Protein elav-like protein

Overview
NameProtein elav-like protein
Smed IDSMED30032581
Length (bp)1925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein elav-like protein (SMED30032581) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein elav-like protein (SMED30032581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein elav-like protein (SMED30032581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein elav-like protein (SMED30032581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30032581SMESG000073310.1 dd_Smed_v4_13151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein elav-like protein vs. Ensembl Human
Match: ELAVL1 (ELAV like RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3312])

HSP 1 Score: 191.045 bits (484), Expect = 8.517e-55
Identity = 97/169 (57.40%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM QDEL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 7.684e-18
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 54.299 bits (129), Expect = 3.711e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          
BLAST of Protein elav-like protein vs. Ensembl Human
Match: ELAVL1 (ELAV like RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3312])

HSP 1 Score: 191.045 bits (484), Expect = 8.517e-55
Identity = 97/169 (57.40%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM QDEL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 7.684e-18
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 54.299 bits (129), Expect = 3.711e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          
BLAST of Protein elav-like protein vs. Ensembl Human
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3313])

HSP 1 Score: 185.267 bits (469), Expect = 2.686e-54
Identity = 91/152 (59.87%), Postives = 110/152 (72.37%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGK 972
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+
Sbjct:   38 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQ 189          
BLAST of Protein elav-like protein vs. Ensembl Human
Match: ELAVL3 (ELAV like RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3314])

HSP 1 Score: 190.66 bits (483), Expect = 3.380e-54
Identity = 96/169 (56.80%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM QDE   +F  IG IESCKL+RDK+TGQSL YGF+N+S  +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q ++  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNP 206          

HSP 2 Score: 93.5893 bits (231), Expect = 6.417e-20
Identity = 39/77 (50.65%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   G+RV+ V+ +
Sbjct:  284 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFK 360          

HSP 3 Score: 50.0618 bits (118), Expect = 9.405e-6
Identity = 20/60 (33.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++  ++++VS 
Sbjct:  300 LWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSF 359          
BLAST of Protein elav-like protein vs. Ensembl Human
Match: ELAVL3 (ELAV like RNA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3314])

HSP 1 Score: 190.66 bits (483), Expect = 3.427e-54
Identity = 96/169 (56.80%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM QDE   +F  IG IESCKL+RDK+TGQSL YGF+N+S  +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q ++  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNP 206          

HSP 2 Score: 93.5893 bits (231), Expect = 6.175e-20
Identity = 39/77 (50.65%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   G+RV+ V+ +
Sbjct:  277 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFK 353          

HSP 3 Score: 50.0618 bits (118), Expect = 8.896e-6
Identity = 20/60 (33.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++  ++++VS 
Sbjct:  293 LWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSF 352          
BLAST of Protein elav-like protein vs. Ensembl Celegans
Match: exc-7 (pep chromosome:WBcel235:II:9575971:9581490:1 gene:WBGene00001368.1 transcript:F35H8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exc-7)

HSP 1 Score: 186.808 bits (473), Expect = 3.558e-52
Identity = 90/169 (53.25%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+I+NYLPQ M Q+E+  +F  IG IESCKL+RDKVTGQSL YGF+N+    DA  A+   NGL++ NK IKVS ARPS++ IKG+NLYV  +P++    +L  +F   G IIT R+L+D+  G SKGV F+RFDK+ EA+ AI+  NG I    S  + VK AN P
Sbjct:   41 KTNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFNGLRLQNKTIKVSYARPSNDQIKGSNLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSKGVGFVRFDKKDEADVAIKTLNGSIPSGCSEQITVKFANNP 209          

HSP 2 Score: 70.4774 bits (171), Expect = 1.562e-12
Identity = 40/101 (39.60%), Postives = 55/101 (54.46%), Query Frame = 1
Query: 1438 LAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYV 1740
            LA    L+ +  +   T   SD     + +FV NLS DT D  +WQLF+ FGA+ +V + +D+ T  C GY FV M NY EA  A+  LNGT    + + V
Sbjct:  349 LAAHAQLSALSASVAATLPPSDTA--GYCLFVYNLSSDTDDTLLWQLFSQFGAIVNVKILRDL-TQQCKGYAFVSMSNYTEAYNAMLSLNGTNLAGKTLQV 446          
BLAST of Protein elav-like protein vs. Ensembl Celegans
Match: pab-2 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q19579])

HSP 1 Score: 92.4337 bits (228), Expect = 2.611e-19
Identity = 61/185 (32.97%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARP------SSEM--------------IKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ V    +++ Q++L  +F+  G I S  ++ D   G+   +GF+ F+    A  A+EKLN   ++    K+S+ R       S+E+               +G NLYV ++  + N D LRD FSS GTI + +V+ D  G+SKG  F+ F+K +EA  A+   N K+I  G+  L V LA 
Sbjct:  238 TNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTD-AQGKPKGFGFVAFADQDAAGQAVEKLNDSILEGTDCKLSVCRAQKKSERSAELKRKYEALKQERVQRYQGVNLYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDENGRSKGFGFVCFEKPEEATAAVTDMNSKMI--GAKPLYVALAQ 419          

HSP 2 Score: 91.2781 bits (225), Expect = 6.940e-19
Identity = 52/160 (32.50%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKG--------ANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIE 981
            NI +  L + +    +   F+  G I SCK+  D   G S  YGF++F + H A+ AIEK+NG+ + +K + V   +P ++ +K          N++V +   + +Q+KL  +FS  G I +  V+TD+ GK KG  F+ F  +  A +A+E  N  I+E
Sbjct:  146 NIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDD-EGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQGKPKGFGFVAFADQDAAGQAVEKLNDSILE 304          

HSP 3 Score: 85.5001 bits (210), Expect = 4.508e-17
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR--PSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSV 993
            L + F+  GP+ S ++ RD  +  SL Y ++NF    DA+ A++ +N   I  + +++  ++  P++      N+++ ++ R  +   + D FS  G I++C+V TD  G SKG  F+ F+    A+ AIE  NG ++ D  V
Sbjct:   73 LFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERALDTMNFEVIHGRPMRIMWSQRDPAARRAGNGNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDEGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKV 215          
BLAST of Protein elav-like protein vs. Ensembl Celegans
Match: pab-2 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q19579])

