arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like

Overview
Namearf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like
Smed IDSMED30032591
Length (bp)3812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30032591) t-SNE clustered cells

Violin plots show distribution of expression levels for arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30032591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30032591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30032591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30032591h1SMcG0014156 PL030017B10A08smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30032591h1SMcG0014156 PL05006A2E01smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30032591h1SMcG0014156 Contig49093uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032591h1SMcG0014156 Contig49093newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30032591h1SMcG0014156 dd_Smed_v4_4332_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:HGNC Symbol;Acc:HGNC:16924])

HSP 1 Score: 147.132 bits (370), Expect = 8.937e-35
Identity = 108/363 (29.75%), Postives = 174/363 (47.93%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLEN-----VKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQP-------EIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            KGI  + +++       NKF++ T  ++F F+    E    WI+ +   +  +    +S      +A+V+ E      ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T E+     +W   +    Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N   ++        E    FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  524 KGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQS------QAVVTPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAV----QQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKEGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 866          

HSP 2 Score: 96.6709 bits (239), Expect = 2.363e-19
Identity = 88/364 (24.18%), Postives = 164/364 (45.05%), Query Frame = 3
Query: 1935 ADQSNNLRDFKNAIGQNLSPNFVPSFS---YACIGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDS----NCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            A+ S   R +  AI ++  P F  + +   Y  IG +        + W+   F +D  S+    ++ E +     D   + +++EL  S    N E +    +        I     H + D    H  + KA        D  +L +Q L++N+VP+ V+  I  +  +G   + +++K G       + +    D  S+ L        DV + LK F   ++D LLTK  Y  WI+A+D +D +++ + +   I  LP +N  TL  +I  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD    +   LL ++Y+
Sbjct:  985 AETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQG----DRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHG---HTKLDFTVWHTAIEKA-----AGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1334          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:24097])

HSP 1 Score: 127.872 bits (320), Expect = 6.984e-29
Identity = 94/354 (26.55%), Postives = 161/354 (45.48%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLL----KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM 1475
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +               ++ L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  +I  N +NR CA+C S+  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN+FW      GE       P     FI+ KY    F  RK     +Y D   L + L   V   N+++ M
Sbjct:  306 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLF--RKP--HPQYPDHSQLLQALCAAVARPNLLKNM 633          

HSP 2 Score: 85.8853 bits (211), Expect = 4.223e-16
Identity = 51/189 (26.98%), Postives = 94/189 (49.74%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL 2903
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +K++I  LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  +++
Sbjct:  909 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQV 1095          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:24097])

HSP 1 Score: 127.102 bits (318), Expect = 1.138e-28
Identity = 96/362 (26.52%), Postives = 166/362 (45.86%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLL----KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF---DGEQPEID----YRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM-QLFHIGA 1496
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +               ++ L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  +I  N +NR CA+C S+  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN+FW       +G  P+        FI+ KY    F  RK     +Y D   L + L   V   N+++ M QL  + A
Sbjct:  228 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLF--RKP--HPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEA 563          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:24097])

HSP 1 Score: 127.102 bits (318), Expect = 1.138e-28
Identity = 96/362 (26.52%), Postives = 166/362 (45.86%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLL----KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF---DGEQPEID----YRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM-QLFHIGA 1496
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +               ++ L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  +I  N +NR CA+C S+  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN+FW       +G  P+        FI+ KY    F  RK     +Y D   L + L   V   N+++ M QL  + A
Sbjct:  228 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLF--RKP--HPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEA 563          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:24097])

HSP 1 Score: 125.946 bits (315), Expect = 2.031e-28
Identity = 96/352 (27.27%), Postives = 164/352 (46.59%), Query Frame = 3
Query:  576 SNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLK----ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM-QLFHI----GADMNYVSEPSG-----LNSLETAGKYHQML 1568
            S+KD  NKF++ T  + F F+  S      W + +   + +++ +         +     ++ L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  +I  N +NR CA+C S+  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN+FW      GE       P     FI+ KY    F  RK     +Y D   L + L   V   N+++ M QL  +    G +  +   P G     L S  + G Y++++
Sbjct:    4 SSKD--NKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLF--RKP--HPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGLLPSDPSPGVYNEVV 336          

HSP 2 Score: 86.6557 bits (213), Expect = 2.449e-16
Identity = 51/189 (26.98%), Postives = 94/189 (49.74%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL 2903
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +K++I  LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  +++
Sbjct:  571 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQV 757          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: F23H11.4 (pep chromosome:WBcel235:III:902151:907539:-1 gene:WBGene00017760.1 transcript:F23H11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23H11.4)

HSP 1 Score: 94.3597 bits (233), Expect = 3.141e-19
Identity = 80/284 (28.17%), Postives = 139/284 (48.94%), Query Frame = 3
Query: 2124 GRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLA--SICLISSVIY-HLRGDTKESH-EELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDP---YDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLI---SGSDQMFNAK---NLQILPYLIRNYQDLFDVT-QEELEMEKLYNKER 2933
            G E + +DLRKV  + E  D +    CP   +     SI L    +Y   R D+  SH  E ++A L+    R +T L N  LT +N+P+ V K IR +  +G + EG++R+ G V EA+ I  +L  DP  Y   + +    Y VA  L+ FFRKL+ PL       +         S++    + ++IN   +++  TL+ LI  L N+ ++    + + +NL+  F   L    +  +++F+      + +L +L   Y  +F ++ +EEL  + + + E+
Sbjct:  504 GDELVEVDLRKVMTMRERIDKS--EFCPNARHKRGPFSITLHGVTLYIDSRDDSTTSHWYEAIEALLK----RPATRLENLRLTGDNIPVIVDKCIRFVSAYGMKCEGIYRRNGKVTEAKTILTKLTEDPVGYYPVHENDETVYAVADVLRQFFRKLDAPLFPSSSQADLFDLATESQSDELCARYAQLINTFELVHRSTLKKLIGHLKNVSEHAQENRASVENLAKVFAASLFLTDAMDEKVFSESYNHQINVLIHLTTGYDVVFQISIEEELSRQMVNDAEK 781          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 80.1073 bits (196), Expect = 5.875e-15
Identity = 57/195 (29.23%), Postives = 93/195 (47.69%), Query Frame = 3
Query:  933 RYKLTFESINLCNEWFHQITIIIQKAISATCSRNA---------RPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFW-LANFDGEQ---PEIDY----RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENII 1466
            R++    S+   +EW   I   I+K++    + NA         RP    +  I  N     CA+C +   EWAS+NL I +C +CSG+HR +G +ISK++G+  D+   E+   + + Q IGN+ AN+ W     +GE+   PE       RFI+ KY +K F              + +  +LI  V   +++
Sbjct:  338 RWEFCAGSLEERDEWIQAIGGEIEKSLGKEVA-NAKTNNRAVANRPDIAALRSIPGNGR---CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEH---LAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAF-------LKPIASGEPVTSQLISAVLARDVM 518          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 80.1073 bits (196), Expect = 7.321e-15
Identity = 54/164 (32.93%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  933 RYKLTFESINLCNEWFHQITIIIQKAISATCSRNA---------RPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFW-LANFDGEQ---PEIDY----RFINDKYSRKRF 1373
            R++    S+   +EW   I   I+K++    + NA         RP    +  I  N     CA+C +   EWAS+NL I +C +CSG+HR +G +ISK++G+  D+   E+   + + Q IGN+ AN+ W     +GE+   PE       RFI+ KY +K F
Sbjct:  414 RWEFCAGSLEERDEWIQAIGGEIEKSLGKEVA-NAKTNNRAVANRPDIAALRSIPGNGR---CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEH---LAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAF 570          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 80.1073 bits (196), Expect = 7.759e-15
Identity = 54/164 (32.93%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  933 RYKLTFESINLCNEWFHQITIIIQKAISATCSRNA---------RPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFW-LANFDGEQ---PEIDY----RFINDKYSRKRF 1373
            R++    S+   +EW   I   I+K++    + NA         RP    +  I  N     CA+C +   EWAS+NL I +C +CSG+HR +G +ISK++G+  D+   E+   + + Q IGN+ AN+ W     +GE+   PE       RFI+ KY +K F
Sbjct:  545 RWEFCAGSLEERDEWIQAIGGEIEKSLGKEVA-NAKTNNRAVANRPDIAALRSIPGNGR---CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEH---LAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAF 701          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 80.1073 bits (196), Expect = 8.058e-15
Identity = 54/164 (32.93%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  933 RYKLTFESINLCNEWFHQITIIIQKAISATCSRNA---------RPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFW-LANFDGEQ---PEIDY----RFINDKYSRKRF 1373
            R++    S+   +EW   I   I+K++    + NA         RP    +  I  N     CA+C +   EWAS+NL I +C +CSG+HR +G +ISK++G+  D+   E+   + + Q IGN+ AN+ W     +GE+   PE       RFI+ KY +K F
Sbjct:  575 RWEFCAGSLEERDEWIQAIGGEIEKSLGKEVA-NAKTNNRAVANRPDIAALRSIPGNGR---CADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEH---LAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAF 731          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: RhoGAP15B (gene:FBgn0030808 transcript:FBtr0110990)

HSP 1 Score: 80.1073 bits (196), Expect = 1.107e-14
Identity = 57/196 (29.08%), Postives = 109/196 (55.61%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSD--PYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFN-TCLISGSDQM-FNAKNLQILPYLIRNYQDLFDVTQEELEMEK 2915
            SL +Q LT+ +VP+ V K I  + +HG+  EG++RK GS     ++     +D  +  +T ++   +DVA+ LK F R L + LL KL  ++++   ++  + +K   ++E++ +L  I  +TLR ++  LV I       +M+  NL+  +  T L   SD++ ++ K   +L  L+  Y++LF  + +E++ E+
Sbjct: 1056 SLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAFRADAFNVEITRNEYNEHDVANVLKRFMRDLPERLLGKL-TDSFVFVTELAVASEKIPIYRELLARLSAIERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKKSDELIYSQKEADVLSDLVVLYKNLFPCSADEIKREQ 1250          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: RhoGAP15B (gene:FBgn0030808 transcript:FBtr0290096)

HSP 1 Score: 80.1073 bits (196), Expect = 1.116e-14
Identity = 57/196 (29.08%), Postives = 109/196 (55.61%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSD--PYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFN-TCLISGSDQM-FNAKNLQILPYLIRNYQDLFDVTQEELEMEK 2915
            SL +Q LT+ +VP+ V K I  + +HG+  EG++RK GS     ++     +D  +  +T ++   +DVA+ LK F R L + LL KL  ++++   ++  + +K   ++E++ +L  I  +TLR ++  LV I       +M+  NL+  +  T L   SD++ ++ K   +L  L+  Y++LF  + +E++ E+
Sbjct: 1098 SLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAFRADAFNVEITRNEYNEHDVANVLKRFMRDLPERLLGKL-TDSFVFVTELAVASEKIPIYRELLARLSAIERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKKSDELIYSQKEADVLSDLVVLYKNLFPCSADEIKREQ 1292          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 77.411 bits (189), Expect = 4.621e-14
Identity = 53/176 (30.11%), Postives = 86/176 (48.86%), Query Frame = 3
Query:  915 LITSYRRYKLTFESINLCNEWF----HQITIIIQ-------KAISATCSRNARPGEDIMH--EINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD--------GEQPEIDYR--FINDKYSRKRF 1373
            +I+  + + L  +S ++ + W     H I   IQ       +  S     N+ P +  +H  E  K   N +C +C+S +  WAS+NL ITLC +CSG+HR +G + SK++ +  D   WE+ N +++   +GN   N+ + A            EQ EI  R  +I  KY  +RF
Sbjct:   94 VISPTKSHILQADSADMLSLWISALQHSIGAAIQHDSTHHSRPQSTNAPNNSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD--AWESEN-VKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRF 266          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084368)

HSP 1 Score: 77.0258 bits (188), Expect = 8.356e-14
Identity = 54/185 (29.19%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  888 DGNDSNSLSLITSYRRYKLTFESINLCNEWF----HQITIIIQ-------KAISATCSRNARPGEDIMH--EINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD--------GEQPEIDYR--FINDKYSRKRF 1373
            +G+      +I+  + + L  +S ++ + W     H I   IQ       +  S     N+ P +  +H  E  K   N +C +C+S +  WAS+NL ITLC +CSG+HR +G + SK++ +  D   WE+ N +++   +GN   N+ + A            EQ EI  R  +I  KY  +RF
Sbjct:  315 EGDRRFCFEVISPTKSHILQADSADMLSLWISALQHSIGAAIQHDSTHHSRPQSTNAPNNSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD--AWESEN-VKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRF 496          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 69.707 bits (169), Expect = 1.514e-11
Identity = 37/105 (35.24%), Postives = 59/105 (56.19%), Query Frame = 3
Query: 1080 SNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGE-QP------EIDYRFINDKYSRKRF 1373
             N FC +C + + EWAS+NL + +C +CSG+HR +G +ISK++ +  D+  W + +L  +   IGN+ AN  W +N     +P      E   R++  KY  K F
Sbjct:  481 GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDD--WPSPHL-SVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEF 582          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: arap1a (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1a [Source:ZFIN;Acc:ZDB-GENE-030131-6226])

HSP 1 Score: 149.828 bits (377), Expect = 5.491e-36
Identity = 106/395 (26.84%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVS------LENVKGK-RIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN-YVSEPSGLNSLETAGKYHQMLQLTYLN 1586
            + R+  L S  L  F+  +   SK  + L S+  +  V  V         +F+L +  ++F F+  + +    W++ I K++ D++   E  N       VS      LE +  + +++T+  +  +  + + E++  G+ +  I +R + V RDG +  S +L T YR +    +S +    W   +T  + +++S          + +   + +  +NR CA+C S+  EWASVNL + LC KC+G HR +G NISK++ +  DE  W + +LIR+F ++GN  ANKFW AN    +        E   + I DKY   ++ +  +     +   +ALN  L   +++ +++ T+ L + GAD   Y   P     L  A +Y Q +Q   L 
Sbjct:   74 QRRWVQLDSEYLRYFQSIKEVYSKRMVSLGSVFKVVSVGDV---------RFELHSQSRTFLFRAENTQERDDWVSCIEKILSDRKHSLEPRNLFFKNGSVSVSFEGYLEMLSPRTKVYTLINRDKLFLFKSHEEYFQGMGITDIDMRMANV-RDGENKRSFTLTTPYRAFSFMVDSESEKQRWCESLTECVSRSLSC---------DGVCESVWRVQANRICADCSSSMPEWASVNLCVLLCEKCAGAHRNLGQNISKVRSLKLDERVWTD-DLIRVFLMLGNGKANKFWGANIPPSERLSASANSEQRLKHITDKYKNGKYRKYHKL----FGQQEALNNALCLAMQSADLLETLTLLNCGADAACYTRIPEFPTPLSLAKRYSQTVQAELLT 444          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 130.568 bits (327), Expect = 6.577e-30
Identity = 90/341 (26.39%), Postives = 167/341 (48.97%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIG-----KLIYDKQQIDESDNSHLLK-ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSG 1526
            KG+  + ++  +     NKF++ T  ++F F+  +     KW + +      +L++ + +      SH  K   + L+  K K I+T      I  Y +++ FK GI +  I+ R + + RDG    S  LIT Y+ +  T E+     +W       +Q++I+ T S       ++  +I  N SN+ CA+CK+ + +WAS+NL + +C  C+G HR +G  +SK+Q +  D S W N  ++++F ++GN+ AN+FW A     +       PE    FI+ KY   R+     +    +   + L + L   V  +N+++T+      A+   +++ +G
Sbjct:  477 KGVIPLAAIQMARLAKDNKFEIVTSHRTFVFRADNDVQRSKWCSTLQERVKEQLVFGRPRF--GPGSHCQKSGFLELKGTKSK-IYTAIIMEQIWLYKSEQCFKNGIGITVIEARGATI-RDGK-GKSFDLITPYKTFSFTAETDREKRDWME----ALQESIAETLS-----DYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRGLGTMVSKVQSLKLDTSVWSN-EIVQLFIMLGNDRANEFWAARLPVSEELDCDATPEQRREFISHKYKEGRYRHPHPS----FSSQEELLKALCTAVTEQNLLKTVTQIFAEAEAARLADANG 798          

