     L+RH RTH
Sbjct:  645 FQCTHCTKSFTHSSNLQLHLRTHSLRKDYKCPYCSKEFVMHSYLQRHIRTH 695          
BLAST of Protein ovo vs. Ensembl Medaka
Match: prdm14 (PR/SET domain 14 [Source:NCBI gene;Acc:101170233])

HSP 1 Score: 80.1073 bits (196), Expect = 4.459e-16
Identity = 40/113 (35.40%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQH 1004
            +CS C K F+ S   N+H++ HS  R Y C YC K F  +  L+ H R H+G RP+ C+ C K+F    + +SH+++ H           RE+  +CE CG S  K  +   H
Sbjct:  426 KCSVCGKSFSQSSSLNKHMRVHSGERPYKCVYCNKAFTASSILRTHIRQHSGERPFKCKHCGKAFASHAAHDSHVRRTHA----------REQPHLCELCGASFQKEQELRLH 528          

HSP 2 Score: 51.2174 bits (121), Expect = 1.254e-6
Identity = 28/77 (36.36%), Postives = 37/77 (48.05%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTR-THTGVRPYHCQKCFKSFTQRCSLESHLK 893
            +C  C K FT S +   HI+ HS  R + CK+C K F        H R TH   +P+ C+ C  SF +   L  H K
Sbjct:  454 KCVYCNKAFTASSILRTHIRQHSGERPFKCKHCGKAFASHAAHDSHVRRTHAREQPHLCELCGASFQKEQELRLHTK 530          
BLAST of Protein ovo vs. Planmine SMEST
Match: SMESG000016051.1 (SMESG000016051.1)

HSP 1 Score: 501.901 bits (1291), Expect = 0.000e+0
Identity = 240/241 (99.59%), Postives = 241/241 (100.00%), Query Frame = 3
Query:  336 MLPTENKSFCISNQLKFGIETILKKNETITYENIYSRCYGFPTQLSWLMNRPHFWPNTKFLDYGVNWISKPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP 1058
            MLPTENKSFCISNQLKFGIETILKKNETITYENIYSRCYGFPTQLSWLMNRPHFWPNTKFLDYGVNWISKPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVL+CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP
Sbjct:    1 MLPTENKSFCISNQLKFGIETILKKNETITYENIYSRCYGFPTQLSWLMNRPHFWPNTKFLDYGVNWISKPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLQCSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP 241          
BLAST of Protein ovo vs. Planmine SMEST
Match: SMESG000006550.1 (SMESG000006550.1)

HSP 1 Score: 192.2 bits (487), Expect = 4.736e-59
Identity = 116/245 (47.35%), Postives = 141/245 (57.55%), Query Frame = 3
Query:  366 ISNQLKFGIETILK--------KNETITYE-----NIYSRCYGFPTQLSW-LMNRPHFWPNTKFLDYG--VNWISKPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLE----------CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            ++ QLKFGI +IL         KNE   +E     N +         L    MN P   P+   L  G   N I   S   +NNG GI NPL        +L   K  + +    LE          C  C K F  +RL NRH+KSHS +R+YLC YC KGFNDTFDLKRHTRTHTG+RPY C++C K+FTQRCSLESHLKK+HN+ LPYG+KERREK++ICE CGF++  ID    HM D HP
Sbjct:    1 MATQLKFGIHSILHDNLKSPIYKNEGGEFEKQSQHNRFQYLKNIHRDLPIDPMNLP---PSYLQLLQGHLSNNIPLSSNVLINNGTGIINPL--------LLLNPKYSNGKYNTSLELSNNNIKEFRCKICDKTFFGARLLNRHLKSHSSLRRYLCNYCFKGFNDTFDLKRHTRTHTGIRPYKCKQCPKAFTQRCSLESHLKKVHNITLPYGFKERREKLYICELCGFNTPNIDACCSHMKDQHP 234          
BLAST of Protein ovo vs. Planmine SMEST
Match: SMESG000081129.1 (SMESG000081129.1)

HSP 1 Score: 130.954 bits (328), Expect = 8.577e-35
Identity = 70/172 (40.70%), Postives = 96/172 (55.81%), Query Frame = 3
Query:  534 WISKPS-IEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVL--------ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            ++S P+  +  N G GI NP   +          K + D+  D          +C  C K F + +   RHI+SH     +LCKYC K F D++DLKRHTR HTGV+PY CQ C + F+QRCSLESH  K+H + L Y YKERR K++ CE C +S++    +  H+   HP
Sbjct:  169 YLSDPAKFKLTNGGDGIVNPFRKQ---------FKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 331          
BLAST of Protein ovo vs. Planmine SMEST
Match: SMESG000081129.1 (SMESG000081129.1)