HSP 1 Score: 92.4337 bits (228), Expect = 2.611e-19
Identity = 61/185 (32.97%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARP------SSEM--------------IKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ V    +++ Q++L  +F+  G I S  ++ D   G+   +GF+ F+    A  A+EKLN   ++    K+S+ R       S+E+               +G NLYV ++  + N D LRD FSS GTI + +V+ D  G+SKG  F+ F+K +EA  A+   N K+I  G+  L V LA 
Sbjct:  238 TNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTD-AQGKPKGFGFVAFADQDAAGQAVEKLNDSILEGTDCKLSVCRAQKKSERSAELKRKYEALKQERVQRYQGVNLYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDENGRSKGFGFVCFEKPEEATAAVTDMNSKMI--GAKPLYVALAQ 419          

HSP 2 Score: 91.2781 bits (225), Expect = 6.940e-19
Identity = 52/160 (32.50%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKG--------ANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIE 981
            NI +  L + +    +   F+  G I SCK+  D   G S  YGF++F + H A+ AIEK+NG+ + +K + V   +P ++ +K          N++V +   + +Q+KL  +FS  G I +  V+TD+ GK KG  F+ F  +  A +A+E  N  I+E
Sbjct:  146 NIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDD-EGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQGKPKGFGFVAFADQDAAGQAVEKLNDSILE 304          

HSP 3 Score: 85.5001 bits (210), Expect = 4.508e-17
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR--PSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSV 993
            L + F+  GP+ S ++ RD  +  SL Y ++NF    DA+ A++ +N   I  + +++  ++  P++      N+++ ++ R  +   + D FS  G I++C+V TD  G SKG  F+ F+    A+ AIE  NG ++ D  V
Sbjct:   73 LFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERALDTMNFEVIHGRPMRIMWSQRDPAARRAGNGNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDEGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKV 215          
BLAST of Protein elav-like protein vs. Ensembl Celegans
Match: pab-2 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q19579])

HSP 1 Score: 92.4337 bits (228), Expect = 2.611e-19
Identity = 61/185 (32.97%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARP------SSEM--------------IKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ V    +++ Q++L  +F+  G I S  ++ D   G+   +GF+ F+    A  A+EKLN   ++    K+S+ R       S+E+               +G NLYV ++  + N D LRD FSS GTI + +V+ D  G+SKG  F+ F+K +EA  A+   N K+I  G+  L V LA 
Sbjct:  238 TNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTD-AQGKPKGFGFVAFADQDAAGQAVEKLNDSILEGTDCKLSVCRAQKKSERSAELKRKYEALKQERVQRYQGVNLYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDENGRSKGFGFVCFEKPEEATAAVTDMNSKMI--GAKPLYVALAQ 419          

HSP 2 Score: 91.2781 bits (225), Expect = 6.940e-19
Identity = 52/160 (32.50%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKG--------ANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIE 981
            NI +  L + +    +   F+  G I SCK+  D   G S  YGF++F + H A+ AIEK+NG+ + +K + V   +P ++ +K          N++V +   + +Q+KL  +FS  G I +  V+TD+ GK KG  F+ F  +  A +A+E  N  I+E
Sbjct:  146 NIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDD-EGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQGKPKGFGFVAFADQDAAGQAVEKLNDSILE 304          

HSP 3 Score: 85.5001 bits (210), Expect = 4.508e-17
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR--PSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSV 993
            L + F+  GP+ S ++ RD  +  SL Y ++NF    DA+ A++ +N   I  + +++  ++  P++      N+++ ++ R  +   + D FS  G I++C+V TD  G SKG  F+ F+    A+ AIE  NG ++ D  V
Sbjct:   73 LFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERALDTMNFEVIHGRPMRIMWSQRDPAARRAGNGNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDEGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKV 215          
BLAST of Protein elav-like protein vs. Ensembl Celegans
Match: pab-2 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q19579])

HSP 1 Score: 92.4337 bits (228), Expect = 2.611e-19
Identity = 61/185 (32.97%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARP------SSEM--------------IKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ V    +++ Q++L  +F+  G I S  ++ D   G+   +GF+ F+    A  A+EKLN   ++    K+S+ R       S+E+               +G NLYV ++  + N D LRD FSS GTI + +V+ D  G+SKG  F+ F+K +EA  A+   N K+I  G+  L V LA 
Sbjct:  238 TNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTD-AQGKPKGFGFVAFADQDAAGQAVEKLNDSILEGTDCKLSVCRAQKKSERSAELKRKYEALKQERVQRYQGVNLYVKNIEEDLNDDGLRDHFSSFGTITSAKVMVDENGRSKGFGFVCFEKPEEATAAVTDMNSKMI--GAKPLYVALAQ 419          

HSP 2 Score: 91.2781 bits (225), Expect = 6.940e-19
Identity = 52/160 (32.50%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKG--------ANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIE 981
            NI +  L + +    +   F+  G I SCK+  D   G S  YGF++F + H A+ AIEK+NG+ + +K + V   +P ++ +K          N++V +   + +Q+KL  +FS  G I +  V+TD+ GK KG  F+ F  +  A +A+E  N  I+E
Sbjct:  146 NIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDD-EGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKVYVGKFQPRAQRMKELGESGLKYTNVFVKNFGEHLDQEKLSAMFSKFGEITSAVVMTDAQGKPKGFGFVAFADQDAAGQAVEKLNDSILE 304          

HSP 3 Score: 85.5001 bits (210), Expect = 4.508e-17
Identity = 43/143 (30.07%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR--PSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSV 993
            L + F+  GP+ S ++ RD  +  SL Y ++NF    DA+ A++ +N   I  + +++  ++  P++      N+++ ++ R  +   + D FS  G I++C+V TD  G SKG  F+ F+    A+ AIE  NG ++ D  V
Sbjct:   73 LFEKFSMAGPVLSIRVCRDNTSRLSLGYAYVNFQQPADAERALDTMNFEVIHGRPMRIMWSQRDPAARRAGNGNIFIKNLDRVIDNKSVYDTFSLFGNILSCKVATDDEGNSKGYGFVHFETEHSAQTAIEKVNGMLLSDKKV 215          
BLAST of Protein elav-like protein vs. Ensembl Fly
Match: Rbp9 (gene:FBgn0010263 transcript:FBtr0290237)

HSP 1 Score: 198.749 bits (504), Expect = 9.911e-57
Identity = 99/169 (58.58%), Postives = 121/169 (71.60%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQ M QDE+  +F   G +ESCKLIRDKVTGQSL YGF+N+    DA+ AI  LNGL++ NK IKVS+ARPSSE IKGANLYV  +P+N  Q  L  LFS  G IIT R+L D+  G SKGV FIRFD+R EA++AI+  NG   ++ +  + VK AN P
Sbjct:  109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNP 277          