HSP 2 Score: 89.3521 bits (220), Expect = 2.489e-17
Identity = 64/215 (29.77%), Postives = 104/215 (48.37%), Query Frame = 3
Query: 2259 HLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE 2897
            HL+G T  +   L  A +Q        +L +Q L++N++P+ V   I  +  +G   EG++RK G+    + + ++   D  +  L   D +  DV   LK FFR+++DP+     +  W  A  I    ++ + +KE+I  LP +N  TL  LI  L  + K  D+ QM   NLS  F   L     +      ++I+  LI NY  +FDV +E
Sbjct: 1026 HLQG-TGRTDFSLWYADIQKAAGGKGNTLKDQQLSRNDIPIIVDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMEEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPFWKEAAKIPLKTQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGK--GEHEVKIIEDLIDNYLYIFDVDEE 1237          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: CR387919.1 (zmp:0000000660 [Source:NCBI gene;Acc:559690])

HSP 1 Score: 127.872 bits (320), Expect = 4.550e-29
Identity = 99/386 (25.65%), Postives = 175/386 (45.34%), Query Frame = 3
Query:  453 RYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDES--DNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRF------SERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            R+  L    L  +   +   SK  IPL ++K I  +           NKF++ T +++F F+     +   W+  +   +  +  +      N+      V L  +KG R++             D+DF  G+A+  + L ++ VK+   +   L + T ++ +  T ES +  +EW   I  + +  +   C+       +++ ++  N SNR CA+C++ + EWAS+NL + +C  C+G HR +GP ISK++ +  D S W N  LI +F  +GN N+N  W+AN     PE +    +    R  F        + + + +     + LN+ L   V   ++++TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  437 RWVKLEGGNLTYYNSEKEMYSKGLIPLSAVKQIRALGE---------NKFEVVTTLRTFVFRAEKEGDRQDWLEVLQAAVSSQSSVSHQPRKNNTNKSGYVELRGLKG-RVYLSLMGTCFRLCKTDQDFNAGLAIAVVDLTAACVKQ--FERKGLEITTPFKSFCFTVESEHERDEW---IEAVQESIVETLCNY------EVLEKVWFNKSNRKCADCQAPEPEWASINLCVVICKNCAGQHRFLGPGISKVRSMKLDSSIWTN-ELIELFLEVGNKNSNSLWVANLP---PEDELCKQSSTEQRASFIRRKYKKRKYKKVLNGLNTQEELNKALCAAVVLPDVLQTMALVFSGADVMCATGDPELSTPYLLAQKAGQRLQMEFL 797          

HSP 2 Score: 92.0485 bits (227), Expect = 4.316e-18
Identity = 61/198 (30.81%), Postives = 97/198 (48.99%), Query Frame = 3
Query: 2331 DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-EMEK 2915
            D  +LSNQ + +N+VP+ V   I  +  +G   EG+++K G       +  +   D     L   +    DV   LK F    ED LL K  Y  WI+A+D +D + + + +   I  LP +N  TL  L+  L  I + + + QM+   L+  F++CL     +   A+  Q++  LI NY  LF V  E++ +MEK
Sbjct: 1042 DGMALSNQQMNKNDVPIIVDSCIAFVTQYGLCYEGIYQKKGDPGRVAHLIQEFTKDARVVKLRVQEQRLEDVTDTLKSFLSHSEDALLAKELYPFWISALDEQDEKVRVQKYSSYIQSLPKVNRSTLGALLQHLYRIQRCSHINQMSSQRLACVFSSCLF--QTEGHTAQETQVVEDLINNYIQLFSVNDEQVRQMEK 1237          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: CR387919.1 (zmp:0000000660 [Source:NCBI gene;Acc:559690])

HSP 1 Score: 127.872 bits (320), Expect = 4.550e-29
Identity = 99/386 (25.65%), Postives = 175/386 (45.34%), Query Frame = 3
Query:  453 RYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDES--DNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRF------SERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            R+  L    L  +   +   SK  IPL ++K I  +           NKF++ T +++F F+     +   W+  +   +  +  +      N+      V L  +KG R++             D+DF  G+A+  + L ++ VK+   +   L + T ++ +  T ES +  +EW   I  + +  +   C+       +++ ++  N SNR CA+C++ + EWAS+NL + +C  C+G HR +GP ISK++ +  D S W N  LI +F  +GN N+N  W+AN     PE +    +    R  F        + + + +     + LN+ L   V   ++++TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  437 RWVKLEGGNLTYYNSEKEMYSKGLIPLSAVKQIRALGE---------NKFEVVTTLRTFVFRAEKEGDRQDWLEVLQAAVSSQSSVSHQPRKNNTNKSGYVELRGLKG-RVYLSLMGTCFRLCKTDQDFNAGLAIAVVDLTAACVKQ--FERKGLEITTPFKSFCFTVESEHERDEW---IEAVQESIVETLCNY------EVLEKVWFNKSNRKCADCQAPEPEWASINLCVVICKNCAGQHRFLGPGISKVRSMKLDSSIWTN-ELIELFLEVGNKNSNSLWVANLP---PEDELCKQSSTEQRASFIRRKYKKRKYKKVLNGLNTQEELNKALCAAVVLPDVLQTMALVFSGADVMCATGDPELSTPYLLAQKAGQRLQMEFL 797          

HSP 2 Score: 92.0485 bits (227), Expect = 4.316e-18
Identity = 61/198 (30.81%), Postives = 97/198 (48.99%), Query Frame = 3
Query: 2331 DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-EMEK 2915
            D  +LSNQ + +N+VP+ V   I  +  +G   EG+++K G       +  +   D     L   +    DV   LK F    ED LL K  Y  WI+A+D +D + + + +   I  LP +N  TL  L+  L  I + + + QM+   L+  F++CL     +   A+  Q++  LI NY  LF V  E++ +MEK
Sbjct: 1042 DGMALSNQQMNKNDVPIIVDSCIAFVTQYGLCYEGIYQKKGDPGRVAHLIQEFTKDARVVKLRVQEQRLEDVTDTLKSFLSHSEDALLAKELYPFWISALDEQDEKVRVQKYSSYIQSLPKVNRSTLGALLQHLYRIQRCSHINQMSSQRLACVFSSCLF--QTEGHTAQETQVVEDLINNYIQLFSVNDEQVRQMEK 1237          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: FO704810.1 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:100005008])

HSP 1 Score: 112.464 bits (280), Expect = 1.763e-24
Identity = 88/350 (25.14%), Postives = 160/350 (45.71%), Query Frame = 3
Query:  558 VDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN-YVSEPSGLNSLETAGKYHQMLQLTYL 1583
            V SV   +K +  +F +    K F+F   +      W++ +    YD +   E+  +      +S+++ + K++++     ++  Y + EDF  G+ M  + +  + VK  G      SLIT YR +  + +S    + W   +  +I+ A+S +         ++   +  +  N+ CA+C + + EWASVNL + +C  C+G HR MG + SK++G+  D+  W    LI++F + GN  AN  W  N    +       P+    FI  KY +  +  RK       +  + L++ L E V    +  T+ L   GA ++   S+P   +++  A    Q LQ   L
Sbjct:  240 VASVTNISKQEHGRFSIHLQKKHFEFMAHNAAVQDGWLHSL----YDSRG-REAIAAPKKHGPLSMKD-RRKKVYSAICGHSLWIYSSKEDFNLGLGMMCVSMNIASVKSTGR--YGFSLITPYRTFNFSADSSKEASAWLESLNDVIRNALSYS---------EVALRLWSSPCNKVCADCGAANPEWASVNLLVVICEACAGAHRSMGSSRSKVRGLKLDDKVWTE-PLIQLFVLHGNKTANNVWGHNIPPTEQISPLASPDQRAEFILAKYHKGLY--RKAHPLAASQ--KLLDQRLREVVCGPAVEETVSLLCSGAKVSCSSSDPELKSAIAVAESAGQALQTELL 567          

HSP 2 Score: 78.9518 bits (193), Expect = 2.992e-14
Identity = 49/174 (28.16%), Postives = 85/174 (48.85%), Query Frame = 3
Query: 2367 NNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSD--PYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLF 2882
             +VP  V + I H+ LHG  +EGL+R+ G   +  ++ D L   P   VL   +    DV+ ALK   R+ E  L+ + +  +W  A  +   + + + ++E++ +LP  N  TL  L   L N+ K++   +M   NL+  F   +I   +   N   +Q+   LI N+  +F
Sbjct:  775 GSVPTSVHRCISHITLHGLMVEGLYRRCGIAPQISKLVDTLRVSPKEAVLQTDELSVLDVSGALKQILRQSE--LIPQTHRPHWQNAAALPGEKVRLQTYRELLKQLPPDNIATLSALCAHLNNVQKHSQTNRMTAHNLAVIF--VVIFFQELAMNINMVQMTRELILNHTHIF 944          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: ccn4 (cellular communication network factor 4 [Source:Xenbase;Acc:XB-GENE-484776])

HSP 1 Score: 141.739 bits (356), Expect = 2.935e-33
Identity = 193/811 (23.80%), Postives = 344/811 (42.42%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSGLNSLET----AGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYW-------LSINQNPKEFRIILIWKSCIQ--ILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQETDYSTKPADYXXXX----XXXXXXXXADQSNNLRDFKNAIGQNLSP---NFVPSFSYACIGWVILSTVSE--DWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVL--TNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE 2897
            KG   + ++   NK   +KF++ T  ++F F+    E+   WI+ +  L   K +  E  +  + +    LE +KG   +I+ +     + +  + +D   GIA+  + L    VK    D  S  L T +R + LT ES     EW  +I    Q++I+ T +       ++  +I  N SNR CA+C++   +WAS++L + +C  C+ L+R M                     L R                            FI  KY   RF   K+  F  +   + LN+ L + V  + I++TM L   GAD      P+G     T    A    Q LQ+ +L+     ++ D+++   ++      N     Y G  +       ++IN+  KE   +  W   I+   L     E   +    I L       SE ISLVI    +D+S+                + +  A+   + R++  AI +N +P    ++    +  +G++     S    WK   F ++   +    + + G      D  ++ K++EL +S+  +     +  L        +  H   D    H  + KA        D  +L +Q L++NN+P+ V+  I  +  +G   + L+ K G+  +   + ++   D  S  L        DV   LK FF +++D LLTK  Y  WI+A+DIR+ +++ + +K +I+ +P +N  TL  LI  L  I K  D+  ++   L+ +F++CL   + +  N K + +L  LI NY ++F+V+ +
Sbjct:  414 KGKISLPAITKVNKMGESKFEVVTVQRTFVFRAEKEEDRDDWIDTL--LRTSKSEPYEFPDLCVTEKNGYLE-LKGYKNKIYAVINGSKLWFSKSKQDASAGIAITDLTLTMVSVKII--DRKSFELTTPFRHFCLTAESEREKQEWTEEI----QQSIAETLA-----DYEVAEKIWFNESNRSCADCRAPSPDWASISLGVVICKNCAALNRSM---------------------LQRRL--------------------------FITQKYKEGRF---KKIYFPGFTQEE-LNQALCDAVTKDEILQTMILVFSGADTMC---PTGDKVYNTPYLLAKMSGQRLQMEFLHHN---RLSDFKAPSLNA------NGASLFYCGFLYKASPSTKMTINRKSKE--EMKQWWCTIENNFLKYYENETAPVADGVIDL-------SEIISLVI--HPSDFSSNGMAAFTFEIYFLSERMFLFGAENVESRREWSRAIAKNFTPAVEGYLLELDFNVLGYLNYKNSSSLSQWKKGWFALEKARLHYCNKDDCGN----ADTIQLKKLQELTNSSTLNGEKGNILLLVENGRTFYIHGHTMLDFTVWHSAIEKA-----AGTDGNALQDQQLSKNNIPIIVNSCIAFVTQYGLGSKSLYLKNGNPLQVRELLEEFKKDARSIKLKVGKHQLEDVTDVLKYFFYEIDDALLTKELYPYWISALDIRNEQERVKKYKTVISTVPALNKATLAALIEHLFRIQKCFDINHLDTQTLAKAFSSCLFQTNGE--NEKEVAVLEDLITNYVNIFNVSMD 1125          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 107.071 bits (266), Expect = 1.336e-22
Identity = 71/262 (27.10%), Postives = 129/262 (49.24%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHI------GKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF 1310
            KG+  + S+  +     NKF++ T  ++F F+  +     +W   I       ++++ + ++  S +       + L+  K K IF +     +  + N++ FK GI M  I +    + RD  + N   L+T  + +  T ES     EW   +   I +++S           ++  +I  N SN+ CA+C+      AS+NL + +C +C+G+HR +G NISK+Q +  D S W N  ++++F I+GN+ AN+FW A  
Sbjct:  280 KGVIPLSSIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMVFPRLRLGCSSSCQR-SGYLELKGYKSK-IFAVLTTDELWIHKNEQLFKMGIGMFVIGMHGCTI-RDVRNKN-FELVTMQKIFSFTAESEREKKEWMEALLECISESLS---------DYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSN-EIVQLFIILGNDKANRFWAAKL 521          

HSP 2 Score: 99.3673 bits (246), Expect = 2.827e-20
Identity = 62/207 (29.95%), Postives = 103/207 (49.76%), Query Frame = 3
Query: 2310 LQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYN 2924
            +Q+        L  Q L++N++P+ V   I  L  +G + EG++RK G+    + + D+   D  +  L  SD +  DV   LK FFR+L+DP+ T   +  W  A D  +  K+ E + E+IN LP +N  TL  LI  L  + K  D+ QM   NL+  F   L     +      ++++  +I NY  +F++ +E++    L N
Sbjct:  788 IQAAACSSGNVLREQQLSRNDIPIIVDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAADNPEKSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTDGK--GEHEVKVMEDIIDNYASVFEIDEEQVTQMDLEN 992          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 107.071 bits (266), Expect = 1.424e-22
Identity = 71/262 (27.10%), Postives = 129/262 (49.24%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHI------GKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF 1310
            KG+  + S+  +     NKF++ T  ++F F+  +     +W   I       ++++ + ++  S +       + L+  K K IF +     +  + N++ FK GI M  I +    + RD  + N   L+T  + +  T ES     EW   +   I +++S           ++  +I  N SN+ CA+C+      AS+NL + +C +C+G+HR +G NISK+Q +  D S W N  ++++F I+GN+ AN+FW A  
Sbjct:  347 KGVIPLSSIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMVFPRLRLGCSSSCQR-SGYLELKGYKSK-IFAVLTTDELWIHKNEQLFKMGIGMFVIGMHGCTI-RDVRNKN-FELVTMQKIFSFTAESEREKKEWMEALLECISESLS---------DYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSN-EIVQLFIILGNDKANRFWAAKL 588          

HSP 2 Score: 98.5969 bits (244), Expect = 5.615e-20
Identity = 84/337 (24.93%), Postives = 151/337 (44.81%), Query Frame = 3
Query: 1935 ADQSNNLRDFKNAIGQNLSP---NFVPSFSYACIGWVILSTV--SEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYN 2924
             D +  L+ + +AIG+  +P   + + +  +  +G +    +   + W    F +  C +     +  G +N   D   + +++EL  S  E+     M     I +      +L+G TK          +Q+        L  Q L++N++P+ V   I  L  +G + EG++RK G+    + + D+   D  +  L  SD +  DV   LK FFR+L+DP+ T   +  W  A    +  K+ E + E+IN LP +N  TL  LI  L  + K  D+ QM   NL+  F   L     +      ++++  +I NY  +F++ +E++    L N
Sbjct:  777 TDAAETLQTWTSAIGKWFTPVSCHCLVAHEFQRVGRMRYKAMLNPDHWMEGFFLLKKCHLF----ICPGDQNAAEDSVNLRQLQELSKSRSENTEKKDML----ILVEKGRTLYLQGVTKADFLAW-STDIQAAACSSGNVLREQQLSRNDIPIIVDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAA---EKSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTDGK--GEHEVKVMEDIIDNYASVFEIDEEQVTQMDLEN 1099          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 106.686 bits (265), Expect = 1.754e-22
Identity = 71/262 (27.10%), Postives = 129/262 (49.24%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHI------GKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF 1310
            KG+  + S+  +     NKF++ T  ++F F+  +     +W   I       ++++ + ++  S +       + L+  K K IF +     +  + N++ FK GI M  I +    + RD  + N   L+T  + +  T ES     EW   +   I +++S           ++  +I  N SN+ CA+C+      AS+NL + +C +C+G+HR +G NISK+Q +  D S W N  ++++F I+GN+ AN+FW A  
Sbjct:  299 KGVIPLSSIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMVFPRLRLGCSSSCQR-SGYLELKGYKSK-IFAVLTTDELWIHKNEQLFKMGIGMFVIGMHGCTI-RDVRNKN-FELVTMQKIFSFTAESEREKKEWMEALLECISESLS---------DYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSN-EIVQLFIILGNDKANRFWAAKL 540          