HSP 1 Score: 130.954 bits (328), Expect = 1.087e-34
Identity = 70/172 (40.70%), Postives = 96/172 (55.81%), Query Frame = 3
Query:  534 WISKPS-IEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVL--------ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHMSDSHP 1022
            ++S P+  +  N G GI NP   +          K + D+  D          +C  C K F + +   RHI+SH     +LCKYC K F D++DLKRHTR HTGV+PY CQ C + F+QRCSLESH  K+H + L Y YKERR K++ CE C +S++    +  H+   HP
Sbjct:  184 YLSDPAKFKLTNGGDGIVNPFRKQ---------FKEERDKSMDKFCIEVNHNYQCKICNKVFPSKKHMQRHIRSHGVNFDWLCKYCFKPFIDSYDLKRHTRVHTGVQPYKCQSCTRKFSQRCSLESHQVKIHGVALNYLYKERRNKLYPCEICSYSTSCKATWLSHIIQEHP 346          
BLAST of Protein ovo vs. Planmine SMEST
Match: SMESG000058261.1 (SMESG000058261.1)

HSP 1 Score: 72.0182 bits (175), Expect = 9.742e-14
Identity = 45/158 (28.48%), Postives = 71/158 (44.94%), Query Frame = 3
Query:  495 FWPNTKFLDYGVNWISKPSIEYVNNGAGIKNPLADEKNLISILDATKNKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECG 968
            F    +  D  +NW ++  ++       I +P+    N  S L++     +++  V  C  C K F       RH+  H+  R ++CK C KGF     L RH   HT  RP+ C+ C KSF +  +L +H+ ++H  + PY           CE CG
Sbjct:   29 FGSQIRCTDLNMNWQNE-DLDINKTLRKINSPILGFTNKNSYLNSNNEVAEKVAKVFSCPDCGKTFNAHYNLTRHMPVHTGARPFICKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHM-RIHQGYKPYK----------CEICG 174          

HSP 2 Score: 58.9214 bits (141), Expect = 2.043e-9
Identity = 38/113 (33.63%), Postives = 53/113 (46.90%), Query Frame = 3
Query:  669 CSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKERREKIFICEECGFSSTKIDDFWQHM 1007
            C  C K F  +    RH   H+  R ++CK C K FN +  L  H R H G +PY C+ C K F Q+ + ++H K  HN+          EK F C  C  +  +I +   HM
Sbjct:  114 CKVCGKGFRQASTLCRHKIIHTSERPHICKTCNKSFNRSSTLNTHMRIHQGYKPYKCEICGKGFHQKGNYKNH-KLTHNI----------EKQFKCPICTKAFHQIYNLTFHM 215          