HSP 2 Score: 103.219 bits (256), Expect = 4.503e-23
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NL+PDT ++ +WQLF PFGAVQSV + +D+ +N C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:  356 WCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFK 432          

HSP 3 Score: 53.9138 bits (128), Expect = 2.806e-7
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G ++S K+IRD  + +   +GF+  ++  +A +AI+ LNG  + N++++VS 
Sbjct:  358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSF 431          
BLAST of Protein elav-like protein vs. Ensembl Fly
Match: Rbp9 (gene:FBgn0010263 transcript:FBtr0077640)

HSP 1 Score: 198.749 bits (504), Expect = 9.911e-57
Identity = 99/169 (58.58%), Postives = 121/169 (71.60%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQ M QDE+  +F   G +ESCKLIRDKVTGQSL YGF+N+    DA+ AI  LNGL++ NK IKVS+ARPSSE IKGANLYV  +P+N  Q  L  LFS  G IIT R+L D+  G SKGV FIRFD+R EA++AI+  NG   ++ +  + VK AN P
Sbjct:  109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNP 277          

HSP 2 Score: 103.219 bits (256), Expect = 4.503e-23
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NL+PDT ++ +WQLF PFGAVQSV + +D+ +N C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:  356 WCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFK 432          

HSP 3 Score: 53.9138 bits (128), Expect = 2.806e-7
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G ++S K+IRD  + +   +GF+  ++  +A +AI+ LNG  + N++++VS 
Sbjct:  358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSF 431          
BLAST of Protein elav-like protein vs. Ensembl Fly
Match: Rbp9 (gene:FBgn0010263 transcript:FBtr0100468)

HSP 1 Score: 198.749 bits (504), Expect = 9.911e-57
Identity = 99/169 (58.58%), Postives = 121/169 (71.60%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQ M QDE+  +F   G +ESCKLIRDKVTGQSL YGF+N+    DA+ AI  LNGL++ NK IKVS+ARPSSE IKGANLYV  +P+N  Q  L  LFS  G IIT R+L D+  G SKGV FIRFD+R EA++AI+  NG   ++ +  + VK AN P
Sbjct:  109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNP 277          

HSP 2 Score: 103.219 bits (256), Expect = 4.503e-23
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NL+PDT ++ +WQLF PFGAVQSV + +D+ +N C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:  356 WCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFK 432          

HSP 3 Score: 53.9138 bits (128), Expect = 2.806e-7
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G ++S K+IRD  + +   +GF+  ++  +A +AI+ LNG  + N++++VS 
Sbjct:  358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSF 431          
BLAST of Protein elav-like protein vs. Ensembl Fly
Match: Rbp9 (gene:FBgn0010263 transcript:FBtr0077638)

HSP 1 Score: 198.749 bits (504), Expect = 9.911e-57
Identity = 99/169 (58.58%), Postives = 121/169 (71.60%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQ M QDE+  +F   G +ESCKLIRDKVTGQSL YGF+N+    DA+ AI  LNGL++ NK IKVS+ARPSSE IKGANLYV  +P+N  Q  L  LFS  G IIT R+L D+  G SKGV FIRFD+R EA++AI+  NG   ++ +  + VK AN P
Sbjct:  109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNP 277          

HSP 2 Score: 103.219 bits (256), Expect = 4.503e-23
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NL+PDT ++ +WQLF PFGAVQSV + +D+ +N C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:  356 WCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFK 432          

HSP 3 Score: 53.9138 bits (128), Expect = 2.806e-7
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G ++S K+IRD  + +   +GF+  ++  +A +AI+ LNG  + N++++VS 
Sbjct:  358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSF 431          
BLAST of Protein elav-like protein vs. Ensembl Fly
Match: Rbp9 (gene:FBgn0010263 transcript:FBtr0077639)

HSP 1 Score: 197.593 bits (501), Expect = 3.008e-56
Identity = 99/174 (56.90%), Postives = 121/174 (69.54%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD------SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQ M QDE+  +F   G +ESCKLIRDKVTGQSL YGF+N+    DA+ AI  LNGL++ NK IKVS+ARPSSE IKGANLYV  +P+N  Q  L  LFS  G IIT R+L D      + G SKGV FIRFD+R EA++AI+  NG   ++ +  + VK AN P
Sbjct:  109 KTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITDEHAAGLSKGVGFIRFDQRFEADRAIKELNGTTPKNSTEPITVKFANNP 282          

HSP 2 Score: 103.219 bits (256), Expect = 4.428e-23
Identity = 43/77 (55.84%), Postives = 58/77 (75.32%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NL+PDT ++ +WQLF PFGAVQSV + +D+ +N C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:  361 WCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFK 437          

HSP 3 Score: 53.9138 bits (128), Expect = 2.760e-7
Identity = 23/74 (31.08%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G ++S K+IRD  + +   +GF+  ++  +A +AI+ LNG  + N++++VS 
Sbjct:  363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSF 436          
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Match: elavl2 (ELAV like neuron-specific RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040704-9])

HSP 1 Score: 189.889 bits (481), Expect = 3.955e-54
Identity = 95/169 (56.21%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYMEPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQFGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANNP 206          

HSP 2 Score: 97.4413 bits (241), Expect = 1.977e-21
Identity = 42/99 (42.42%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    ++  +    W IFV NL+PD  ++ +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  255 PMTIDGVTSLAGINLPAHAGTGWCIFVYNLAPDADENVLWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAVAIASLNGYRLGDRVLQVSFK 353          
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 190.66 bits (483), Expect = 5.680e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   87 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 255          

HSP 2 Score: 98.5969 bits (244), Expect = 1.212e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  290 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 388          

HSP 3 Score: 50.0618 bits (118), Expect = 6.425e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  314 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 387          
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Match: elavl2 (ELAV like neuron-specific RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040704-9])

HSP 1 Score: 189.889 bits (481), Expect = 7.529e-54
Identity = 95/169 (56.21%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  NG+     +  + VK AN P
Sbjct:   67 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYMEPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQFGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANNP 235          

HSP 2 Score: 97.0561 bits (240), Expect = 3.677e-21
Identity = 42/99 (42.42%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    ++  +    W IFV NL+PD  ++ +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  284 PMTIDGVTSLAGINLPAHAGTGWCIFVYNLAPDADENVLWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAVAIASLNGYRLGDRVLQVSFK 382          