HSP 2 Score: 102.449 bits (254), Expect = 3.224e-21
Identity = 101/429 (23.54%), Postives = 188/429 (43.82%), Query Frame = 3
Query: 1662 KQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQETDYSTKPADYXXXXXXXXXXXXADQSNNLRDFKNAIGQNLSP---NFVPSFSYACIGWVILSTV--SEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEEL-KDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYN 2924
            ++  Y+G +   +N   +  +I+ +  SC  IL   N+  CK  +R   LI+ K   +   +++++     Y  +    +      +     D +  L+ + +AIG+  +P   + + +  +  +G +    +   + W    F +  C +     +  G +N   D   + +++EL K  N E            I +      +L+G TK          +Q+        L  Q L++N++P+ V   I  L  +G + EG++RK G+    + + D+   D  +  L  SD +  DV   LK FFR+L+DP+ T   +  W  A D  +  K+ E + E+IN LP +N  TL  LI  L  + K  D+ QM   NL+  F   L     +      ++++  +I NY  +F++ +E++    L N
Sbjct:  564 REGKYRG-FHPQLNTQEEILKILTV--SCCTILGKCNRR-CKAFYRFTLLIKSKKAITMPANIMLICCFFCYRFRYMFEIYLVTEKVHQFGTDAAETLQTWTSAIGKWFTPVSCHCLVAHEFQRVGRMRYKAMLNPDHWMEGFFLLKKCHLF----ICPGDQNAAEDSVNLRQLQELSKSKNTEK-------KDMLILVEKGRTLYLQGVTKADFLAW-STDIQAAACSSGNVLREQQLSRNDIPIIVDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAADNPEKSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTDGK--GEHEVKVMEDIIDNYASVFEIDEEQVTQMDLEN 974          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 106.301 bits (264), Expect = 2.138e-22
Identity = 71/262 (27.10%), Postives = 129/262 (49.24%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHI------GKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF 1310
            KG+  + S+  +     NKF++ T  ++F F+  +     +W   I       ++++ + ++  S +       + L+  K K IF +     +  + N++ FK GI M  I +    + RD  + N   L+T  + +  T ES     EW   +   I +++S           ++  +I  N SN+ CA+C+      AS+NL + +C +C+G+HR +G NISK+Q +  D S W N  ++++F I+GN+ AN+FW A  
Sbjct:  328 KGVIPLSSIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMVFPRLRLGCSSSCQR-SGYLELKGYKSK-IFAVLTTDELWIHKNEQLFKMGIGMFVIGMHGCTI-RDVRNKN-FELVTMQKIFSFTAESEREKKEWMEALLECISESLS---------DYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSN-EIVQLFIILGNDKANRFWAAKL 569          

HSP 2 Score: 99.7525 bits (247), Expect = 2.309e-20
Identity = 92/376 (24.47%), Postives = 165/376 (43.88%), Query Frame = 3
Query: 1821 KLNESEGISLVIVVQETDYSTKPADYXXXXXXXXXXXXADQSNNLRDFKNAIGQNLSP---NFVPSFSYACIGWVILSTV--SEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEEL-KDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYN 2924
            K++ SE + + +  Q  D    P+      +S       D +  L+ + +AIG+  +P   + + +  +  +G +    +   + W    F +  C +     +  G +N   D   + +++EL K  N E            I +      +L+G TK          +Q+        L  Q L++N++P+ V   I  L  +G + EG++RK G+    + + D+   D  +  L  SD +  DV   LK FFR+L+DP+ T   +  W  A D  +  K+ E + E+IN LP +N  TL  LI  L  + K  D+ QM   NL+  F   L     +      ++++  +I NY  +F++ +E++    L N
Sbjct:  680 KIDPSEVVCMGVTRQ--DVLCSPSPVERYCMSGFHQFGTDAAETLQTWTSAIGKWFTPVSCHCLVAHEFQRVGRMRYKAMLNPDHWMEGFFLLKKCHLF----ICPGDQNAAEDSVNLRQLQELSKSKNTEK-------KDMLILVEKGRTLYLQGVTKADFLAW-STDIQAAACSSGNVLREQQLSRNDIPIIVDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAADNPEKSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTDGK--GEHEVKVMEDIIDNYASVFEIDEEQVTQMDLEN 1039          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:MGI Symbol;Acc:MGI:2684416])

HSP 1 Score: 147.132 bits (370), Expect = 6.849e-35
Identity = 110/363 (30.30%), Postives = 174/363 (47.93%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLEN-----VKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD-GEQPEIDY------RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            KGI  + +++       NKF++ T  ++F F+    E    WI+ +   +       +      L+A V+ E      ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T +S     EW       +Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N    E+ ++D        FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  522 KGIIPLTAISTVRAQGDNKFEIVTTQRTFVFRVEKEEERNDWISILLSALKSPSLASQ------LQAAVAPEKCGYLELRGYKAKIFTVLRGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRAVKQSFEIITPYRSFSFTADSEREKQEWIE----AVQQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLQKDEELQVDSPVEKRKNFITQKYKEGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 864          

HSP 2 Score: 93.5893 bits (231), Expect = 1.288e-18
Identity = 58/208 (27.88%), Postives = 105/208 (50.48%), Query Frame = 3
Query: 2331 DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKD 2948
            D  +L +Q L +N+VP+ V+  I  +  +G   + +++K G       + +    D  S  L        DV   LK F   ++D LLTK  Y  W++A+D +D +++   ++  I  LP +N  TL  LI  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD
Sbjct: 1112 DGNALQDQQLCKNDVPIIVNSCIAFVTQYGLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWVSALDTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMNAHNLAMVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD 1317          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2147274])

HSP 1 Score: 122.479 bits (306), Expect = 1.869e-27
Identity = 92/354 (25.99%), Postives = 162/354 (45.76%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSH----LLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM 1475
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +      H    L    + L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  ++  N +NR CA+C+++  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN FW      GE       P     FI+ KY    F  RK     ++ D   L + L   +   N+++ M
Sbjct:  301 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELRGHKAKVFAALIPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKYKLGLF--RKP--HPRHPDHSQLLQALCAAMAGPNLLKNM 628          

HSP 2 Score: 87.0409 bits (214), Expect = 1.212e-16
Identity = 52/188 (27.66%), Postives = 94/188 (50.00%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEE 2900
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +KE+I+ LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  ++
Sbjct:  905 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQ 1090          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2147274])

HSP 1 Score: 122.479 bits (306), Expect = 2.080e-27
Identity = 92/354 (25.99%), Postives = 162/354 (45.76%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSH----LLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM 1475
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +      H    L    + L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  ++  N +NR CA+C+++  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN FW      GE       P     FI+ KY    F  RK     ++ D   L + L   +   N+++ M
Sbjct:  223 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELRGHKAKVFAALIPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKYKLGLF--RKP--HPRHPDHSQLLQALCAAMAGPNLLKNM 550          

HSP 2 Score: 86.6557 bits (213), Expect = 1.575e-16
Identity = 52/188 (27.66%), Postives = 94/188 (50.00%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEE 2900
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +KE+I+ LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  ++
Sbjct:  827 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQ 1012          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:1916960])

HSP 1 Score: 120.168 bits (300), Expect = 9.350e-27
Identity = 88/369 (23.85%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVS----------LENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN-YVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDP 1646
             KF++ T  ++F F+  S     +W+  + + + + +      ++ +L    S          L   K K ++       +  Y N E+F  GI +  I +    VK    D  S  L T YR +  + +S     +W   +   I +A+S +         ++   I   A NRFCA+C +   +WAS+NL + +C +C+G HR +G  +SK++ +  D   W    LI++F  +GN   N FW AN    +       P      +  KY   ++  R   +F    + + L++ L   V T ++  T  L   GA ++ +  +P+    L  A +  Q LQ+ +L +    ++        DS+ P
Sbjct:  388 QKFEVITNNRTFAFRAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVRGSEQPDRAGSLELRGFKNK-LYVAVTGDKVQLYKNLEEFHLGIGITFIDMNVGNVKE--VDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTS---------EVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKY-RRYHPLFG---NQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPAAPTPLALAEQAGQTLQMEFLRNNQSTEV-----PRLDSVKP 734          

HSP 2 Score: 91.2781 bits (225), Expect = 6.075e-18
Identity = 62/194 (31.96%), Postives = 102/194 (52.58%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEK 2915
            +LS Q L  +++P+ V + + ++   G   EG++RK G   + +R+ D L  D  S  L   + +  DV+SALK F R L D L T+     W+ A +I D E+K   ++E++  LP +N  T++ LI  L  +   +D  QMN  NL+  F   L     Q + A   +++  LI +Y  +F V +EEL  ++
Sbjct:  961 TLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAG--KVVEDLINHYVVVFSVDEEELRKQR 1152          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:1916960])

HSP 1 Score: 120.168 bits (300), Expect = 9.966e-27
Identity = 88/369 (23.85%), Postives = 158/369 (42.82%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVS----------LENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN-YVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDP 1646
             KF++ T  ++F F+  S     +W+  + + + + +      ++ +L    S          L   K K ++       +  Y N E+F  GI +  I +    VK    D  S  L T YR +  + +S     +W   +   I +A+S +         ++   I   A NRFCA+C +   +WAS+NL + +C +C+G HR +G  +SK++ +  D   W    LI++F  +GN   N FW AN    +       P      +  KY   ++  R   +F    + + L++ L   V T ++  T  L   GA ++ +  +P+    L  A +  Q LQ+ +L +    ++        DS+ P
Sbjct:  388 QKFEVITNNRTFAFRAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVRGSEQPDRAGSLELRGFKNK-LYVAVTGDKVQLYKNLEEFHLGIGITFIDMNVGNVKE--VDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTS---------EVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKY-RRYHPLFG---NQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPAAPTPLALAEQAGQTLQMEFLRNNQSTEV-----PRLDSVKP 734          

HSP 2 Score: 91.6633 bits (226), Expect = 5.889e-18
Identity = 62/194 (31.96%), Postives = 102/194 (52.58%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEK 2915
            +LS Q L  +++P+ V + + ++   G   EG++RK G   + +R+ D L  D  S  L   + +  DV+SALK F R L D L T+     W+ A +I D E+K   ++E++  LP +N  T++ LI  L  +   +D  QMN  NL+  F   L     Q + A   +++  LI +Y  +F V +EEL  ++
Sbjct:  961 TLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAG--KVVEDLINHYVVVFSVDEEELRKQR 1152          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8WZ64|ARAP2_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3)

HSP 1 Score: 147.132 bits (370), Expect = 4.292e-34
Identity = 108/363 (29.75%), Postives = 174/363 (47.93%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLEN-----VKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQP-------EIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            KGI  + +++       NKF++ T  ++F F+    E    WI+ +   +  +    +S      +A+V+ E      ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T E+     +W   +    Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N   ++        E    FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  524 KGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQS------QAVVTPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAV----QQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKEGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 866          

HSP 2 Score: 96.6709 bits (239), Expect = 1.135e-18
Identity = 88/364 (24.18%), Postives = 164/364 (45.05%), Query Frame = 3
Query: 1935 ADQSNNLRDFKNAIGQNLSPNFVPSFS---YACIGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDS----NCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            A+ S   R +  AI ++  P F  + +   Y  IG +        + W+   F +D  S+    ++ E +     D   + +++EL  S    N E +    +        I     H + D    H  + KA        D  +L +Q L++N+VP+ V+  I  +  +G   + +++K G       + +    D  S+ L        DV + LK F   ++D LLTK  Y  WI+A+D +D +++ + +   I  LP +N  TL  +I  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD    +   LL ++Y+
Sbjct:  985 AETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQG----DRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHG---HTKLDFTVWHTAIEKA-----AGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1334          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8BZ05|ARAP2_MOUSE (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Arap2 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.979e-33
Identity = 109/363 (30.03%), Postives = 173/363 (47.66%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLEN-----VKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD-GEQPEIDY------RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            KGI  + +++       NKF++ T  ++F F+    E    WI+ +   +       +      L+A V+ E      ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T +S     EW       +Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP   K++ +  D S W N  LI +F +IGN  AN FW  N    E+ ++D        FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  522 KGIIPLTAISTVRAQGDNKFEIVTTQRTFVFRVEKEEERNDWISILLSALKSPSLASQ------LQAAVAPEKCGYLELRGYKAKIFTVLRGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRAVKQSFEIITPYRSFSFTADSEREKQEWIE----AVQQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDCKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLQKDEELQVDSPVEKRKNFITQKYKEGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 864          

HSP 2 Score: 93.9745 bits (232), Expect = 8.493e-18
Identity = 58/208 (27.88%), Postives = 105/208 (50.48%), Query Frame = 3
Query: 2331 DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKD 2948
            D  +L +Q L +N+VP+ V+  I  +  +G   + +++K G       + +    D  S  L        DV   LK F   ++D LLTK  Y  W++A+D +D +++   ++  I  LP +N  TL  LI  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD
Sbjct: 1112 DGNALQDQQLCKNDVPIIVNSCIAFVTQYGLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWVSALDTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMNAHNLAMVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD 1317          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8WWN8|ARAP3_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.354e-28
Identity = 94/354 (26.55%), Postives = 161/354 (45.48%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLL----KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM 1475
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +               ++ L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  +I  N +NR CA+C S+  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN+FW      GE       P     FI+ KY    F  RK     +Y D   L + L   V   N+++ M
Sbjct:  306 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLF--RKP--HPQYPDHSQLLQALCAAVARPNLLKNM 633          

HSP 2 Score: 85.8853 bits (211), Expect = 2.028e-15
Identity = 51/189 (26.98%), Postives = 94/189 (49.74%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL 2903
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +K++I  LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  +++
Sbjct:  909 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQV 1095          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8R5G7|ARAP3_MOUSE (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3)

HSP 1 Score: 122.479 bits (306), Expect = 1.308e-26
Identity = 92/354 (25.99%), Postives = 162/354 (45.76%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSH----LLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGE------QPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTM 1475
            + R+       L+ F   +    K  IPL +++       +  S+KD  NKF++ T  + F F+  S      W + +   + +++ +      H    L    + L   K K    + P   +A Y +++ F  GI +  I+L+   V+     S S  L+T +R +  T ES      W       +Q+A++ T S       ++  ++  N +NR CA+C+++  +WA+VNL + +C +C+G HR +G  ISK+Q +  D S W N  ++++F ++GN+ AN FW      GE       P     FI+ KY    F  RK     ++ D   L + L   +   N+++ M
Sbjct:  301 QRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIE-------MTRSSKD--NKFQVITGQRVFVFRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHPPRPLRTGTLELRGHKAKVFAALIPG-ELALYKSEQAFSLGIGICFIELQGCSVRE--TKSRSFDLLTPHRCFSFTAESGGARQSW----AAALQEAVTETLSDY-----EVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSN-EIVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKYKLGLF--RKP--HPRHPDHSQLLQALCAAMAGPNLLKNM 628          

HSP 2 Score: 87.0409 bits (214), Expect = 8.475e-16
Identity = 52/188 (27.66%), Postives = 94/188 (50.00%), Query Frame = 3
Query: 2343 LSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEE 2900
            L  Q +++ ++P+ V   I  +  HG ++EG++RK G+   + R+  +   D  S  L   + +  DV   LK FFR+L+DP+ +      W  A ++    ++ E +KE+I+ LP +N +TL  LI  L  + K   + QM   NL+  F   +     +      +++L  LI  Y  +FD+  ++
Sbjct:  905 LQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTDGR--GEHEVRVLQELIDGYISVFDIDSDQ 1090          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q96P48|ARAP1_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3)