HSP 3 Score: 56.9954 bits (136), Expect = 9.298e-9
Identity = 27/79 (34.18%), Postives = 42/79 (53.16%), Query Frame = 3
Query:  666 ECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDTFDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLH 902
            +C  C K F     +  H  +H+  +++ C  C K F+  ++L  H  THT  +PY CQ C K F +   L+ H++KLH
Sbjct:  169 KCEICGKGFHQKGNYKNHKLTHNIEKQFKCPICTKAFHQIYNLTFHMHTHTDKKPYVCQHCSKGFCRNFDLKKHIRKLH 247          
The following BLAST results are available for this feature:
BLAST of Protein ovo vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OVOL11.929e-4854.35ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL17.874e-4854.35ovo like transcriptional repressor 1 [Source:HGNC ... [more]
OVOL22.138e-4550.76ovo like zinc finger 2 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL38.708e-4541.18ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
OVOL32.072e-4452.89ovo like zinc finger 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Protein ovo vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-489.110e-5851.41Putative zinc finger transcription factor [Source... [more]
pag-32.122e-1535.83Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
F47E1.31.423e-1337.18pep chromosome:WBcel235:X:9046213:9054885:1 gene:W... [more]
che-11.155e-1231.30Transcription factor che-1 [Source:UniProtKB/Swis... [more]
Y55F3AM.141.380e-1241.10pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
back to top
BLAST of Protein ovo vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovo4.605e-4558.33gene:FBgn0003028 transcript:FBtr0070739[more]
ovo8.552e-4558.33gene:FBgn0003028 transcript:FBtr0070738[more]
ovo8.552e-4558.33gene:FBgn0003028 transcript:FBtr0301914[more]
ovo2.506e-4358.33gene:FBgn0003028 transcript:FBtr0070740[more]
ovo2.911e-4358.33gene:FBgn0003028 transcript:FBtr0100408[more]
back to top
BLAST of Protein ovo vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol1b1.976e-4746.79ovo-like zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ovol1a4.953e-4653.49ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1719293.002e-2555.41zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19][more]
znf11624.479e-1838.10zinc finger protein 1162 [Source:ZFIN;Acc:ZDB-GENE... [more]
zbtb404.388e-1733.06zinc finger and BTB domain containing 40 [Source:Z... [more]
back to top
BLAST of Protein ovo vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol25.880e-4851.49ovo like zinc finger 2 [Source:NCBI gene;Acc:44847... [more]
ovol21.368e-4751.49ovo like zinc finger 2 [Source:NCBI gene;Acc:44847... [more]
csf3r8.125e-4754.62colony stimulating factor 3 receptor [Source:Xenba... [more]
ENSXETT00000009201.13.397e-2647.62pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ENSXETT00000009194.11.326e-2547.62pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Protein ovo vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ovol14.099e-4854.35ovo like zinc finger 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol26.472e-4651.16ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol21.313e-4551.16ovo like zinc finger 2 [Source:MGI Symbol;Acc:MGI:... [more]
Ovol39.173e-4450.79ovo like zinc finger 3 [Source:MGI Symbol;Acc:MGI:... [more]
Mynn7.769e-1931.41myoneurin [Source:MGI Symbol;Acc:MGI:1931415][more]
back to top
BLAST of Protein ovo vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WTJ2|OVOL1_MOUSE2.867e-4754.35Putative transcription factor Ovo-like 1 OS=Mus mu... [more]
sp|O14753|OVOL1_HUMAN3.781e-4754.35Putative transcription factor Ovo-like 1 OS=Homo s... [more]
sp|A2VDT4|OVOL1_BOVIN7.551e-4754.35Putative transcription factor Ovo-like 1 OS=Bos ta... [more]
sp|Q8CIV7|OVOL2_MOUSE9.182e-4551.16Transcription factor Ovo-like 2 OS=Mus musculus OX... [more]
sp|Q9BRP0|OVOL2_HUMAN1.027e-4450.76Transcription factor Ovo-like 2 OS=Homo sapiens OX... [more]
back to top
BLAST of Protein ovo vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N5AD426.269e-5845.00Uncharacterized protein OS=Syphacia muris OX=45137... [more]
A0A0B2VMY18.518e-5654.38Protein ovo OS=Toxocara canis OX=6265 GN=ovo PE=4 ... [more]
A0A1I8CE431.153e-5556.25Uncharacterized protein OS=Rhabditophanes sp. KR30... [more]
A0A0K0DXC61.565e-5555.09Uncharacterized protein OS=Strongyloides stercoral... [more]
F1L8G31.990e-5554.71Protein ovo OS=Ascaris suum OX=6253 PE=2 SV=1[more]
back to top
BLAST of Protein ovo vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1719292.721e-4548.98putative transcription factor ovo-like protein 3 [... [more]
ovol1a1.255e-4456.78ovo like transcriptional repressor 1 [Source:NCBI ... [more]
ovol1b1.163e-4352.07putative transcription factor Ovo-like 1 [Source:N... [more]
ENSAMXT00000057905.11.405e-1637.37pep primary_assembly:Astyanax_mexicanus-2.0:10:340... [more]
ENSAMXT00000030295.11.735e-1637.37pep primary_assembly:Astyanax_mexicanus-2.0:10:340... [more]
back to top
BLAST of Protein ovo vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OVOL18.712e-5156.82ovo like transcriptional repressor 1 [Source:HGNC ... [more]
ENSPMAT00000005225.12.602e-1632.56pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
znf3663.787e-1423.62zinc finger protein 366 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000003016.11.369e-1339.53pep scaffold:Pmarinus_7.0:GL477497:34499:46557:1 g... [more]
ZNF4364.837e-1327.94zinc finger protein 436 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Protein ovo vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF14.037e-1230.00Zinc-finger transcription factor; involved in diau... [more]
YGR067C_mRNA2.766e-1140.63Putative protein of unknown function; contains a z... [more]
ZAP12.355e-1038.16Zinc-regulated transcription factor; binds to zinc... [more]
ADR18.296e-841.07Carbon source-responsive zinc-finger transcription... [more]
CRZ15.558e-732.14Transcription factor, activates transcription of s... [more]
back to top
BLAST of Protein ovo vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO452556.580e-4351.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451991.040e-4150.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395602.299e-1640.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489564.344e-1635.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463331.044e-1536.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein ovo vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovol1a1.921e-4558.62ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1719295.838e-2150.75zgc:171929 [Source:ZFIN;Acc:ZDB-GENE-070820-19][more]
ENSORLT00000043766.11.298e-1638.84pep primary_assembly:ASM223467v1:2:477676:522067:1... [more]
ENSORLT00000044974.12.221e-1644.00ras-responsive element-binding protein 1 [Source:N... [more]
prdm144.459e-1635.40PR/SET domain 14 [Source:NCBI gene;Acc:101170233][more]
back to top
BLAST of Protein ovo vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016051.10.000e+099.59SMESG000016051.1[more]
SMESG000006550.14.736e-5947.35SMESG000006550.1[more]
SMESG000081129.18.577e-3540.70SMESG000081129.1[more]
SMESG000081129.11.087e-3440.70SMESG000081129.1[more]
SMESG000058261.19.742e-1428.48SMESG000058261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032592 ID=SMED30032592|Name=Protein ovo|organism=Schmidtea mediterranea sexual|type=transcript|length=1101bp
CCTTACTTAAGCTTACTAACAGATCATTGACATAATTTTCTTTTCCAACA
GGTGTGGTCATTTCAATTTTCAATAATTAAGGATTTTCTTGAAAGCATAG
ATTACCTCATCTGTCACAAGAAGATCAAAGTTGCGCCAAGGTCAATAAAA
TACCAAATGGTCAGTTGGAATAAAATTACGTCAGAATAGTTTGATTGATA
CTTAGTAATTATTTTGCGAATTATAAATCATTCTTATTGGCGGAATAGCC
ATCCAATTGAAATCACTAACAAATAAGTATTGAAACAGAAATTCATTTAT
AAATAATATTGATAGATGTCAGAAAAGTCAATCAAATGTTACCAACAGAA
AACAAAAGTTTCTGCATTTCTAATCAATTGAAATTCGGAATTGAAACGAT
TCTTAAGAAAAACGAAACAATAACTTATGAAAACATTTATTCGAGATGCT
ATGGATTTCCAACACAACTTTCTTGGTTAATGAACCGACCTCACTTTTGG
CCCAATACGAAATTTCTCGACTACGGCGTCAATTGGATTTCTAAACCATC
AATAGAATACGTAAATAATGGAGCTGGAATAAAAAATCCATTAGCCGACG
AAAAGAATTTAATTTCAATACTGGATGCTACTAAGAACAAAGACGACCGC
ATGAAAGACGTTTTAGAATGTTCAACATGCAAGAAAGAATTCACAAACAG
TCGCTTATTCAACAGGCATATTAAAAGTCACAGTAAAATACGCAAATATC
TCTGTAAATATTGTCTCAAAGGATTCAATGACACTTTCGATTTGAAAAGG
CACACCAGAACTCATACAGGTGTCCGGCCATATCATTGCCAGAAATGTTT
CAAATCTTTCACTCAGAGATGTTCATTAGAAAGTCATTTGAAAAAACTCC
ACAACATGTTTCTGCCTTACGGTTACAAAGAACGAAGAGAGAAAATATTC
ATTTGTGAAGAATGCGGTTTCAGTTCAACGAAAATTGACGATTTTTGGCA
GCATATGTCCGACAGTCATCCTTTGAACTATTTGAATCGGAAATCTGGTG
ACAAACCTTAAATTTTAAATTGATGTCTGTAAATAAAGTGACTTGATTAA
A
back to top