HSP 3 Score: 49.2914 bits (116), Expect = 9.726e-6
Identity = 22/74 (29.73%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  ++ L ++F P G + + K+IRD  T +   +GF+  ++  +A +AI  LNG ++ +++++VS 
Sbjct:  308 IFVYNLAPDADENVLWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAVAIASLNGYRLGDRVLQVSF 381          
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Match: elavl2 (ELAV like neuron-specific RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-040704-9])

HSP 1 Score: 189.889 bits (481), Expect = 7.971e-54
Identity = 95/169 (56.21%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  NG+     +  + VK AN P
Sbjct:   67 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYMEPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQFGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANNP 235          

HSP 2 Score: 97.0561 bits (240), Expect = 3.842e-21
Identity = 42/99 (42.42%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    ++  +    W IFV NL+PD  ++ +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  283 PMTIDGVTSLAGINLPAHAGTGWCIFVYNLAPDADENVLWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAVAIASLNGYRLGDRVLQVSFK 381          
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 190.274 bits (482), Expect = 9.857e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   87 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 255          

HSP 2 Score: 98.5969 bits (244), Expect = 1.557e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  303 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 401          

HSP 3 Score: 49.6766 bits (117), Expect = 7.088e-6
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  341 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 400          
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Match: pnpla2 (patatin like phospholipase domain containing 2 [Source:Xenbase;Acc:XB-GENE-953517])

HSP 1 Score: 192.586 bits (488), Expect = 5.426e-55
Identity = 97/169 (57.40%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+   +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV S+P+  NQ ++  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     S  + VK AN P
Sbjct:   34 KTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGASEPITVKFANNP 202          

HSP 2 Score: 98.5969 bits (244), Expect = 1.041e-21
Identity = 48/113 (42.48%), Postives = 66/113 (58.41%), Query Frame = 1
Query: 1411 ALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
             ++ F+  T+  V  L  +  T  TTA         W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  244 GVKRFSPITIDSVTNLAGVSLTGPTTAG--------WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 348          

HSP 3 Score: 50.8322 bits (120), Expect = 3.789e-6
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  288 LWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 347          
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Match: pnpla2 (patatin like phospholipase domain containing 2 [Source:Xenbase;Acc:XB-GENE-953517])

HSP 1 Score: 191.815 bits (486), Expect = 1.278e-54
Identity = 97/169 (57.40%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+   +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV S+P+  NQ ++  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     S  + VK AN P
Sbjct:   53 KTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGASEPITVKFANNP 221          

HSP 2 Score: 97.4413 bits (241), Expect = 2.961e-21
Identity = 48/109 (44.04%), Postives = 64/109 (58.72%), Query Frame = 1
Query: 1423 FNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            F+  T+  V  L  +  T  TTA         W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  254 FSPITIDSVTNLAGVSLTGPTTAG--------WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 354          

HSP 3 Score: 50.8322 bits (120), Expect = 3.932e-6
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L     +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  280 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 353          
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 190.274 bits (482), Expect = 2.441e-54
Identity = 97/174 (55.75%), Postives = 119/174 (68.39%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLN 1038
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P   +N
Sbjct:   26 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVN 199          

HSP 2 Score: 95.1301 bits (235), Expect = 1.095e-20
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +   +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  230 PMTIDGMTSLAGINFPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 328          

HSP 3 Score: 50.0618 bits (118), Expect = 6.971e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  254 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 327          
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 190.274 bits (482), Expect = 4.188e-54
Identity = 97/174 (55.75%), Postives = 119/174 (68.39%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLN 1038
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P   +N
Sbjct:   55 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVN 228          

HSP 2 Score: 95.1301 bits (235), Expect = 1.569e-20
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +   +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  259 PMTIDGMTSLAGINFPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 357          

HSP 3 Score: 50.0618 bits (118), Expect = 7.540e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  283 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 356          
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 190.274 bits (482), Expect = 5.329e-54
Identity = 97/174 (55.75%), Postives = 119/174 (68.39%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLN 1038
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P   +N
Sbjct:   66 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKVN 239          

HSP 2 Score: 94.7449 bits (234), Expect = 2.866e-20
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +   +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  270 PMTIDGMTSLAGINFPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 368          

HSP 3 Score: 50.447 bits (119), Expect = 5.620e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  294 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 367          
BLAST of Protein elav-like protein vs. Ensembl Mouse
Match: Elavl3 (ELAV like RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:109157])

HSP 1 Score: 191.045 bits (484), Expect = 6.891e-56
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM QDE   +F  IG IESCKL+RDK+TGQSL YGF+N+S  +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q ++  LFS  G IIT R+L D + G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   37 KTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNP 205          
BLAST of Protein elav-like protein vs. Ensembl Mouse
Match: Elavl1 (ELAV (embryonic lethal, abnormal vision)-like 1 (Hu antigen R) [Source:MGI Symbol;Acc:MGI:1100851])

HSP 1 Score: 189.889 bits (481), Expect = 2.076e-54
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM Q+EL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 4.853e-18
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 53.9138 bits (128), Expect = 2.711e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          

HSP 4 Score: 50.447 bits (119), Expect = 3.704e-6
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  748 LARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNG 969
            +A    + I   NL V  +P+N  Q++LR LFSS G + + +++ D   G S G  F+ +   K+AE+AI   NG
Sbjct:    9 MAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNG 83          
BLAST of Protein elav-like protein vs. Ensembl Mouse
Match: Elavl1 (ELAV (embryonic lethal, abnormal vision)-like 1 (Hu antigen R) [Source:MGI Symbol;Acc:MGI:1100851])

HSP 1 Score: 189.889 bits (481), Expect = 2.076e-54
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM Q+EL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 4.853e-18
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 53.9138 bits (128), Expect = 2.711e-7
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          

HSP 4 Score: 50.447 bits (119), Expect = 3.704e-6
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 1
Query:  748 LARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNG 969
            +A    + I   NL V  +P+N  Q++LR LFSS G + + +++ D   G S G  F+ +   K+AE+AI   NG
Sbjct:    9 MAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNG 83          
BLAST of Protein elav-like protein vs. Ensembl Mouse
Match: Elavl3 (ELAV like RNA binding protein 3 [Source:MGI Symbol;Acc:MGI:109157])