HSP 1 Score: 122.479 bits (306), Expect = 1.461e-26
Identity = 85/349 (24.36%), Postives = 152/349 (43.55%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLL----------KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN-YVSEPSGLNSLETAGKYHQMLQLTYLN 1586
             KF++ T  ++F F+  S     +W+  + + + +++      +++LL             + L   K K ++       +  Y N E++  GI +  I +    VK    D  S  L T YR +  + +S     +W   +   I +A+S +         ++   I   A NRFCA+C +   +WAS+NL + +C +C+G HR +G  +SK++ +  D   W    LI +F  +GN   N+FW AN    +       P      +  KY   ++  R   +F    + + L++ L   V T ++  T  L   GA +N +  +P     L  A +  Q LQ+ +L 
Sbjct:  386 QKFEVITNNRTFAFRAESDVERKEWMQALQQAMAEQRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNK-LYVAVVGDKVQLYKNLEEYHLGIGITFIDMSVGNVKE--VDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTS---------EVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTE-TLIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKY-RRYHPLFG---NQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLR 717          

HSP 2 Score: 91.2781 bits (225), Expect = 4.836e-17
Identity = 61/194 (31.44%), Postives = 103/194 (53.09%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEK 2915
            +LS Q L  +++P+ V + + ++   G   EG++RK G   + +R+ + L  D  S  L   + +  DV+SALK F R L D L T+     W+ A +I D E+K   ++E++ +LP +N  T++ LI  L  +   +D  QMN  NL+  F   L     Q + A   +++  LI +Y  +F V +EEL  ++
Sbjct:  959 TLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAG--RVVEDLINHYVVVFSVDEEELRKQR 1150          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A3L8SUZ2 (Uncharacterized protein (Fragment) OS=Chloebia gouldiae OX=44316 GN=DV515_00002877 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.848e-55
Identity = 222/860 (25.81%), Postives = 381/860 (44.30%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIG---KLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGEQPEID------YRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDP-------DNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIR-EKLNESEGI-----SLVIVVQETDYSTKPADYXXXXXXXXXXXX----ADQSNNLRDFKNAIGQNLSPNFVPS-FSYAC--IGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVR-------DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            KGI  + ++        NKF++ T  ++F F+    E    W+N +    KL+ D      S  +      + L+  K K IF +    T+    N++DFK G  +  I +  + VK+ D     S  +IT Y+ +  T ES     +W   +    Q++I+ T S       ++  +I  N SNR CA+CK+   +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F IIGN  AN FW  N    E+  ID        FI  KY   +F   ++T F  YK  + LN+ L   V  ++++ T+ L   GAD M    +P        A K  Q LQ+ +L          + +   D  + DP       +++  + +  ++   ++ N  +       K      DC NK  C +    +     +K     G+      + +VV ++D+     D     + ++        A+ +++ R + +AI ++  P    S     C  IG +        + W+   F I+  S+    E+ +  E+  I LR   +++EL  S+        M N   I ++  V    +G T   H      F+  WY         D  +L +Q L++N+VP+ V+  I  +  +G   + ++ K G       + +    D  S  L        DV   LK F  +++D LLTK  Y  WI+A+D ++ +++   ++  I  LP +N  TL  LI  L  + K +++ QMNP NL+  F++CL     Q   ++ + ++  LI+NY  LF + +++++   + N    K KD    +   LL ++Y+
Sbjct:  207 KGIILLSAIATVRVHGENKFEVVTSHRTFVFRVDKEEERNDWVNTMLNALKLLSDNNSQSRSSVTPEKSGYLELKGYKTK-IFILLQGSTVWICKNEQDFKTGFGITLIPMNVANVKQVDRAAKQSFEIITPYKSFSFTAESEKEKQDWIEAL----QQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPGPDWASINLCVVICKKCAGQHRSLGPRDSKVRSLKMDASIWSN-ELIELFIIIGNKRANSFWAGNLPPDEELHIDDPAEKRIAFITQKYKEGKF---RKTPF-HYKTKEQLNKALCAAVVKQDVLETLMLLFSGADAMCATGDPVYSTPYLLAKKAGQRLQMEFL----------YHNKFSDFPNYDPCFESGFSEDSSHSTFLCEFLYKVSSNAAKLPTEKKLKE-----DC-NKRWCTLESGFLSYYENDKTTTPNGMIDVNEVICLVVHKSDFFINRGDIFTFEMYLLSERVFLFGAETAHSQRKWTSAIAKHFVPPVAESLLERDCDLIGQLYYKDCHNLDQWRKGWFAIEKSSLYFCLEMEDAEED-SIYLR---RLQELTTSSV-------MQNGERIDVLLLV---EKGRTLYIHGHTKLDFM-VWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKQIYLKNGDSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQIDDALLTKELYPFWISALDTQNEKERVRKYRAFIRSLPPVNRATLAALIEHLYRVQKCSEINQMNPQNLAVVFSSCLFQTKGQ--TSEEVNVIEDLIKNYVQLFHINEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1018          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A093QCG1 (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_07220 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.885e-54
Identity = 218/853 (25.56%), Postives = 375/853 (43.96%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIG---KLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGEQPEIDY------RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIR-EKLNESEGI-----SLVIVVQETDYSTKPADYXX----XXXXXXXXXXADQSNNLRDFKNAIGQNLSPNFVPSF---SYACIGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVR-------DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            KGI  + ++        NKF++ T  ++F F+    E    W+N +    KL+ D      +  +      + L+  K K IF +    T+    N++DFK G  +  I +  + VK+ D     S  +IT Y+ +  T ES     +W       +Q++I+ T S       ++  +I  N SNR CA+CK+   +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N   GE+  +D        FI  KY   +F  RK      YK  + LN+ L   V  ++++ T+ L   GAD M    +P        A K  Q LQ+ +L         ++ +        D   +  + +  ++   ++ N  +   +L  K   +  DC NK  C +    +     +K     G+      + +VVQ+TD+ +   D            +    A+ + + R +  AI ++  P    S     +  IG +        + W+   F I+  S+    E+    E+  I LR   +++EL  S+        M N   I ++  V    +G T   H      F+  WY         D  +L +Q L++N+VP+ V+  I  +  +G   + ++ K G       + +    D  S  L        DV   LK F  +++D LLTK  Y  WI+A+D ++ +++   +   I+ LP +N  TL  LI  L  + K +++  MNP NL+  F++CL     Q   ++ + ++  LI+NY  +F + +++++   + N    K KD    +   LL ++Y+
Sbjct:  496 KGIILLSAIATVRVHGENKFEVVTSHRTFVFRVDKEEERNDWVNTMLNALKLLSDNNSQSRTSVAPEKSGYLELKGYKAK-IFIVLQGSTVWICKNEQDFKTGFGITLIPMNVANVKQVDRAAKQSFEIITPYKSFSFTAESEREKQDWIE----ALQQSIAETLS-----DYEVAEKIWFNESNRSCADCKTPSPDWASINLCVVICKKCAGQHRSLGPRDSKVRSLKMDASIWSN-ELIELFIVIGNKRANSFWAGNLPPGEELHMDAPAEKRIAFITQKYKEGKF--RKAPFL--YKTKEQLNKALCAAVVKQDVLETLMLLFSGADAMCATGDPVYSTPYLLAKKAGQRLQMEFLYHNKFSDFPNYDTCFESGFSED---SSHSTFLCEFLYKVSSNAAK---LLTEKKLKE--DC-NKRWCTLESGFLSYYENDKTTTPNGMIDINEVICLVVQKTDFFSNRGDIFTFEIYLMSERVFQFGAETAYSQRKWTWAIAKHFVPPVAESLLERDFDLIGQLYYKDRHNLDQWRKGWFAIEKSSLYFCLEMANAEED-SIYLR---RLQELTTSSV-------MQNGEKIDVLLLV---EKGRTLYIHGHTKLDFM-VWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKQIYLKSGDSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQIDDALLTKELYPFWISALDTQNEKERVRKYGAFIHSLPPVNRATLAALIEHLYRVQKCSEINHMNPHNLAMVFSSCLFQTKGQ--TSEEVNVIEDLIKNYVQIFHINEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1307          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: H0ZFT5 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 OS=Taeniopygia guttata OX=59729 GN=ARAP2 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.097e-54
Identity = 221/860 (25.70%), Postives = 380/860 (44.19%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIG---KLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGEQPEID------YRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDP-------DNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIR-EKLNESEGI-----SLVIVVQETDYSTKPADYXXXXXXXXXXXX----ADQSNNLRDFKNAIGQNLSPNFVPS-FSYAC--IGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVR-------DSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            KGI  + ++        +KF++ T  ++F F+    E    W+N +    KL+ D      S  +      + L+  K K IF +    T+    N++DFK G  +  I +  + VK+ D     S  +IT Y+ +  T ES     +W   +    Q++I+ T S       ++  +I  N SNR CA+CK+   +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F IIGN  AN FW  N    E+  ID        FI  KY   +F   ++T F  YK  + LN+ L   V  ++++ T+ L   GAD M    +P        A K  Q LQ+ +L          + +   D  + DP       +++  + +  ++   ++ N  +       K      DC NK  C +    +     +K     G+      + +VV ++D+     D     + ++        A+ + + R + +AI ++  P    S     C  IG +        + W+   F I+  S+    E+ +  E+  I LR   +++EL  S+        M N   I ++  V    +G T   H      F+  WY         D  +L +Q L++N+VP+ V+  I  +  +G   + ++ K G       + +    D  S  L        DV   LK F  +++D LLTK  Y  WI+A+D ++ +++   ++  I  LP +N  TL  LI  L  + K +++ QMNP NL+  F++CL     Q   ++ + ++  LI+NY  LF + +++++   + N    K KD    +   LL ++Y+
Sbjct:   64 KGIILLSAIATVRVHGESKFEVVTSHRTFVFRADKEEERNDWVNTMLNALKLLPDNNSQSRSSVTPEKSGYLELKGYKTK-IFILLQGSTVWICKNEQDFKTGFGITLIPMNVANVKQMDRAAKQSFEIITPYKSFSFTAESEKEKQDWIEAL----QQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPGPDWASINLCVVICKKCAGQHRSLGPRDSKVRSLKMDASIWSN-ELIELFIIIGNKRANSFWAGNLPPDEELHIDDPAEKRIAFITQKYKEGKF---RKTPF-HYKTKEQLNKALCAAVVKQDVLETLMLLFSGADAMCATGDPVYSTPYLLAKKAGQRLQMEFL----------YHNKFSDFPNYDPCFESGFSEDSSHSTFLCEFLYKVSSNAAKLPTEKKLKE-----DC-NKRWCTLESGFLSYYENDKTTTPNGMIDINEVICLVVHKSDFFLNRGDIFTFEMHLLSERVFLFGAETAQSQRKWTSAIAKHFVPPVAESLLERDCDLIGQLYYKDCHNLDQWRKGWFAIEKSSLYFCLEMEDAEED-SIYLR---RLQELTTSSV-------MQNGERIDVLLLV---EKGRTLYIHGHTKLDFM-VWYTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKQIYLKNGDSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKSFLSQIDDALLTKELYPFWISALDTQNEKERVRKYRAFIRSLPPVNRATLAALIEHLYRVQKCSEINQMNPQNLAVVFSSCLFQTKGQ--TSEEVNVIEDLIKNYVQLFHINEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 875          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: H0UZX6 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 OS=Cavia porcellus OX=10141 GN=ARAP2 PE=4 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 1.380e-53
Identity = 223/852 (26.17%), Postives = 376/852 (44.13%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD-GEQPEIDY------RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL--NSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLS-INQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIRE---------KLNESEGISLVIVVQETDYSTKPADYXXXXXXXXXX--XXADQSNNLRDFKNAIGQNLSPNFVPSFS---YACIGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIY---HLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            KGI  + +V+       NKF++ T  ++F F+    E    WI+ +   +       +S  +   +    LE ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T ES     +W       +Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N    E+ ++D        FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L  N        D  SD             Q P Q  +    + Q P     +    S  +IL+ +NK+ C +L        E          +N SE I L I  ++   +T P    E  +    +    A+ S   R +   I ++  P    + +   Y  IG +        + WK   F ID  S+     + E +E    D   + +++EL  S    V   +  ++  +      +Y   H + D    H  + KA        D  +L +Q L++N+VP+ V+  I  +  +G   + +++K G       + +    D  S+ L        DV   LK F   ++D LLTK  Y  W++A+D +D +++ + +   I  LP +N  TL  +I  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD    +   LL ++Y+
Sbjct:  517 KGIIPLSAVSTVRVQGDNKFEVVTTQRTFVFRAEKEEERNDWISILSNALKLHSLTSQSQVAVAPEKCGYLE-LRGYKAKIFTVLKGSSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQDWIE----AVQQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLQKDEELQMDSPVEKRKNFIIQKYREGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSDT---------GLSQEPAQATFLCDFLYQVPASASKV---SSEKKILEETNKKWC-VLEGGFLSYYENDKSTTPNGTINISEVICLAIHKEDFYLNTGPVFIFEIYLPSERVFLFGAETSQAQRKWTETIAKHFVPFVAENLTEADYDLIGQLFYKDCHALDQWKKGWFAIDKSSLRFCLHMQEAQE----DRMHLRRLQELTTSTV--VQNGEKLDVLFLVEKGRTLYIHGHTKLDFTVWHTAIEKA-----AGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLENFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWVSALDTQDEKERIKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1327          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A0P6J175 (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Heterocephalus glaber OX=10181 GN=ARAP2 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.965e-53
Identity = 222/853 (26.03%), Postives = 375/853 (43.96%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKG--KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKR-DGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLAN-FDGEQPEIDY------RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL--NSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLS-INQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIRE---------KLNESEGISLVIVVQETDYSTKPADYXXXXXXXXXX--XXADQSNNLRDFKNAIGQNLSPNFVPSFS---YACIGWVILSTVS--EDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDS----NCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEIS-LLRQIYI 2990
            KGI  + +V+       NKF++ T  ++F F+    E    WI+ +   +  +    +S  +   +    LE ++G   +IFT+    ++    N++DFK G+ +  I +  + VK+ D     S  +IT YR +  T ES     +W       +Q++I+ T S       ++  +I  N SNR CA+CK+ D +WAS+NL + +C KC+G HR +GP  SK++ +  D S W N  LI +F +IGN  AN FW  N    E+ ++D        FI  KY   +F  RK  +    K+   LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L  N        D  SD             Q P Q  +    + Q P     +    S  ++L+ +NK+ C IL        E          +N SE I L I  ++   +T P    E  +    +    A+ S   R +   I ++  P    + +   Y  IG +        + W+   F +D  S+    ++ E +E    D   + +++EL  S    N E +    +        I     H + D    H  + KA        D  +L +Q L++N+VP+ V+  I  +  +G     +++K G       + +    D  S+ L        DV   LK F   ++D LLTK  Y  W++A+D +D +++ + +   I  LP +N  TL  +I  L  + K +++  MN  NL+  F++CL     Q   ++ + ++  LI NY ++F+V +++++   + N    K KD    +   LL ++Y+
Sbjct:  517 KGIIPLSAVSTVRVQGDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTPQSQVAVAPEKCGYLE-LRGYKAKIFTVLKGSSLWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQDWIE----AVQQSIAETLS-----DYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSN-ELIELFIVIGNKRANDFWAGNLLKDEELQMDSPVEKRKNFITQKYREGKF--RKTLLASLTKEE--LNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSDT---------RLSQEPAQATFLYDFLYQAPASASKV---SSEKKLLEETNKKWC-ILEGGFLSYYENDKSTTPNGTINISEVICLAIHKEDFYLNTGPVFIFEIYLPSERVFLFGAETSQAQRKWTETIAKHFVPFVAENLTETDYDLIGQLFYKDCHALDQWRKGWFALDKSSLHFCLQMQEAQE----DRMHLRRLQELTTSTMIQNGEKLDVLFLVEKGRTLYIHG---HSKLDFTVWHTAIEKA-----AGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGYRYIYQKSGDPLHISELLENFKKDARSFKLRAGKHQLEDVTGVLKRFLSDIDDALLTKELYPYWVSALDTQDEKERIKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQ--TSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYV 1327          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103028333])