protein sequence of SMED30032592-orf-1

>SMED30032592-orf-1 ID=SMED30032592-orf-1|Name=SMED30032592-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MLPTENKSFCISNQLKFGIETILKKNETITYENIYSRCYGFPTQLSWLMN
RPHFWPNTKFLDYGVNWISKPSIEYVNNGAGIKNPLADEKNLISILDATK
NKDDRMKDVLECSTCKKEFTNSRLFNRHIKSHSKIRKYLCKYCLKGFNDT
FDLKRHTRTHTGVRPYHCQKCFKSFTQRCSLESHLKKLHNMFLPYGYKER
REKIFICEECGFSSTKIDDFWQHMSDSHPLNYLNRKSGDKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000030midline
PLANA:0000032dorsal midline
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR027756Ovo-like
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 166..189
e-value: 0.17
score: 20.9
coord: 205..228
e-value: 0.028
score: 23.6
coord: 138..160
e-value: 0.043
score: 23.0
coord: 110..132
e-value: 0.0073
score: 25.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 138..160
e-value: 0.0012
score: 19.2
coord: 111..132
e-value: 7.4E-4
score: 19.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 168..189
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 140..160
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 112..132
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 110..137
score: 10.637
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 138..165
score: 14.233
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 166..194
score: 11.739
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 87..160
e-value: 7.8E-12
score: 47.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 161..237
e-value: 9.4E-15
score: 56.5
IPR027756Ovo-likePANTHERPTHR10032ZINC FINGER PROTEIN WITH KRAB AND SCAN DOMAINScoord: 72..239
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 132..184