HSP 1 Score: 191.045 bits (484), Expect = 2.182e-54
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM QDE   +F  IG IESCKL+RDK+TGQSL YGF+N+S  +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q ++  LFS  G IIT R+L D + G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNP 206          

HSP 2 Score: 93.5893 bits (231), Expect = 4.092e-20
Identity = 39/77 (50.65%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   G+RV+ V+ +
Sbjct:  284 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFK 360          

HSP 3 Score: 50.0618 bits (118), Expect = 6.571e-6
Identity = 20/60 (33.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++  ++++VS 
Sbjct:  300 LWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSF 359          
BLAST of Protein elav-like protein vs. Ensembl Mouse
Match: Elavl2 (ELAV like RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:1100887])

HSP 1 Score: 189.889 bits (481), Expect = 3.433e-54
Identity = 96/169 (56.80%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNP 206          

HSP 2 Score: 95.5153 bits (236), Expect = 8.446e-21
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  242 PMTIDGMTSLAGINIPGHPGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 340          

HSP 3 Score: 50.0618 bits (118), Expect = 5.180e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  266 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 339          
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Match: sp|Q91584|ELAV3_XENLA (ELAV-like protein 3 OS=Xenopus laevis OX=8355 GN=elavl3 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 3.319e-54
Identity = 97/169 (57.40%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+   +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV S+P+  NQ ++  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     S  + VK AN P
Sbjct:   33 KTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGASEPITVKFANNP 201          

HSP 2 Score: 104.375 bits (259), Expect = 5.650e-23
Identity = 53/123 (43.09%), Postives = 70/123 (56.91%), Query Frame = 1
Query: 1381 HPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            H +    PLS L  F+  T+  V  L  +  T  TTA         W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  227 HQTQRFSPLSILPRFSPITIDSVTNLAGVSLTGPTTAG--------WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 341          
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Match: sp|Q15717|ELAV1_HUMAN (ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 4.090e-54
Identity = 97/169 (57.40%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM QDEL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 3.690e-17
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 54.299 bits (129), Expect = 1.782e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Match: sp|B5DF91|ELAV1_RAT (ELAV-like protein 1 OS=Rattus norvegicus OX=10116 GN=Elavl1 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.452e-53
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM Q+EL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 3.395e-17
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 53.9138 bits (128), Expect = 1.897e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Match: sp|P70372|ELAV1_MOUSE (ELAV-like protein 1 OS=Mus musculus OX=10090 GN=Elavl1 PE=1 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 1.452e-53
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQNM Q+EL  +F+ IG +ES KLIRDKV G SL YGF+N+ ++ DA+ AI  LNGL++ +K IKVS ARPSSE+IK ANLY+  +PR   Q  + D+FS  G II  RVL D + G S+GVAFIRFDKR EAE+AI  FNG      S  + VK A  P
Sbjct:   19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANP 187          

HSP 2 Score: 86.6557 bits (213), Expect = 3.395e-17
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL  D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+++ V+ +
Sbjct:  244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFK 320          

HSP 3 Score: 53.9138 bits (128), Expect = 1.897e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +KI++VS 
Sbjct:  246 IFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSF 319          
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Match: sp|Q60900|ELAV3_MOUSE (ELAV-like protein 3 OS=Mus musculus OX=10090 GN=Elavl3 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.526e-53
Identity = 96/169 (56.80%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM QDE   +F  IG IESCKL+RDK+TGQSL YGF+N+S  +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q ++  LFS  G IIT R+L D + G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNP 206          