HSP 1 Score: 139.813 bits (351), Expect = 7.429e-33
Identity = 104/395 (26.33%), Postives = 186/395 (47.09%), Query Frame = 3
Query:  447 KSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKL-------IYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQP-------EIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNY-VSEPSGLNSLETAGKYHQMLQLTYLN 1586
            + R+  L ++ L  F+  +   SK  IP  S+ G+        +N  D  KF++ T  + F F+  S     +W++ +  +       + ++  ++   NS + K  + L  ++ K ++T+     +  Y N E++K GI +  I +    VK    D  +  L T YR +    E+  L ++W   +   I +A+S           ++  +I     N+ CA+C +   EWA++NL +  C +C+G HR +GP+ISK++ +  D+  W N  LI++F+++GN  AN+FW AN    +        E   RFI  KY   ++  R   +F   K+   +N  L   V++ ++  T+ L   GAD+N     P   + +  A  Y Q LQ+ +L 
Sbjct:  501 QRRWVKLDADYLRYFDNEKEVYSKRVIPTSSITGV--------ANVGD-QKFEVVTHNRIFLFRAESDSERNEWVSVLQDMTGPVRARVSNELTLNPMVNSEM-KGYLELRGLRSK-LYTVVCGDKVFLYKNIEEYKMGIGITSIDMNVGNVKE--MDRRAFDLTTPYRIFSFIAETDQLKDQWVEAMRNSIAEALS---------NYEVAEKIWAEPDNQKCADCGAPKPEWAAINLCVVFCKRCAGEHRSLGPSISKVRSLKMDKKVWTN-ELIQLFRVLGNERANQFWAANVPPSEALSVCSSSEERRRFITAKYREGKY-RRYHPLFGNQKE---INNALCINVQSNDVCETLALVFCGADVNCDTGLPDSPSPIALAVNYGQALQVEFLT 868          

HSP 2 Score: 87.8113 bits (216), Expect = 6.745e-17
Identity = 52/193 (26.94%), Postives = 104/193 (53.89%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEME 2912
            +L  Q LT+ ++P+ V + I ++  +G   EG++RK G   +   + +    +  S  L  ++    DV++ LK FFR +E+ L  + + +NW+    + D  K+  +++ + N LP +N  TLR L+  L  + + +++ QMN  NL+  F   L     + +NA   +++  LI++Y  +F V +++L+ +
Sbjct: 1106 TLRQQQLTEADIPVIVERCIHYITQYGLTSEGIYRKSGVNSKIAALLEAFRRNARSVWLKEAEQQVDDVSNVLKRFFRDIEEGLFGQ-HAQNWLTTTAVSDESKRISHYQLLFNNLPRVNKATLRTLVNHLYCVQRFSEMNQMNLHNLAIVFGPTLFQTDGKDYNAG--RVVEDLIQHYIAIFHVNEQQLKRQ 1295          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 131.339 bits (329), Expect = 3.452e-30
Identity = 91/339 (26.84%), Postives = 163/339 (48.08%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDE---SDNSHLLK-ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSG 1526
            KG+  + ++  +     NKF++ T  ++F F+  +     KW + + + + ++           SH  K   + L+  K K I+       I  Y N++ F  GI +  I+ R + + RDG  S S  LIT Y+ +  T ES     EW       +Q++I+ T S       ++  +I  N SN+ CA+CK+ + +WAS+NL + +C  C+G HR +G  +SK+Q +  D S W N  ++++F ++GN+ AN+FW A     +       PE    FI  KY   R+     +    +   + L + L   V  +N+++T+      A+   +++ +G
Sbjct:  518 KGVIPLAAIQMARVAKDNKFEVVTSHRTFVFRADNEVQRNKWCSVLQERVKEQMVFGRPRFGPGSHCQKSGFLELKGTKSK-IYAAIITEQIWLYKNEQCFNTGIGISVIEARGATI-RDGK-SKSFDLITPYKTFSFTAESDRDKREWME----ALQESIAETLS-----DYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRSLGTMVSKVQSLKLDTSVWSN-EIVQLFIMLGNDRANEFWAARLPVAEELDCDASPEQRREFIVQKYREGRYRHPHPS----FSTQEELLKALCTAVTEQNLLKTVTQIFAEAEAARLADSNG 839          

HSP 2 Score: 87.4261 bits (215), Expect = 8.718e-17
Identity = 64/223 (28.70%), Postives = 109/223 (48.88%), Query Frame = 3
Query: 2259 HLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE---ELEME 2912
            HL+G  +     L  A +Q      + +L +Q L++N++P+ V   I  +  +G   EG++RK G+    + + D+   D  +  L   D +  DV   LK FFR+++DP+     +  W  A    +  ++ + +KE+I  LP +N  TL  LI  L  + K  D+ QM   NLS  F   L     +      ++I+  LI NY  +FD+ +E   ++E+E
Sbjct: 1066 HLQGMGRMDFS-LWYADIQKAAGGKANTLKDQQLSRNDIPIIVDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPYWKDAAKTSNKMQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGK--GEHEVKIVEDLIDNYLYVFDIDEEHKTQIELE 1285          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 131.339 bits (329), Expect = 3.481e-30
Identity = 91/339 (26.84%), Postives = 163/339 (48.08%), Query Frame = 3
Query:  543 KGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDE---SDNSHLLK-ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSG 1526
            KG+  + ++  +     NKF++ T  ++F F+  +     KW + + + + ++           SH  K   + L+  K K I+       I  Y N++ F  GI +  I+ R + + RDG  S S  LIT Y+ +  T ES     EW       +Q++I+ T S       ++  +I  N SN+ CA+CK+ + +WAS+NL + +C  C+G HR +G  +SK+Q +  D S W N  ++++F ++GN+ AN+FW A     +       PE    FI  KY   R+     +    +   + L + L   V  +N+++T+      A+   +++ +G
Sbjct:  413 KGVIPLAAIQMARVAKDNKFEVVTSHRTFVFRADNEVQRNKWCSVLQERVKEQMVFGRPRFGPGSHCQKSGFLELKGTKSK-IYAAIITEQIWLYKNEQCFNTGIGISVIEARGATI-RDGK-SKSFDLITPYKTFSFTAESDRDKREWME----ALQESIAETLS-----DYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRSLGTMVSKVQSLKLDTSVWSN-EIVQLFIMLGNDRANEFWAARLPVAEELDCDASPEQRREFIVQKYREGRYRHPHPS----FSTQEELLKALCTAVTEQNLLKTVTQIFAEAEAARLADSNG 734          

HSP 2 Score: 87.4261 bits (215), Expect = 8.344e-17
Identity = 64/223 (28.70%), Postives = 109/223 (48.88%), Query Frame = 3
Query: 2259 HLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE---ELEME 2912
            HL+G  +     L  A +Q      + +L +Q L++N++P+ V   I  +  +G   EG++RK G+    + + D+   D  +  L   D +  DV   LK FFR+++DP+     +  W  A    +  ++ + +KE+I  LP +N  TL  LI  L  + K  D+ QM   NLS  F   L     +      ++I+  LI NY  +FD+ +E   ++E+E
Sbjct:  961 HLQGMGRMDFS-LWYADIQKAAGGKANTLKDQQLSRNDIPIIVDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPYWKDAAKTSNKMQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGK--GEHEVKIVEDLIDNYLYVFDIDEEHKTQIELE 1180          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000019510.2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:NCBI gene;Acc:103040621])

HSP 1 Score: 122.865 bits (307), Expect = 1.215e-27
Identity = 102/387 (26.36%), Postives = 166/387 (42.89%), Query Frame = 3
Query:  453 RYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLK--ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD-------GEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            R+       L  +   +   SK  +PL ++K +  V           NK ++ T  ++F F+         W+  +   +  +  I    + H       V L   KGK   ++     +     D+DF  G+A+  + L ++ VK    D  S  + T +R +  T ES     EW       +Q++I  T S       ++  ++  N SNR CA+C++ + EWAS+NL + +C  C+G HR +G  IS+++ +  D S W N  L+ +F  +GN NANKFW  N         G  PE    F    + RK    +   +     + + LN+ L   V   +++ TM L   GAD M    +P        A K  Q LQ+ +L
Sbjct:  442 RWVKFDGENLTYYNNDKEMYSKGLVPLSAVKQVRSVGE---------NKLEVVTSQRTFVFRAEKEGERQDWLEVLQSALKSRSSISHKPSKHSSSKSGYVELRGHKGKVYLSLT-GTKVRLCKTDQDFNTGMAIAVVDLTAACVKH--VDRRSFEINTPFRSFCFTAESEREREEWIE----AVQESIVETLSNY-----EVAEKVWFNQSNRNCADCRAPNPEWASINLGVVICKLCAGQHRFLGSGISQVRSLKLDSSIWTN-ELVELFLEVGNENANKFWAFNLPLEEELHMGATPEQRATF----HRRKYRERKYRRVLGGLHNQEGLNQALCAAVLQSDVLVTMALVFSGADVMCATGDPEHSTPYLLAQKGGQRLQMEFL 802          

HSP 2 Score: 98.9821 bits (245), Expect = 2.496e-20
Identity = 73/253 (28.85%), Postives = 121/253 (47.83%), Query Frame = 3
Query: 2244 SSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNK--ERMKIKDFPPLEISLLRQIYI 2990
            S    ++ G TK+    L  + +Q    RD  +LSNQ L++N+VP+ V   I  +  +G   +G+++K G  K + ++ +    D  +  L   D    DV   LK F  + ED LL K  Y  WI+A+D  + E + E +   I  LP IN  TL  L+  L  +   + + QM   +L+  F++CL     +       +++  LI NY  LF V +E++   +  N+   R K   F P    L+ ++Y+
Sbjct: 1019 SGRTIYIHGVTKQDFA-LWHSAIQLAAGRDGRALSNQQLSKNDVPIIVDSCIAFVTQYGLCYQGIYQKNGDPKRSAQLLEDFTRDARNVKLRVQDHRLEDVTDTLKHFLSQCEDALLAKELYPYWISALDEENEEDRIEKYSTYIQSLPKINRSTLAALLQHLYRVQSCSHINQMKAQSLACVFSSCLF--QTEGHTTPETRVVEDLISNYIQLFSVNEEQVRQMERENRFITRWKDTTFSPAG-DLIFEVYL 1267          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000000841.2 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:103047121])

HSP 1 Score: 112.464 bits (280), Expect = 1.451e-24
Identity = 76/259 (29.34%), Postives = 126/259 (48.65%), Query Frame = 3
Query:  813 YDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF--------DGEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQ 1562
            Y++ EDF  G+ M  + +  + VK+ G   +  SLIT Y+ +  + +S      W +Q+  +I+ A+S  CS       ++   +  +  N+ CA+C S++ EWAS+NL + +C  C+G+HR +G + SK++ +  D   W    LI++F I GN  +N  W  N         D  Q E D  FI  KY    + +    I ++      LN+ L E V   ++  T+ L   GA  +     PS ++  E AG+  Q
Sbjct:  297 YNSKEDFNLGLGMTLVSMNVASVKQTGR--HGFSLITPYKSFNFSADSSKDQTTWLNQLNEVIRSALS--CS-------EVALRLWASPWNKVCADCGSSNPEWASINLLVVICEACAGVHRSIGTSRSKVRSLKLDSKIWTE-PLIKLFIIYGNKASNNVWGHNVPAAEQILPDAGQEERDA-FIKAKYCSGLYRKTHPLISNQ----TLLNQRLCEVVCGVDVEETLCLLCSGAKVLTDPQSPSAISIAENAGQALQ 538          

HSP 2 Score: 58.151 bits (139), Expect = 5.692e-8
Identity = 46/184 (25.00%), Postives = 83/184 (45.11%), Query Frame = 3
Query: 2367 NNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNS--DPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEME 2912
             +VP  + + I H+ L+G ++EGL+R+ G+  +  ++   L S P   VL     D  DVA   K   R++ D L+      +W  A        + + ++ +++KL   N  TL  L   L  +  ++ V +M   NL+  F   L    +   N   +++   LI ++  +F    E +E E
Sbjct:  762 GSVPPELERCISHITLYGLKVEGLYRRCGTGTKINQLVKDLHSAPAETVLGTGELDIVDVAGTFKQLLRQM-DELIPTPQRPDWAKAAAAALETDRLQQYRRLVSKLDPDNRATLAALCGHLYIVQLHSQVNRMTAHNLAVVFVPTLF--QELAMNTDMVRLTKELIIHHTLVFLSHPEAVEDE 942          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000232.1 (pep scaffold:Pmarinus_7.0:GL480628:15362:26221:1 gene:ENSPMAG00000000209.1 transcript:ENSPMAT00000000232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 2.322e-24
Identity = 82/358 (22.91%), Postives = 157/358 (43.85%), Query Frame = 3
Query:  387 DRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALV--------------SLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQ 1418
            D+    GP   + QK       RY    SN   ++ K    +S VQ  L    G    D+          KF++ T  ++F F+  S      W++ + + +  ++  +    S L  A V              +LE     +++ +     +  + +++DF+  + +  I++  + V+    +   + L T+++ +    E+    +EW   +   I  ++S           D+  +I  N  NR CA+C +   +WASVNL + +C +C+G HR +G  +SK++ +  D++ W   NLI +FQ +GN   NKFW A+    +       ++     +R   R+E +F KY++ +
Sbjct:    7 DKQAPQGPY--LFQKRWVKSDGRYLYYYSNDKEMYSKGVLPLSAVQEVLTQTGG----DA----------KFEVVTQTRAFVFRADSEAERAGWVSALREAVQAQRSPEGGVASMLHSAGVIPGEALWGEQEKRGTLELRGKAKLYVVGCSDRLWLFKSEQDFRTSLGITCIEMNVANVR--AVEKKGIDLTTAFKTFSFMAENERERDEWLETMRDSIATSLSHL---------DVAKQIWANEHNRRCADCGAAWPDWASVNLCVVICKRCAGEHRNLGQTVSKVRSLKMDKNIWTK-NLIELFQELGNAQVNKFWAASVPPSEA------VDPSSEAER---RREYVFAKYREGR 327          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007633.1 (pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-1 gene:ENSPMAG00000006898.1 transcript:ENSPMAT00000007633.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 3.594e-23
Identity = 65/191 (34.03%), Postives = 95/191 (49.74%), Query Frame = 3
Query: 1050 DIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKETIFDKYK------------DSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSG-LNSLETAGKYHQMLQLTYL 1583
            DI   I    +NR CA+C +    WAS+NL + +C  C+G HR +GPNISK++ +  D+  W + +LI +F  IGN   N+FW AN    + EID   + +        ER+E +  KY+            D   LNR L   V T +++ +M L + GAD+      S   + L  A +  Q LQL  L
Sbjct:  209 DIADRIWALPANRLCADCGAAKPAWASINLCVVICKLCAGQHRALGPNISKVRSLKMDKKIWTD-DLIELFVQIGNERVNEFWAANVPPSE-EIDPASMPN--------ERREFVVAKYRSGKYRRYHEFFGDQAELNRALCSAVVTSDVLESMALVYCGADVTGAPGCSPDDDPLLLAEQAGQKLQLQML 389          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003939.1 (pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 gene:ENSPMAG00000003551.1 transcript:ENSPMAT00000003939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 5.750e-18
Identity = 47/149 (31.54%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 2370 NVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSD 2816
            +VP  + K++ ++++HG   EG++RK G+  + + +  QL +D NS  L +   + + S LK + R+L  PL+T   Y+ ++ AV + + ++K +    II +LP +NY TL  +IF LV I +  D  +M+ + L+  F  C++   D
Sbjct: 1128 SVPFLLEKLLNYIEIHGLYTEGIYRKSGANTKVKELRQQLDNDVNSVNLDDYQVHVIGSVLKQWLRELPVPLMTLDLYDEFLRAVGVPEKKEKIKAVYSIIGQLPSVNYSTLERIIFHLVRIAQYEDTNRMSCNALAIVFAPCILRPPD 1276          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: GIT2 (GIT ArfGAP 2 [Source:HGNC Symbol;Acc:HGNC:4273])

HSP 1 Score: 72.7886 bits (177), Expect = 1.875e-13
Identity = 52/179 (29.05%), Postives = 80/179 (44.69%), Query Frame = 3
Query: 1092 CAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF-DGEQPEIDYR--------------FINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            C  C  +D  WAS+N  + +C +C  +HR +G +IS ++ +    S W   +LI++ Q + +N AN  W  +  D  Q +   R              FI  KY    F  R     D    +  L+R+L   V+T N+  +++L  +GA  NY +   G   L  A K  Q LQ   L
Sbjct:   10 CKGCTISDPGWASINRGVLVCDECCSVHRSLGRHISLVKHL--RHSQWPT-SLIQMVQTLVSNGANSIWEHSLLDPAQIQSGKRKANPHDKVHPTKAEFIKAKYQMLSFVHRMPCREDDNIMATDLSRQLHSSVRTGNLETSLRLLSLGAQANYFNPDKGNTPLHVAAKAGQTLQAELL 185          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000404.1 (pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1 gene:ENSPMAG00000000361.1 transcript:ENSPMAT00000000404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 4.309e-13
Identity = 56/188 (29.79%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 2367 NNVPLPVSKMIRHLQLH-----GTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSE----KKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNY-QDLFDVTQEE 2900
              VPL V  M++ L+ H     G + EGLFR  GSV+  ER+     +D  S     +D   VA  LKLF R+L D ++      +++ A   RDS     +  E  + ++ +LP  N+  LR L   LV + ++ +V  M+P NL T F       S  M      Q++  +   +  D   + QE+
Sbjct:   18 RTVPLVVETMVQFLEEHVSVHTGLESEGLFRVSGSVRAVERLRQAWEADVTSDGRGQADVSSVAGLLKLFLRELPDGVVPASLLPSFLQA--HRDSAGDEMRLAESLRLLLAQLPGENHALLRYLCSFLVRVAQHQEVNLMSPQNLGTVFGPNFFRVSPGMEGIAEQQVVNRVTARFITDFLSIFQED 203          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 65.4698 bits (158), Expect = 1.154e-11
Identity = 36/116 (31.03%), Postives = 63/116 (54.31%), Query Frame = 3
Query: 1041 PGEDIMHEINKNASNRFCAECKST-DIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERK 1385
            P +  +  + ++  N  CA+CK+     WAS +L + +C KC+G+HR +G +ISK++ +  D  TW+  +L+++ Q   N  AN ++ A       E+  R I D  S + F + K
Sbjct:    6 PVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSV--DLDTWKEEHLVKLIQFKNNLRANSYYEATLAD---ELKQRKITDTSSLQNFIKNK 116          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 60.077 bits (144), Expect = 1.245e-9
Identity = 45/148 (30.41%), Postives = 74/148 (50.00%), Query Frame = 3
Query: 1053 IMHEINKNASNRFCAECKST-DIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQ---------IIGNNNANKFWLANFDGEQPEIDY-RFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENI 1463
            I+ +I+K  SN  C +C ST  +EW S+NL   LC KCSG+HR +G +ISKI+ +  D  T  +  L+ + Q          I  +N   F +        + +  +FI DKY  K+F      + D  +  +A  + LI+ +  +++
Sbjct:  175 IVRKIDK--SNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFT--SLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKF------VIDSNQGREASLKSLIKAIHLDSV 312          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 58.151 bits (139), Expect = 5.332e-9
Identity = 30/92 (32.61%), Postives = 52/92 (56.52%), Query Frame = 3
Query: 1047 EDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ 1322
            + +  ++  N  NR C +C + +  W SV   + LC +CS +HR MG +I+ ++    D+ T  N   +R F++ GN+ A  F+L N +G+Q
Sbjct:   16 QQVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWTINN---LRRFKLGGNHKARDFFLKN-NGKQ 103          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 56.225 bits (134), Expect = 2.343e-8
Identity = 49/190 (25.79%), Postives = 82/190 (43.16%), Query Frame = 3
Query: 2364 QNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVL-------TNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEME 2912
            Q+ VP  V + I  +   G   EG++RK  +V +  ++ +++  DP +  +       ++SD Y V S LK FF  L D +L K         + I D   +  +   +I  LP   Y TLR L+F L  +  +    +MN   L   +   +   +    N  N QI+   +     L +V+ +  E E
Sbjct:  482 QDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDANDVNFQIMAMEV-----LLEVSDQAFEPE 666          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 56.225 bits (134), Expect = 3.146e-8
Identity = 58/189 (30.69%), Postives = 87/189 (46.03%), Query Frame = 3
Query: 2418 GTQIEGLFRKVGS---VKEAERIYDQ---LISD---PNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAV--------------DIRDSEKKFEYFK-------EIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLI---SGSDQMFNAKNLQ-ILPYLIRNYQDLF 2882
            G  +EGL+RK GS   V+E E  + Q   L SD   P    L N D + VAS LK + RKL DP+L+   Y+  I  V                 DS +K   ++       EI   LPV + + L++L   +  + + ++   MN  NLS  F   LI    G   + + K    I+ +++ NY+D+F
Sbjct:  818 GLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIHDFDGEKDIVDMKERNYIVEFILGNYRDIF 1006          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO34673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK8])

HSP 1 Score: 117.857 bits (294), Expect = 1.795e-26
Identity = 78/255 (30.59%), Postives = 127/255 (49.80%), Query Frame = 3
Query:  771 KRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTD-IEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANK---FWLANFDGEQPEID----YRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYV 1511
            KR +      +I YYD  +DF++   +H I+ + + VK+D N  N  ++ITS + +    E+    + W   +   IQ  +S            ++  +  N SNR CA+C + D    ASVN  + +C  C G HR +G NISK + +  D+  W N +L  +   IGN NANK   F + + D  +P+ D      FI  KY  K++S+    I  +Y +   L + L E V+T++++RT +L     ++ YV
Sbjct:  894 KRRYVAIKGGSICYYDTYDDFQFETPIHSIEAQLASVKQDPNHRNRFNIITSQKTFSFQVENDFEVSSWIEAVQRAIQIGLSDPA---------VLEYVFTNPSNRKCADCGNKDPYPHASVNHLVCICGNCCGSHRSLGSNISKPRSLLMDKKIW-NDDLKELMVKIGNENANKLLEFKIPDDDRIRPDADSAKRREFICAKYEYKKYSK----ILPEYGNVDVLGQALRESVQTDDVMRTFELIINRVNVKYV 1134          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 77.411 bits (189), Expect = 2.519e-14
Identity = 46/148 (31.08%), Postives = 83/148 (56.08%), Query Frame = 3
Query: 1065 INKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERK--ETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADM 1502
            I K   N++CA+C +   +WAS+NL IT+C +CSG+HR MG ++SK++ +  D+  W +G+ +   + +GN   NK + AN + + P++     + K+ R+ F + K  E  F     ++ L+ E+ E + T    R  +L  I  ++
Sbjct:  515 IRKVEGNKYCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDK--W-DGDTVEFMEAMGNTKVNKIFEANLN-DFPKLTRD--SGKHDRQAFIKLKYVEQKFYSPIPAEGLDPEVAEALITRPGDREDELLDISQEL 656          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO34178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ28])

HSP 1 Score: 75.0998 bits (183), Expect = 1.573e-13
Identity = 46/159 (28.93%), Postives = 83/159 (52.20%), Query Frame = 3
Query: 1053 IMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDE-STWENGNLIRIFQIIGNNNANKFWLANFDGEQ-PEIDYR------FINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMN 1505
            I+ ++ +   N  CA+C S D  W S NL +  C +CSG+HR MG ++S++Q I  D   T E    + + + IGN   N+   A  D +Q P  + +      FI+ KY + +++++        +  + + +EL + VK+ +I+  +Q F  G D++
Sbjct:  417 IVKQVQRLPGNDTCADCTSKDPTWLSTNLGVLTCIECSGVHRGMGVHVSRVQSITLDNIGTAE----LLLAKAIGNGGFNEIMEATLDIDQKPTANSKMDEKKEFIHAKYIKHQYAQK------SGESPEKVLQELHQAVKSRDILAVLQGFGEGVDLS 565          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO37809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL6])

HSP 1 Score: 72.7886 bits (177), Expect = 5.021e-13
Identity = 37/119 (31.09%), Postives = 63/119 (52.94%), Query Frame = 3
Query: 1041 PGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDY--------RFINDKYSRKRF 1373
            P + I+  +     N  CA+C   D +WAS+NL + LC +CSG+HR +G ++SK++ +  D   WE  +L ++   +GN+  N  + A   G+  +I++         +I  KY   RF
Sbjct:  403 PPKSILEAVRSVPGNEVCADCNHNDPKWASINLGVVLCIECSGIHRSLGVHVSKVRSLTLD--AWEPEHL-KLMSELGNSLINSIYEAKIAGDHKKINHLSNRSDREAWIKSKYIYHRF 518          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 66.6254 bits (161), Expect = 5.590e-13
Identity = 37/114 (32.46%), Postives = 62/114 (54.39%), Query Frame = 3
Query: 1047 EDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANF--DGEQPEIDY---RFINDKYSRKRF 1373
            + I+ ++ K   N++CA+C +    WAS NL + +C +C+G+HR +G +ISK++ +  D  +W    +  I Q  GN  A  +W      D  +P+ D     FI  KY +K+F
Sbjct:   17 QAILVDMLKEEKNKYCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLD--SWTEEQMASI-QSWGNRRAGLYWECYLPEDFRRPQTDSAMEAFIRKKYEQKKF 127          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000045891.1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:NCBI gene;Acc:105356443])

HSP 1 Score: 132.109 bits (331), Expect = 2.034e-30
Identity = 95/346 (27.46%), Postives = 163/346 (47.11%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYD---KQQIDESDNSHLL----KALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFD-------GEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD-MNYVSEPSGLNSLETAGKYHQMLQLTYLN 1586
            NKF++ T +++F F+        +WI  +           Q   +  SHL     + L+ L   KGK + ++     +     ++D+K G+ +  ++L ++ + RD  D     + T ++ +  T ES     EW       IQ++I  T S       ++  +I  N +NR CA+C++   EWAS NL + +C KC+G HR +GP+ISK++ +  D S W N  L+  F  +GN  AN FW AN         G   E    FI  KY  +++      + + ++    LN+ L   V T ++++TM L   GA+ M    +P+       A +  Q +Q+ +L+
Sbjct:  493 NKFEVITSLRTFIFRAEGEGERQEWIEALQTATQPPACSSQKRSNTLSHLSSTNKRGLLELRGYKGKVLVSLVGS-KVRLCKTEQDYKAGLGISEVELTAANI-RD-MDRRGFEINTPFKNFCFTAESEQEKAEWVE----AIQESIVETLSDY-----EVAEKIWFNEANRSCADCRAPQPEWASTNLGVVICKKCAGQHRFLGPSISKVRSLKLDSSIWSN-ELVEFFLEVGNKKANSFWAANLPLEEELHIGASTEQRATFIRRKYKERKYRR----LLEGFEYVVQLNQALCASVVTPDVLQTMALVFTGANVMCATGDPTYSTPYLLAQRAGQKVQMEFLH 821          

HSP 2 Score: 87.4261 bits (215), Expect = 8.137e-17
Identity = 59/197 (29.95%), Postives = 96/197 (48.73%), Query Frame = 3
Query: 2334 STSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-EMEK 2915
            S +LS Q LT+N +P+ +   I  +  +G   EG++ K+G       + ++   D  S  L   +    DV   LK F   LED LL K  Y  W++A+D RD   + + +   I  LP IN  TL  L+  L  I + + +  M  + L+  F+ C      Q    + + ++  LIRNY  LF V ++++ +ME+
Sbjct: 1063 SKALSEQQLTKNGIPIILESCIAFVTQYGFCQEGVYEKLGDPTRVGLLLEEFNRDARSVKLREKEHKLEDVTDTLKSFLNHLEDALLIKELYPYWVSALDERDESLRVKKYSTFIESLPKINKMTLDALLQHLYRIHQCSHLNHMPSEKLAAVFSCCFFQTQGQ--TTQEISVVQDLIRNYVTLFRVNEDQVQQMER 1257          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101162821])

HSP 1 Score: 128.257 bits (321), Expect = 2.895e-29
Identity = 92/347 (26.51%), Postives = 166/347 (47.84%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWIN----HI-GKLIYDKQQIDESDNSHLLK-ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVS--------EPSGLNSLETAGKYHQMLQ 1571
            NKF++ T  + F F+  +     +W+     HI  +L++ +++      SH  K  ++ L+  K K ++T      I  + +++ F+ GI +  I+ R + + RDG    S  LIT Y+ +  T ES     +W       +Q+AI+ T S       ++  +I  N SNR CA+CK+ + +WAS+NL + +C  C+G HR +G  +SK+Q +  D S W N  ++++F ++GN+ AN FW A+    +       PE    FI  KY   RF          +   + L + L   +  + +++T+    + A+   ++         P G +     G Y +++Q
Sbjct:  572 NKFEIVTSNRIFVFRTDNEVLRRRWVTTLQEHIRDQLVFGRRRF--GPGSHCQKHGVLELKGTKSK-VYTAISTDQIWLHKSEQCFRNGIGITVIEARGATI-RDGKH-RSFDLITPYKSFSFTAESERDKRDWME----ALQEAIAETLS-----DYEVAEKIWSNRSNRMCADCKAVNPDWASINLCVVICKNCAGQHRSLGSMVSKVQSLKLDTSVWSN-EIVQLFIMVGNDRANDFWAAHLSQSEELDCDASPEQRKDFITQKYKEGRF----RLAHPAFSTHEELLKALCTALSEQTLLKTVTQIFLEAESARLTGDSRRQHDAPQGYSPSTDPGVYDEIMQ 899          

HSP 2 Score: 88.5817 bits (218), Expect = 3.623e-17
Identity = 59/196 (30.10%), Postives = 97/196 (49.49%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE---ELEME 2912
            +L  Q +++N++P+ V   I  +  +G   EG++RK G+      + ++   D  +  L   D +  DV   LK FFR+++DP+     +  W  A  I    ++ E +KEII  LP +N  TL  LI  L  + K  D+ QM   NLS  F   L     +      ++I+  LI NY  +FD+ +E   ++E+E
Sbjct: 1127 TLREQQMSRNDIPIIVDSCIAFITQYGLGHEGIYRKNGAKTRIRLLMEEFRKDARNVKLRIGDHFIEDVTDVLKRFFREIDDPIFMAELHAFWQEAAKIPQKRQRLERYKEIIRSLPRVNQTTLAALIGHLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGK--GEHEVKIVEDLIDNYLFVFDIDEEHQTQIELE 1320          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101162821])

HSP 1 Score: 128.257 bits (321), Expect = 3.086e-29
Identity = 92/347 (26.51%), Postives = 166/347 (47.84%), Query Frame = 3
Query:  594 NKFKLETPVKSFKFQCSSHENAGKWIN----HI-GKLIYDKQQIDESDNSHLLK-ALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQ-------PEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVS--------EPSGLNSLETAGKYHQMLQ 1571
            NKF++ T  + F F+  +     +W+     HI  +L++ +++      SH  K  ++ L+  K K ++T      I  + +++ F+ GI +  I+ R + + RDG    S  LIT Y+ +  T ES     +W       +Q+AI+ T S       ++  +I  N SNR CA+CK+ + +WAS+NL + +C  C+G HR +G  +SK+Q +  D S W N  ++++F ++GN+ AN FW A+    +       PE    FI  KY   RF          +   + L + L   +  + +++T+    + A+   ++         P G +     G Y +++Q
Sbjct:  528 NKFEIVTSNRIFVFRTDNEVLRRRWVTTLQEHIRDQLVFGRRRF--GPGSHCQKHGVLELKGTKSK-VYTAISTDQIWLHKSEQCFRNGIGITVIEARGATI-RDGKH-RSFDLITPYKSFSFTAESERDKRDWME----ALQEAIAETLS-----DYEVAEKIWSNRSNRMCADCKAVNPDWASINLCVVICKNCAGQHRSLGSMVSKVQSLKLDTSVWSN-EIVQLFIMVGNDRANDFWAAHLSQSEELDCDASPEQRKDFITQKYKEGRF----RLAHPAFSTHEELLKALCTALSEQTLLKTVTQIFLEAESARLTGDSRRQHDAPQGYSPSTDPGVYDEIMQ 855          