HSP 2 Score: 93.5893 bits (231), Expect = 2.863e-19
Identity = 39/77 (50.65%), Postives = 53/77 (68.83%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   G+RV+ V+ +
Sbjct:  284 WCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFK 360          
BLAST of Protein elav-like protein vs. TrEMBL
Match: A0A0A7M1Y8 (Embryonic lethal abnormal vision 4 (Fragment) OS=Schmidtea polychroa OX=50054 GN=elav4 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 5.663e-82
Identity = 178/440 (40.45%), Postives = 244/440 (55.45%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGS----NGKS--VVPSGKVSQNIPIKDISRPV---------------VFCNSQSTIPGMVWRSLFIE------PVRHTFSAPALSLPKLSNLKSEPEFVCTRPILS----ESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYV 1740
            ++TN+IVNYLPQNM Q+E+  +F+ +G +ESCKLIRDK TGQSLSYGF+N+  + DA  AI + NGL++ NKIIKVSLARPSSE IKGANLY+  +P++  Q +L  LFS  GTIITCR+L DS  G SKGVAFIR+D+R EAE AI+  N     +G+  + VKLANTPFN+ N    S    S I++NG+    NG +   VPS   + N  I+ I  P+               V   +    P  V  + F++      P  H    P   +  L  + S   F  + P +     +SIS    ++   T +  P              S    + +P + +  IP TT      + Y      + V NLSPDT +  +WQ F PFGAVQSV L++D  T  C G+G + M NY+EA++A+Q LNG    +R + +
Sbjct:  104 NRTNLIVNYLPQNMTQEEMRNLFSSLGEVESCKLIRDKTTGQSLSYGFVNYQDAKDASNAIRQFNGLRLQNKIIKVSLARPSSETIKGANLYICGLPKSMTQLELEQLFSQYGTIITCRILVDSVTGNSKGVAFIRYDQRYEAETAIKKLNNYTPPNGTEPITVKLANTPFNINN----SCNMQSSILANGNVEYLNGSTNGSVPSNNNNNNNNIRGIIPPLRPNGSNCSDMMPRLDVVMPNNGNQPNGVINTEFVQSSSATMPPSHQLPFPPGQMVCLPQMHSIATFPMSYPGIQHPGLQSISVPPGATTVQTTHLVP--------------SNGGPSPSPFLSIETIPTTTHLIDPNNLY-----CLVVYNLSPDTKEATLWQTFGPFGAVQSVNLARDPQTGKCRGFGLITMPNYHEALLAIQHLNGNSLDNRALQI 520          
BLAST of Protein elav-like protein vs. TrEMBL
Match: A0A164QM89 (ELAV protein 2 OS=Daphnia magna OX=35525 GN=APZ42_028252 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.366e-81
Identity = 166/425 (39.06%), Postives = 227/425 (53.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVT-GQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDS---YGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSN-----------GKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            KTN+IVNYLPQ M Q+E+  +FA IG +ESCKLIRDK+T GQSL YGF+N+  + DA+ AI  LNGL++ NK IKVS ARPSSE IKGANLYV  +P+   Q +L  LF+  G IIT R+L DS    G SKGV FIRFD R EAE+AIE  NG + +  +  + VK AN P N     +          S  +            G  + P+G++ + IP+  ++R            G  W+ + +  V        +S+  LS     P      P+  + +++                   P+LP +A  +   +          IP T              W IFV NL+PDT +  +WQLF PFGAVQSV + +D+ TN C G+GFV M NY+EA++A+Q LNG   G+RV+ V+ +
Sbjct:   42 KTNLIVNYLPQTMTQEEIRSLFASIGEVESCKLIRDKITAGQSLGYGFVNYHRAEDAEKAINTLNGLRLQNKTIKVSFARPSSENIKGANLYVSGIPKTMCQSELETLFAPFGRIITSRILCDSITAAGLSKGVGFIRFDTRGEAERAIEKLNGTVPQGATEPITVKFANNPSNSTKGLAPLAAYLPEFSSGAAAAAAAALGVRRFGGPIHPTGRL-RYIPLSPLAR-----------GGAAWQPMGVTGVNDGVGVNEMSITDLSEGARTPSRFS--PLAGDILAS-------------------PLLPGAAAAAAAAAA------GAAIPGT-------------GWCIFVYNLAPDTEESVLWQLFGPFGAVQSVKVIRDLQTNKCKGFGFVTMTNYDEALVAIQSLNGYTLGNRVLQVSFK 414          
BLAST of Protein elav-like protein vs. TrEMBL
Match: A0A195ESB5 (ELAV-like protein 3 OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_14590 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 2.257e-81
Identity = 179/470 (38.09%), Postives = 234/470 (49.79%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY--------------GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSS--------NTCTF---------NNTPFHPSLPIL----------------PLSALESFNQSTLA------PVVPL-------TCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            KTN+IVNYLPQ+M QDE+  +F+ IG +ESCKLIRDK++GQSL YGF+N+    DA+ AI  LNGL++ NK IKVS ARPSSE IKGANLYV  +P+N  Q  L +LFS  G IIT R+L D+               G SKGV FIRFD+R EAE+AI+  NG I +  S  + VK AN P N                    N K++ P                  +   Q+T         F  P+ H       S+P+       P ++C    L  S   AID S         TC           NN     ++ ++                PL AL S  ++ LA         PL       + +P  T   A         W IFV NL+P+T ++ +WQLF PFGAVQSV + +D+ TN C G+GFV M NY EAV+A+Q LNG   G+RV+ V+ +
Sbjct:   27 KTNLIVNYLPQSMTQDEIRSLFSSIGEVESCKLIRDKLSGQSLGYGFVNYHRPEDAEKAINTLNGLRLQNKTIKVSYARPSSEAIKGANLYVSGLPKNMAQQDLENLFSPYGRIITSRILCDNITVRQFVTGGGDNLPGLSKGVGFIRFDQRVEAERAIQELNGTIPKGSSEPITVKFANNPSN--------------------NNKAIPPL---------------AAYLAPQAT-------RRFGGPIHHPTGRFRYSVPEHRRSTENPHYLC----LERSFRLAIDMSLLNFHIDETTCQGRSEGSVTLSNNRSMFDNIHVISHNNNIKKKKKTSTGSPLFALSSTGKAMLAINKGLQRYSPLAGDLLANSMLPGNTMNGAG--------WCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTNKCKGFGFVTMTNYEEAVVAIQSLNGYTLGNRVLQVSFK 442          
BLAST of Protein elav-like protein vs. TrEMBL
Match: A0A3M7SHD2 (ELAV 3 isoform X8 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_023977 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 3.750e-79
Identity = 164/412 (39.81%), Postives = 230/412 (55.83%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPI-KDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            KTN+IVNYLPQNM QDE+  +F+ IGP+ESCKLI+DK+TGQSL Y F+N+    DA+ A+  LNG+++ NK IKVS ARPSSE IKGANLYV  + +++ Q  L  +FSS GTII+ ++L+D   G SKGV F+RFD+R EAE AI   NGK  ++    L+VK AN+P ++                     KSV+    ++  IPI +   +P  +  S S        + +  P + + + P L  P    + + P      P L+ S+             NTP  P   ++P       N  T A    +   P T+ +  S+S   +  W IFV N+ PDT +  +WQLF PFGAVQ+V + +D  T  C G+GFV M NY EAV A+ CLNG    +R++ V+ +
Sbjct:   57 KTNLIVNYLPQNMTQDEIKALFSSIGPVESCKLIKDKLTGQSLGYAFVNYQIQGDAEKAVNTLNGMRLQNKTIKVSHARPSSESIKGANLYVCGLDKDFGQADLEKMFSSFGTIISSKILSDPKTGASKGVGFVRFDQRYEAEIAISELNGKCYDNMQEPLIVKFANSPTSV---------------------KSVM-GLPLAPFIPINRGFYQP--YRPSASNSYRYSPMTPYCSPDQTSLNTPILPTPLTGMIPATPS--PQTPSLATSLP------------NTPVAPVPTMVPTMV----NGQTTA----ILSTPPTSISNTSLSSINYSGWCIFVYNVGPDTDESLLWQLFGPFGAVQNVKIIRDQQTLKCKGFGFVTMTNYEEAVTAINCLNGFNLNNRILQVSFK 422          
BLAST of Protein elav-like protein vs. TrEMBL
Match: E2IXF8 (ELAV2 OS=Schmidtea mediterranea OX=79327 GN=elav2 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.701e-78
Identity = 158/412 (38.35%), Postives = 217/412 (52.67%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDS-YGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            +KTN+IVNYLP NM Q+E+  +F+ IG +ESCKL+RDK TG+SL Y F+ + +  DA+ AI  LNGL++ NK IKVSLARPSSE IKGANLY+  +P+   Q +L +LFS CG IIT R+L D+  G S+GVAFIRFD+R EA+ AI+  N    E+ +  ++VK AN+                             PS     NI +  + +     N  +       RS  I P++   S   L  P                        ++D           F PSL         + N S LAP            +T +++  G   W IFV NL+P+T D  +WQLF PFGAVQ+V + +D  TN C G+GFV M NY EA++A+Q LNG   G+R++ V+ +
Sbjct:   51 NKTNLIVNYLPPNMTQEEVRALFSSIGVVESCKLVRDKTTGESLGYSFVKYLNYPDAEKAIRTLNGLRLQNKTIKVSLARPSSEAIKGANLYICGLPKKMTQMELENLFSQCGKIITARILYDNKTGLSRGVAFIRFDQRSEAQLAIKKLNSYQPENSTEPIIVKFANS-----------------------------PSTSRQDNISLAILKQAAQIPNQNAQSANPQSRSSLISPLQQLASVARLKYP-----------------------TSMD-----------FMPSL---------TGNNSLLAPAF--------AASTGALTATG---WCIFVYNLAPETDDATLWQLFGPFGAVQTVKIIRDTATNKCKGFGFVTMSNYEEALLAIQSLNGFTLGNRILQVSFK 379          
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:NCBI gene;Acc:103047015])