HSP 2 Score: 88.5817 bits (218), Expect = 3.334e-17
Identity = 59/196 (30.10%), Postives = 97/196 (49.49%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQE---ELEME 2912
            +L  Q +++N++P+ V   I  +  +G   EG++RK G+      + ++   D  +  L   D +  DV   LK FFR+++DP+     +  W  A  I    ++ E +KEII  LP +N  TL  LI  L  + K  D+ QM   NLS  F   L     +      ++I+  LI NY  +FD+ +E   ++E+E
Sbjct: 1083 TLREQQMSRNDIPIIVDSCIAFITQYGLGHEGIYRKNGAKTRIRLLMEEFRKDARNVKLRIGDHFIEDVTDVLKRFFREIDDPIFMAELHAFWQEAAKIPQKRQRLERYKEIIRSLPRVNQTTLAALIGHLYRVQKCADLNQMCTKNLSLLFAPSLFQTDGK--GEHEVKIVEDLIDNYLFVFDIDEEHQTQIELE 1276          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000040486.1 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101156673])

HSP 1 Score: 102.449 bits (254), Expect = 1.734e-21
Identity = 74/264 (28.03%), Postives = 120/264 (45.45%), Query Frame = 3
Query:  813 YDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQP-------EIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSGLNSLETAGKYHQMLQLTYL 1583
            Y N ++F+ GIA   + L  + VK  G  S    L    +   LT ES      W + +   I  A+S  CS+       +   + +N  N+ CA+C   + +WASVNL +++C  C+  HR +  N+SK++ +  D   W    +I++F   GN  AN+ W       +        E   +FI DKYSR R+      +         + + L + V T ++  TM L   GA +   S+P   + +  A K +Q LQ+ +L
Sbjct:  441 YTNKDNFQLGIASFIVPLTVACVKPTGKQS--FILTVPQKTLNLTVESNKDLTTWLNCLEAAICSALS--CSQ-------VALRLRENPHNKVCADCGEANPDWASVNLLLSICKSCADHHRNLSSNLSKVRSML-DTKIWTEP-IIQLFVTYGNKLANQVWAPAVPAAEQLHPKSTDEERSKFIQDKYSRGRYRR----VHPLSSSRAMMEQRLCQVVCTSDLEETMSLICSGAKV-CPSDPQSPSPISLAEKANQALQMQFL 686          

HSP 2 Score: 57.3806 bits (137), Expect = 1.009e-7
Identity = 41/175 (23.43%), Postives = 81/175 (46.29%), Query Frame = 3
Query: 2364 QNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDP--YDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLF 2882
            Q++V   + + I H+  +G ++EG++R+ G   +  ++ + L + PNS  L   +    D  SALK + R  +D ++     + W+ A    D   +F+ ++ ++ +LP  N  TL  L      +   +   +M+  NL+      L     Q+ N   +Q+    I ++  LF
Sbjct:  914 QSSVSPAIERCISHITTYGLKVEGVYRRCGLATKVNKLVEALKTSPNSAPLEGDEQGVLDACSALKKYIRD-QDSIVPTTQRQRWLQAAANPDESCRFKEYRRLLRQLPDNNKATLNALFGHFYMVQVFSQENKMSAYNLAVVLAPSLF----QVMNQDMIQLTKEFIIHHTLLF 1083          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16925])

HSP 1 Score: 90.1225 bits (222), Expect = 7.049e-18
Identity = 61/195 (31.28%), Postives = 106/195 (54.36%), Query Frame = 3
Query: 2340 SLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY--DVASALKLFFRKLEDPLLTKLYYENW--IAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEME 2912
            +LS Q LT+ +VP+ V   I  +  +G + EG++RK G       + ++   D  S  L   +    DV++ LK FFR+LED L T  +  +W  +AA D+ +S  K   +K+++N+LP +N  TL+ LI  L  +   +D+ QMN  NL+  F   L     + + A   + +  LI++Y  +F+V +++L+ +
Sbjct:  195 TLSEQQLTETDVPVIVLSCISFITQYGLKSEGIYRKSGVNSRVAALCERFHRDARSLCLKEGEHQVDDVSNTLKRFFRELEDGLFTSEHARDWLTVAAGDLENS--KISQYKDLLNRLPRVNRATLQALINHLYCVQCFSDLNQMNLHNLAIVFGPTLFQTDGKDYTAG--RAIEDLIQHYILIFEVDEQQLKRQ 385          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000006535.1 (SMESG000006535.1)

HSP 1 Score: 2349.7 bits (6088), Expect = 0.000e+0
Identity = 1207/1213 (99.51%), Postives = 1210/1213 (99.75%), Query Frame = 3
Query:   69 MSDNERILETNWKIEDFDRNIXXXXXXXRNGSLRTYLSEEGDDVISVSCKDIEGESVXXXXXXXXXGMPVFSQPLMKNYAKSPNKTIKSDNIPFPKLPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSGLNSLETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQETDYSTKPADYXXXXXXXXXXXXADQSNNLRDFKNAIGQNLSPNFVPSFSYACIGWVILSTVSEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFPPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKELLTKQLRIEQSMTSKSLFGKLFKENTNTQNISIFEDRKVDDFHMEHLVYPDENLIEVIQNSEKCDVPSKWIFKINKYTLDADSTSKSFQCQASLSMSSKNRVIIELTEKHELIICRNDQTQXXXXXXXXXXXFRSCEDNKNFVAFEYRKNQSSTMPSVLQXXXXXXXXXXXXXXXXXETDYFNFLKHYDRFKLVEIKYPESRSQLTASTVI 3707
            MSDNERILETNWKIEDFDRNIPKPKPPPRNGSLRTYLSEEGDDVISVSCKDIEGESVDDLDLPDDLGMPVFSQPL+KNYAKSPNKTIKSDNIPFPKLPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIM EINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKE IFDKYKDSQALNRELIECVKTENIIRTMQLFHIGAD+NYVSEPSGLN+LETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQETDYSTKPADYVESGISVIEISSADQSNNLRDFKNAIGQNLSPNFVPSFSYACIGWVILSTVSEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDF PLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKELLTKQLRIEQSMTSKSLFGKLFKENTNTQNISIFEDRKVDDFHMEHLVYPDENLIEVIQNSEKCDVPSKWIFKINKYTLDADSTSKSFQCQASLSMSSKNRVIIELTEKHELIICRNDQTQDLIIKIKDLILFRSCEDNKNFVAFEYRKNQSSTMPSVLQIFSFRSRSSFNIIHFSNETDYFNFLKHYDRFKLVEIKYPESRSQLTASTVI
Sbjct:    1 MSDNERILETNWKIEDFDRNIPKPKPPPRNGSLRTYLSEEGDDVISVSCKDIEGESVDDLDLPDDLGMPVFSQPLLKNYAKSPNKTIKSDNIPFPKLPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMREINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKEAIFDKYKDSQALNRELIECVKTENIIRTMQLFHIGADINYVSEPSGLNALETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLSINQNPKEFRIILIWKSCIQILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQETDYSTKPADYVESGISVIEISSADQSNNLRDFKNAIGQNLSPNFVPSFSYACIGWVILSTVSEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKIEELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQSWYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKLYNKERMKIKDFTPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKELLTKQLRIEQSMTSKSLFGKLFKENTNTQNISIFEDRKVDDFHMEHLVYPDENLIEVIQNSEKCDVPSKWIFKINKYTLDADSTSKSFQCQASLSMSSKNRVIIELTEKHELIICRNDQTQDLIIKIKDLILFRSCEDNKNFVAFEYRKNQSSTMPSVLQIFSFRSRSSFNIIHFSNETDYFNFLKHYDRFKLVEIKYPESRSQLTASTVI 1213          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070925.1 (SMESG000070925.1)

HSP 1 Score: 127.872 bits (320), Expect = 2.011e-29
Identity = 113/435 (25.98%), Postives = 196/435 (45.06%), Query Frame = 3
Query:  357 LPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPV----KSFKFQCSSHENAGKWINH----IGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIE--PKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSN--------SLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDG-EQPEIDYR-FINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFH-IGADMN--YVSEPSGLNSLETAGKYHQMLQLTYLNSQ 1592
            L C SE ++     +H  ++  +++    + + Y VL+ + +I+F+K    +S  ++P+ +              K +CN+F  +  +     +F F          WI +    IG  +  K  ID +       A V ++ + G  +F +     + +  + + ++    I  H +  +   VK D  D++        SL LI  +  +K++F+  +   EW      I+ KA+      N     +++ EI +N SNR CA+C S D EW S+NL + +C  C+G+HR  G + S+IQ    DE  W +  LI+I + IGN  +N FW  N         DY  F+ +KY  K+F + +     +Y     L +     V  +++  TM+L+H I  D N  +V E      LE A   +Q LQ  +L+ Q
Sbjct:    3 LLCLSELEEQHI--FHSSLILHLKQ----QSNMYCVLIESYMIIFKKSTDIISFKRLPITN------------KTKVECNEFGDQFSIIIRENTFTFSSPDVTIIETWIKNLNFLIGNFVLTKPLIDYN------YAEVKIDQIGGSIVFILLFCNDYNLIIFSSLKEHSDNIVTHVVNCKFYSVKNDSRDNSIASRSTIKSLVLIGKHLSFKISFKDESTLKEW----ECILLKAVKTAFGINEN---EVLTEIYENESNRCCADCGSPDPEWISINLSVIICINCAGIHRSFGTSFSRIQSAVLDECIWSDSYLIKILKTIGNEKSNSFWYKNQRKLTSTSTDYSLFVKNKYVSKKFIDDEFINLSEYDFKSHLQKS----VAADDVFLTMRLWHSINFDYNSEFVEEL-----LEIARNSNQFLQEKFLSVQ 397          

HSP 2 Score: 65.4698 bits (158), Expect = 2.938e-10
Identity = 63/265 (23.77%), Postives = 129/265 (48.68%), Query Frame = 3
Query: 2382 PVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDP-----YDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-EMEKLYNKERMKIKDFPPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKE---LLTKQLRIEQSMTSKSLFGKLFKEN 3149
            P++KMI  +   G + EG+FR  G++K+   ++  +    N++ +   DP     YDV+S LK +FR L++P++T   ++ +  A+   +  +K   +KE ++ LP  NY   R L+ L   I  +   T+M+  +L+ S  +      D +    + +I+  LI N+  LFD + +++ ++E+      +  +        ++R  YI P +           R S  KK +F  +    ++  + +++ +T K +  +LF ++
Sbjct:  631 PINKMISFIISRGLKSEGIFRICGTIKKVNILHKSIEKSGNNFFI---DPLIYNVYDVSSCLKKYFRSLDEPIITSNLFDIFRGALIEENQSRKITLYKEGLSFLPRDNYSVFRDLLELFYMIQMSVTDTRMDCSSLAIS-VSSSFISFDHINTEISSKIMKELIENFIALFDYSGKKINDLERFVAGPEIVAQ-------KIIRNFYIHPNINSVTI------RNSESKKLNFIDKDANFVSVIINVDEYVTVKQIIERLFTDS 878          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070668.1 (SMESG000070668.1)

HSP 1 Score: 126.716 bits (317), Expect = 4.719e-29
Identity = 119/426 (27.93%), Postives = 194/426 (45.54%), Query Frame = 3
Query:  357 LPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLI--YDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSN----SLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGED-IMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEI----DYRFINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFH---IGADMNYVSEPSGLNSLETAGKYHQMLQLTYLNSQ 1592
            + C SE +DN  +  H  +     K+  S    Y  L+  +LI+F+     +S  ++P+     + ++D        + N+F +      + F  S       W+N I  L+  Y+  Q++    + +        NV    I     ++ +  Y+N ++    I  H I L+   ++   + S+     L L      +K+ FES  L NEW     II+ +AI+         GE+ I+ +I  N SN+ CA+C   + EW S+NL + LC  CSGLHR +  + S+IQ    D+  WE+  LI I + IGN N+N FW  N + ++  I    D   IN KY  K+F    +T F    D++  NR L   V T+++  TM+L+H      D  ++ E      L  A   +Q LQ  +L+ Q
Sbjct:    3 VTCLSEIEDN--ILIHSNL-----KVNGSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYID--------NSNQFLILLGNFQYLFMNSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSS-YILIRSDEYLLHIYENLDEHAQNICSHVINLKFYSLENSRSLSSVNNRCLKLFGKSITFKIKFESSELVNEW----KIILSEAINIA----FMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCISCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW--NKNKQKLSIIFPSDLSEINSKYIEKKFI---DTEFINLSDNEIKNR-LRSSVATDDVFLTMKLYHSIKFPYDSEFIKEI-----LLIARNSNQYLQEKFLSVQ 393          

HSP 2 Score: 79.337 bits (194), Expect = 1.665e-14
Identity = 71/264 (26.89%), Postives = 122/264 (46.21%), Query Frame = 3
Query: 2382 PVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY-----DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-----EMEKLYNKERMKIKDFPPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKELLTKQLRIEQSMTSKSLFGKLFK 3143
            P+ KMI  +   G + E +FRKVG+V++   +Y+ +   PN + +   DP      DVAS  K +FR   +P++T   +  +  A  + ++  K    +  ++ +P INYQ L   + LL  I K  D  +M+  +L+ S    +IS  D+     + +IL  LI  ++ +F  + +E       +E    KE + I++F           YI P L+ FL    N  +  G         ++  ++ I Q  T K +  KLF+
Sbjct:  623 PIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFI---DPNVYNVNDVASCFKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLLKTVELLYMIQKFADENKMDSKSLALSTALSIIS-EDENHREISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREF-----------YIHPFLKNFLLIPTNENKRVGFLDRGISFSMI--RMTINQCATVKQVVQKLFR 869          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070925.1 (SMESG000070925.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.198e-26
Identity = 83/264 (31.44%), Postives = 127/264 (48.11%), Query Frame = 3
Query:  840 GIAMHRIQLRSSGVKRDGNDSN--------SLSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDG-EQPEIDYR-FINDKYSRKRFSERKETIFDKYKDSQALNRELIECVKTENIIRTMQLFH-IGADMN--YVSEPSGLNSLETAGKYHQMLQLTYLNSQ 1592
             I  H +  +   VK D  D++        SL LI  +  +K++F+  +   EW      I+ KA+      N     +++ EI +N SNR CA+C S D EW S+NL + +C  C+G+HR  G + S+IQ    DE  W +  LI+I + IGN  +N FW  N         DY  F+ +KY  K+F + +     +Y     L +     V  +++  TM+L+H I  D N  +V E      LE A   +Q LQ  +L+ Q
Sbjct:   21 NIVTHVVNCKFYSVKNDSRDNSIASRSTIKSLVLIGKHLSFKISFKDESTLKEW----ECILLKAVKTAFGINEN---EVLTEIYENESNRCCADCGSPDPEWISINLSVIICINCAGIHRSFGTSFSRIQSAVLDECIWSDSYLIKILKTIGNEKSNSFWYKNQRKLTSTSTDYSLFVKNKYVSKKFIDDEFINLSEYDFKSHLQKS----VAADDVFLTMRLWHSINFDYNSEFVEEL-----LEIARNSNQFLQEKFLSVQ 268          

HSP 2 Score: 65.855 bits (159), Expect = 2.127e-10
Identity = 63/265 (23.77%), Postives = 129/265 (48.68%), Query Frame = 3
Query: 2382 PVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDP-----YDVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEEL-EMEKLYNKERMKIKDFPPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKE---LLTKQLRIEQSMTSKSLFGKLFKEN 3149
            P++KMI  +   G + EG+FR  G++K+   ++  +    N++ +   DP     YDV+S LK +FR L++P++T   ++ +  A+   +  +K   +KE ++ LP  NY   R L+ L   I  +   T+M+  +L+ S  +      D +    + +I+  LI N+  LFD + +++ ++E+      +  +        ++R  YI P +           R S  KK +F  +    ++  + +++ +T K +  +LF ++
Sbjct:  502 PINKMISFIISRGLKSEGIFRICGTIKKVNILHKSIEKSGNNFFI---DPLIYNVYDVSSCLKKYFRSLDEPIITSNLFDIFRGALIEENQSRKITLYKEGLSFLPRDNYSVFRDLLELFYMIQMSVTDTRMDCSSLAIS-VSSSFISFDHINTEISSKIMKELIENFIALFDYSGKKINDLERFVAGPEIVAQ-------KIIRNFYIHPNINSVTI------RNSESKKLNFIDKDANFVSVIINVDEYVTVKQIIERLFTDS 749          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.052e-12
Identity = 41/116 (35.34%), Postives = 64/116 (55.17%), Query Frame = 3
Query: 1053 IMHEINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDG---EQPEIDYR------FINDKYSRKRF 1373
            I + I   A N  C +C S D  WAS+NL I++C +CSG+HR++G ++S+++    DE + E+   I + Q IGN  AN  W A+      ++PE D        ++  KY +K F
Sbjct:  664 IANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEH---IAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMF 776          
The following BLAST results are available for this feature:
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARAP28.937e-3529.75ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP36.984e-2926.55ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP31.138e-2826.52ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP31.138e-2826.52ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP32.031e-2827.27ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F23H11.43.141e-1928.17pep chromosome:WBcel235:III:902151:907539:-1 gene:... [more]
cnt-25.875e-1529.23Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-27.321e-1532.93Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-27.759e-1532.93Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-28.058e-1532.93Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP15B1.107e-1429.08gene:FBgn0030808 transcript:FBtr0110990[more]
RhoGAP15B1.116e-1429.08gene:FBgn0030808 transcript:FBtr0290096[more]
CenB1A4.621e-1430.11gene:FBgn0039056 transcript:FBtr0084369[more]
CenB1A8.356e-1429.19gene:FBgn0039056 transcript:FBtr0084368[more]
CenG1A1.514e-1135.24gene:FBgn0028509 transcript:FBtr0080548[more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arap1a5.491e-3626.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap36.577e-3026.39ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
CR387919.14.550e-2925.65zmp:0000000660 [Source:NCBI gene;Acc:559690][more]
CR387919.14.550e-2925.65zmp:0000000660 [Source:NCBI gene;Acc:559690][more]
FO704810.11.763e-2425.14arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccn42.935e-3323.80cellular communication network factor 4 [Source:Xe... [more]
itgav1.336e-2227.10integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
itgav1.424e-2227.10integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
itgav1.754e-2227.10integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
itgav2.138e-2227.10integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arap26.849e-3530.30ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap31.869e-2725.99ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap32.080e-2725.99ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap19.350e-2723.85ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap19.966e-2723.85ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WZ64|ARAP2_HUMAN4.292e-3429.75Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q8BZ05|ARAP2_MOUSE1.979e-3330.03Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q8WWN8|ARAP3_HUMAN3.354e-2826.55Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q8R5G7|ARAP3_MOUSE1.308e-2625.99Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q96P48|ARAP1_HUMAN1.461e-2624.36Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8SUZ25.848e-5525.81Uncharacterized protein (Fragment) OS=Chloebia gou... [more]
A0A093QCG11.885e-5425.56Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
H0ZFT54.097e-5425.70ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
H0UZX61.380e-5326.17ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
A0A0P6J1751.965e-5326.03Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARAP17.429e-3326.33ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap33.452e-3026.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap33.481e-3026.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSAMXT00000019510.21.215e-2726.36ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSAMXT00000000841.21.451e-2429.34arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000232.12.322e-2422.91pep scaffold:Pmarinus_7.0:GL480628:15362:26221:1 g... [more]
ENSPMAT00000007633.13.594e-2334.03pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-... [more]
ENSPMAT00000003939.15.750e-1831.54pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 ... [more]
GIT21.875e-1329.05GIT ArfGAP 2 [Source:HGNC Symbol;Acc:HGNC:4273][more]
ENSPMAT00000000404.14.309e-1329.79pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AGE21.154e-1131.03ADP-ribosylation factor (ARF) GTPase activating pr... [more]
AGE11.245e-930.41ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GLO35.332e-932.61ADP-ribosylation factor GTPase activating protein ... [more]
RGD12.343e-825.79GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
RGA23.146e-830.69GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346731.795e-2630.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430072.519e-1431.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341781.573e-1328.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378095.021e-1331.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330915.590e-1332.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045891.12.034e-3027.46ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap32.895e-2926.51ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap33.086e-2926.51ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSORLT00000040486.11.734e-2128.03arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
ARAP17.049e-1831.28ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006535.10.000e+099.51SMESG000006535.1[more]
SMESG000070925.12.011e-2925.98SMESG000070925.1[more]
SMESG000070668.14.719e-2927.93SMESG000070668.1[more]
SMESG000070925.13.198e-2631.44SMESG000070925.1[more]
SMESG000075717.11.052e-1235.34SMESG000075717.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032591 ID=SMED30032591|Name=arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3812bp
TATATAAATCTTATATGAAATGGAATTTTTAAAAATTGTTTCGCTAATTA
TTTTTTGATTCCTTTGATATGTCAGATAATGAAAGAATACTAGAAACAAA
TTGGAAAATCGAAGATTTTGATCGAAATATTCCAAAACCCAAACCACCTC
CAAGAAATGGTTCTTTACGCACATATTTATCAGAAGAAGGTGACGATGTA
ATATCTGTATCGTGTAAAGATATCGAAGGAGAATCAGTCGATGATTTAGA
TTTACCAGATGATTTAGGAATGCCCGTATTCAGTCAGCCTTTAATGAAAA
ATTACGCTAAATCTCCTAATAAAACGATTAAATCCGATAATATTCCGTTT
CCAAAGCTTCCTTGTTTTTCAGAATTCGATGATAACGACAGATTAGAGTA
TCATGGACCGATAGTTCAAATTGTACAAAAATTAACATCTAGTAGAAAAT
CCAGGTACGCAGTGTTGATGTCTAACAAATTGATATTATTCGAAAAACCC
GAACACAAAGTGTCGAAAGTTCAAATCCCATTAAAATCTATGAAAGGCAT
CGATTGGGTGGATTCAGTCAATTGTTCCAATAAAGATGATTGCAATAAAT
TCAAACTTGAAACTCCCGTGAAATCATTCAAGTTCCAATGTTCTAGTCAC
GAAAACGCCGGGAAGTGGATTAATCACATTGGGAAACTTATTTATGATAA
ACAGCAGATCGATGAATCAGATAATTCTCATTTATTAAAAGCTTTGGTTT
CATTGGAAAATGTAAAAGGCAAGCGGATATTTACCATCGAACCGAAATTC
ACAATTGCCTATTATGATAACGATGAAGATTTCAAATACGGAATCGCTAT
GCATCGGATCCAATTGAGATCAAGCGGAGTGAAACGAGACGGGAACGACA
GCAATTCATTGTCATTGATTACGTCATATAGAAGATACAAATTAACATTT
GAAAGCATCAACCTGTGCAATGAATGGTTTCATCAGATAACCATCATAAT
CCAGAAAGCGATTTCCGCAACCTGTTCAAGAAATGCCAGGCCCGGTGAGG
ACATAATGCACGAGATTAACAAAAATGCCAGCAACCGATTTTGCGCCGAA
TGTAAATCGACCGACATCGAATGGGCGTCAGTAAATCTATTCATCACTTT
GTGTGCCAAATGTTCCGGGCTACATCGAAAAATGGGTCCGAACATCTCGA
AAATCCAAGGAATATTCACCGACGAATCGACTTGGGAAAATGGCAATCTC
ATCAGAATCTTTCAAATCATAGGCAACAACAACGCAAACAAATTCTGGTT
GGCTAATTTCGATGGGGAACAACCGGAAATCGATTATAGATTCATCAATG
ATAAATACAGCAGGAAGCGGTTCTCTGAGAGAAAGGAAACGATTTTCGAT
AAATACAAAGACAGCCAAGCTTTGAATAGAGAACTGATAGAATGCGTCAA
AACTGAAAACATCATACGAACGATGCAACTGTTTCACATTGGGGCTGATA
TGAACTACGTTTCGGAACCCAGTGGATTGAATTCTTTGGAAACTGCGGGG
AAATATCACCAAATGCTGCAATTGACTTATTTGAACTCTCAATGCAAATG
CCAAATCAGAGACTGGAGGAGTGATCTGTTCGACTCGATCGATCCAGACC
CTGACAACACCAAGCAAACGCCCTACCAGGGGAAATATTGGCTATCCATC
AACCAAAACCCAAAAGAATTCCGAATCATATTGATCTGGAAAAGCTGTAT
ACAGATTCTCGATTGTTCCAATAAAGAAGTATGCAAAATACTGTTTCGAA
ACATCTGTTTGATAAGAGAAAAACTCAACGAATCCGAAGGAATAAGCCTC
GTTATTGTTGTCCAGGAAACGGACTACTCAACGAAACCCGCGGATTATGT
CGAGTCCGGCATTAGTGTGATTGAGATTTCCAGTGCTGACCAATCGAACA
ACTTGCGAGATTTCAAAAATGCTATCGGTCAAAATCTGTCACCAAATTTC
GTGCCGAGTTTCTCGTACGCTTGTATCGGTTGGGTTATCTTGAGCACAGT
GAGTGAAGATTGGAAGCCTCATCTATTCACTATCGACTATTGTAGCATTG
CCAGCTTTTACGAGGTGAATGAGGGCCGAGAAAATCTGTGTATTGATTTG
AGAAAAGTAAACAAAATTGAAGAATTAAAGGACAGCAACTGCGAAAGCGT
CTGCCCGTATAAGATGTATAATCTTGCCTCTATTTGTTTGATATCATCGG
TTATCTATCATCTGAGAGGCGATACAAAAGAATCTCATGAAGAACTTCTT
AAAGCCTTTCTCCAGAGTTGGTATGTAAGAGATTCCACTTCGTTGTCCAA
TCAATTTCTCACCCAGAACAATGTTCCATTGCCTGTTTCAAAAATGATTA
GACACCTTCAATTGCACGGCACCCAAATTGAAGGCCTGTTTAGAAAGGTC
GGCAGTGTGAAAGAAGCGGAAAGAATATATGACCAGCTGATCTCCGATCC
GAATTCATATGTCCTAACCAACAGTGATCCCTATGACGTAGCCAGCGCTT
TGAAGCTATTCTTTCGTAAATTAGAAGATCCATTGCTGACGAAATTGTAC
TATGAAAACTGGATTGCAGCTGTTGACATTAGGGATTCCGAGAAAAAGTT
CGAATATTTCAAAGAAATAATCAATAAACTCCCGGTAATCAATTACCAAA
CACTGAGGCTGTTGATTTTTCTACTCGTAAACATCGACAAGAATAATGAC
GTCACCCAAATGAACCCGGACAATTTGTCCACCAGTTTCAACACTTGCCT
CATATCTGGATCTGATCAGATGTTCAATGCGAAAAATCTGCAAATTTTGC
CCTATCTAATAAGAAACTACCAGGATCTGTTTGATGTAACCCAGGAAGAG
CTGGAAATGGAAAAACTCTACAACAAAGAACGAATGAAAATAAAGGACTT
CCCGCCATTGGAAATCAGCCTACTGAGACAGATTTATATTTTACCGGAAC
TGGAAAGATTTCTCAAACCGGATATTAATTTCGAAAGGGAATCTGGACAT
AAAAAAACCGATTTCTTTAAAGAACTTCTAACGAAACAGTTACGCATTGA
ACAATCGATGACTTCAAAATCTCTATTTGGAAAGCTGTTCAAAGAAAACA
CAAATACTCAGAATATCTCCATTTTCGAGGATCGAAAAGTTGACGATTTC
CACATGGAACATCTAGTATATCCGGACGAGAACCTGATTGAGGTTATACA
AAATTCGGAAAAATGCGATGTTCCCAGTAAATGGATATTTAAAATCAACA
AATATACACTGGATGCCGATTCGACAAGTAAATCGTTTCAATGTCAAGCG
TCATTGTCGATGTCGAGCAAAAATAGAGTCATCATTGAATTGACAGAAAA
ACATGAATTAATTATCTGTAGAAACGATCAAACTCAGGATTTAATCATTA
AAATTAAAGACTTGATTCTTTTTAGAAGTTGTGAGGATAATAAAAATTTT
GTGGCTTTCGAATACCGAAAAAACCAAAGCAGTACTATGCCCAGTGTGTT
GCAGATATTTTCATTCAGATCACGATCTTCTTTTAATATTATTCATTTCT
CAAACGAAACCGATTATTTTAATTTCCTAAAGCACTACGACAGATTTAAA
TTGGTGGAAATAAAGTATCCCGAAAGCCGTAGCCAATTAACTGCATCCAC
AGTTATATAAACTGATTAATTTTATATTTTTACTTTTCAATATTTGCTCA
AATGTTTTTTAAATAATATTTAGAGATTTTATATGAAATTCCATTTTAAA
AGTTGATTTGTA
back to top

protein sequence of SMED30032591-orf-1

>SMED30032591-orf-1 ID=SMED30032591-orf-1|Name=SMED30032591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1214bp
MSDNERILETNWKIEDFDRNIPKPKPPPRNGSLRTYLSEEGDDVISVSCK
DIEGESVDDLDLPDDLGMPVFSQPLMKNYAKSPNKTIKSDNIPFPKLPCF
SEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSK
VQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKW
INHIGKLIYDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYD
NDEDFKYGIAMHRIQLRSSGVKRDGNDSNSLSLITSYRRYKLTFESINLC
NEWFHQITIIIQKAISATCSRNARPGEDIMHEINKNASNRFCAECKSTDI
EWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQI
IGNNNANKFWLANFDGEQPEIDYRFINDKYSRKRFSERKETIFDKYKDSQ
ALNRELIECVKTENIIRTMQLFHIGADMNYVSEPSGLNSLETAGKYHQML
QLTYLNSQCKCQIRDWRSDLFDSIDPDPDNTKQTPYQGKYWLSINQNPKE
FRIILIWKSCIQILDCSNKEVCKILFRNICLIREKLNESEGISLVIVVQE
TDYSTKPADYVESGISVIEISSADQSNNLRDFKNAIGQNLSPNFVPSFSY
ACIGWVILSTVSEDWKPHLFTIDYCSIASFYEVNEGRENLCIDLRKVNKI
EELKDSNCESVCPYKMYNLASICLISSVIYHLRGDTKESHEELLKAFLQS
WYVRDSTSLSNQFLTQNNVPLPVSKMIRHLQLHGTQIEGLFRKVGSVKEA
ERIYDQLISDPNSYVLTNSDPYDVASALKLFFRKLEDPLLTKLYYENWIA
AVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNP
DNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVTQEELEMEKL
YNKERMKIKDFPPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFF
KELLTKQLRIEQSMTSKSLFGKLFKENTNTQNISIFEDRKVDDFHMEHLV
YPDENLIEVIQNSEKCDVPSKWIFKINKYTLDADSTSKSFQCQASLSMSS
KNRVIIELTEKHELIICRNDQTQDLIIKIKDLILFRSCEDNKNFVAFEYR
KNQSSTMPSVLQIFSFRSRSSFNIIHFSNETDYFNFLKHYDRFKLVEIKY
PESRSQLTASTVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038508ArfGAP_dom_sf
IPR037278ARFGAP/RecO
IPR001164ArfGAP_dom
IPR001849PH_domain
IPR000198RhoGAP_dom
IPR011993PH-like_dom_sf
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001164Arf GTPase activating proteinSMARTSM00105arf_gap_3coord: 327..443
e-value: 1.9E-19
score: 80.6
IPR001164Arf GTPase activating proteinPFAMPF01412ArfGapcoord: 329..450
e-value: 3.3E-24
score: 85.2
IPR001164Arf GTPase activating proteinPROSITEPS50115ARFGAPcoord: 327..443
score: 19.592
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 767..936
e-value: 1.2E-37
score: 141.1
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 770..915
e-value: 4.8E-36
score: 123.9
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 757..938
score: 34.752
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 224..314
e-value: 7.5
score: 13.9
coord: 109..211
e-value: 2.1E-10
score: 50.6
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 110..208
e-value: 6.6E-8
score: 33.0
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 108..209
score: 8.92
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 106..221
e-value: 2.2E-10
score: 42.3
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 222..318
e-value: 1.2E-5
score: 26.9
IPR038508ArfGAP domain superfamilyGENE3DG3DSA:3.30.40.160coord: 319..443
e-value: 1.5E-27
score: 98.0
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 750..950
e-value: 3.7E-46
score: 158.6
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 766..941
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..36
NoneNo IPR availablePANTHERPTHR45899FAMILY NOT NAMEDcoord: 127..979
NoneNo IPR availableCDDcd08837ArfGap_ARAPcoord: 332..436
e-value: 1.22307E-30
score: 115.166
NoneNo IPR availableCDDcd00821PHcoord: 111..204
e-value: 6.58658E-7
score: 46.3818
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 111..215
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 235..314
IPR037278ARFGAP/RecO-like zinc fingerSUPERFAMILYSSF57863ArfGap/RecO-like zinc fingercoord: 328..437