HSP 1 Score: 190.66 bits (483), Expect = 3.903e-54
Identity = 96/169 (56.80%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  NG+     S  + VK AN P
Sbjct:   67 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGASEPITVKFANNP 235          

HSP 2 Score: 95.1301 bits (235), Expect = 1.355e-20
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+     T+    +I  +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  284 PMAIDGVTSLAGINIPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 382          

HSP 3 Score: 50.447 bits (119), Expect = 4.276e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  308 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 381          
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 190.274 bits (482), Expect = 4.007e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   58 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 226          

HSP 2 Score: 98.5969 bits (244), Expect = 7.419e-22
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  274 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 372          

HSP 3 Score: 49.6766 bits (117), Expect = 5.618e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  298 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 371          
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 189.889 bits (481), Expect = 4.535e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   56 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 224          

HSP 2 Score: 98.2117 bits (243), Expect = 1.048e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  272 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 370          

HSP 3 Score: 50.0618 bits (118), Expect = 4.568e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  296 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 369          
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Match: elavl4 (ELAV like neuron-specific RNA binding protein 4 [Source:NCBI gene;Acc:30737])

HSP 1 Score: 190.66 bits (483), Expect = 5.015e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   87 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 255          

HSP 2 Score: 98.5969 bits (244), Expect = 1.147e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  290 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 388          

HSP 3 Score: 50.0618 bits (118), Expect = 5.738e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  314 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 387          
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:NCBI gene;Acc:103047015])

HSP 1 Score: 190.66 bits (483), Expect = 8.099e-54
Identity = 96/169 (56.80%), Postives = 117/169 (69.23%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  NG+     S  + VK AN P
Sbjct:   67 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGASEPITVKFANNP 235          

HSP 2 Score: 95.5153 bits (236), Expect = 1.469e-20
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+     T+    +I  +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  315 PMAIDGVTSLAGINIPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 413          

HSP 3 Score: 50.0618 bits (118), Expect = 5.168e-6
Identity = 23/74 (31.08%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I V  L  +  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  339 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 412          
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 93.9745 bits (232), Expect = 8.587e-21
Identity = 50/154 (32.47%), Postives = 80/154 (51.95%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIE 981
            KTN+ +  LP      +L K+  P G I S K I DK T Q   YGF++F S   A+ A+  L    +  ++ K     P+       NLY+ ++P + ++ +L  +    G +I+ R+L D+ G S+GV F R +  ++ E  I+ FNGK I+
Sbjct:   57 KTNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTALKANGVQAQMAKQQEQDPT-------NLYISNLPLSMDEQELEGMLKPFGQVISTRILRDANGTSRGVGFARMESTEKCEAVIQHFNGKFIQ 203          
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 2.623e-20
Identity = 49/153 (32.03%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
            KTN+ +  LP      +L+K+  P G I S K I DK T Q   YGF++F     A+ A+  L    I  ++ K     P+       NLY+ ++P   ++ +L  +    G +I+ R+L D  G S+GV F R +  ++ E  I+ FNGK +
Sbjct:   34 KTNLYIRGLPPGTTDQDLVKLCQPYGKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTALKASGIQAQMAKQQEQDPT-------NLYISNLPVTIDEQELEGMLKQFGHVISTRILRDIVGTSRGVGFARMESTEKCEAVIQRFNGKFL 179          
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 88.1965 bits (217), Expect = 1.416e-18
Identity = 56/183 (30.60%), Postives = 97/183 (53.01%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSS----------EMIK--------GANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ +     +M +D+L + F   G   S  ++ D+  G+S  +GF++F    DA+ A+ ++NG +++ + + V  A+             EM+K        G NLYV ++  N + ++LR  F+  GTI + +V+++  G+SKG  F+ F   +EA KA+   NG+I+  GS  L V LA 
Sbjct:  194 TNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDEC-GKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEE-GRSKGFGFVCFSSPEEATKAVTEMNGRIV--GSKPLYVALAQ 372          

HSP 2 Score: 87.8113 bits (216), Expect = 2.048e-18
Identity = 44/140 (31.43%), Postives = 84/140 (60.00%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR--PSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIED 984
            L + F+P GP+ S ++ RD +T +SL Y ++NF    DA+ A++ +N   I  K I++  ++  PS       N+++ ++ ++ +   + D FS+ G I++C+V+ D  G S+G  F+ F+ ++ A++AIE  NG ++ D
Sbjct:   27 LYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGMLLND 165          

HSP 3 Score: 87.0409 bits (214), Expect = 3.468e-18
Identity = 47/167 (28.14%), Postives = 91/167 (54.49%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL-----ARPSSEMIKGA------NLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSV 993
            N+ +  L +++    +   F+  G I SCK++ D+    S  YGF++F +   A  AIEK+NG+ +++++ +        +R   E   GA      N+Y+ +   + ++DKLR+ F   G  ++  V++D  GKS+G  F+ F++ ++A++A+   NGK +   +V
Sbjct:  100 NVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDE--NGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTV 264          

HSP 4 Score: 52.373 bits (124), Expect = 2.540e-7
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSE 768
            N+ V  L  N+  ++L K FAP G I S K++ ++  G+S  +GF+ FSS  +A  A+ ++NG  + +K + V+LA+   E
Sbjct:  298 NLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEE--GRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEE 376          
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 81.2629 bits (199), Expect = 1.694e-17
Identity = 55/194 (28.35%), Postives = 84/194 (43.30%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGAN----------------------LYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVG-LVVKLANTPFN 1029
            D  ++ V  L   +  D+L   FAP G I   ++++D  TG+S  YGF++F    DA+ AI+++ G  +  + I+ + A       KG+                       +Y G + +   +  +R  F   G I+  RV  D     KG +FIRF   + A  AI   NG  IE  SV     K A+ P N
Sbjct:    1 DHYHVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDPVN 189          

HSP 2 Score: 53.1434 bits (126), Expect = 5.156e-8
Identity = 25/74 (33.78%), Postives = 38/74 (51.35%), Query Frame = 1
Query: 1525 IFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNL 1746
            +FV +LSP+ + D++   F PFG +    + KD+ T    GYGFV      +A  A+Q + G   G R +  N 
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNW 78          
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 81.2629 bits (199), Expect = 1.655e-16
Identity = 57/184 (30.98%), Postives = 96/184 (52.17%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAP-IGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSE----------MIK--------GANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            TN+ +     +M  + L + F   +G   S K++ D+  G+S  +GF++F    DA+ A++++N  +++ + I V  A+  +E          M+K        G NLYV ++  N N ++L   FS  GTI + +V+ +  G+S+G  F+ F   +EA KA+   NG+II  GS  L V LA 
Sbjct:   51 TNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDE-GGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEE-GRSRGFGFVCFSSPEEATKAVTEMNGRII--GSKPLYVALAQ 230          

HSP 2 Score: 65.855 bits (159), Expect = 1.333e-11
Identity = 35/115 (30.43%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  655 GFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL--ARPSSEMIKGA------NLYVGSVPRNYNQDKLRDLFSS-CGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGK 972
            GF++F +   A  AIEK+NG+ ++++ + V    +R   E   GA      N+Y+ +   + + ++LR+ F    G  ++ +V+ D  GKSKG  F+ F++ ++A+KA++  N K
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAEFGAKAREFTNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTK 115          

HSP 3 Score: 51.6026 bits (122), Expect = 3.633e-7
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 1
Query: 1525 IFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNL 1746
            ++V+NL  +  D+ +W+ F+PFG + S  +   M      G+GFV   +  EA  AV  +NG + G + +YV L
Sbjct:  157 LYVKNLDDNINDERLWKEFSPFGTITSAKVM--MEEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVAL 228          

HSP 4 Score: 51.6026 bits (122), Expect = 4.358e-7
Identity = 29/81 (35.80%), Postives = 48/81 (59.26%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSE 768
            N+ V  L  N+  + L K F+P G I S K++ ++  G+S  +GF+ FSS  +A  A+ ++NG  I +K + V+LA+   E
Sbjct:  156 NLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEE--GRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEE 234          
BLAST of Protein elav-like protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 89.3521 bits (220), Expect = 3.640e-19
Identity = 46/154 (29.87%), Postives = 85/154 (55.19%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKV--SLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
             ++ V  L  ++ +  L  +F+PIG + S ++ RD +T  SL Y ++NF+     + AIE+LN   I  ++ ++  S   PS       N+++ ++  + +   L D FS  G I++ ++ TD  GKSKG  F+ F++   A++AI+  NG ++
Sbjct:   38 ASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLL 191          

HSP 2 Score: 78.1814 bits (191), Expect = 1.180e-15
Identity = 49/170 (28.82%), Postives = 85/170 (50.00%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMI------------------KGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
            TN+ V  +      ++  ++FA  GPI S  L +D   G+   +GF+N+    DA  A+E LN  +++ + + V  A+  +E +                  +G NL+V ++  + + +KL + F+  GTI + +V+    GKSKG  F+ F   +EA KAI   N +I+
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIV 387          

HSP 3 Score: 74.3294 bits (181), Expect = 2.390e-14
Identity = 48/155 (30.97%), Postives = 82/155 (52.90%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVS--LARPSS----EMIKG--ANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFN 966
            NI +  L  ++    L   F+  G I S K+  D+  G+S  +GF++F     AK AI+ LNG+ ++ + I V+  L+R       E  K    NLYV ++      ++ ++LF+  G I++  +  D+ GK KG  F+ ++K ++A KA+E  N
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280          

HSP 4 Score: 51.2174 bits (121), Expect = 3.662e-7
Identity = 25/72 (34.72%), Postives = 40/72 (55.56%), Query Frame = 1
Query: 1525 IFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYV 1740
            ++V+N++ +TTD+   +LF  FG + S  L KD       G+GFV    + +AV AV+ LN +      +YV
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291          

HSP 5 Score: 46.595 bits (109), Expect = 9.266e-6
Identity = 32/110 (29.09%), Postives = 49/110 (44.55%), Query Frame = 1
Query: 1411 ALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYV 1740
            A+E  N     P+    C    +Q   S+   G  N  IF++NL PD  +  ++  F+ FG + S  ++ D       G+GFV       A  A+  LNG L   + +YV
Sbjct:   95 AIEQLN---YTPIKGRLCRIMWSQRDPSLRKKGSGN--IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198          
BLAST of Protein elav-like protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 82.0333 bits (201), Expect = 5.494e-17
Identity = 46/151 (30.46%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGA--NLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGK 972
            + V  L + + +D L + F   GPI + K++ DK   ++++Y F+ +  SHDA +A++ LNG QI+N I+K++ A  S +       NL+VG +  N + + LR+ F    + ++  V+ D   G S+G  F+ F  + +A+ A++   G+
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQ 226          
BLAST of Protein elav-like protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 68.1662 bits (165), Expect = 1.114e-12
Identity = 42/171 (24.56%), Postives = 91/171 (53.22%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIK--VSLARPSSEMIKGAN-----------LYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGL 999
            I V  L  ++  + L K F  IG +   ++I ++ T +S  YG+++F +   A+ AI+++ G +ID + I   +S ++P+    +              L++G++  N ++D + +LF+  G +++ R+ T     + KG  +++F   ++A+KA++   G+ I++  V L
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340          

HSP 2 Score: 46.595 bits (109), Expect = 7.710e-6
Identity = 22/77 (28.57%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARP 759
            + +  L  N  +D + ++FA  G + S ++     T Q   +G++ FS+  DAK A++ L G  IDN+ +++  + P
Sbjct:  269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSP 345          
BLAST of Protein elav-like protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 66.2402 bits (160), Expect = 6.973e-12
Identity = 37/136 (27.21%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFS--SSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFD 927
            + +  L  +  +D L + F   G +   K+++D  TG+S  +GF++F   SS D  +  + +    +D K+I    A P  E  K   ++VG +  +    +  + FS  GTII  +++ D   G+S+G  F+ +D
Sbjct:  161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHI----LDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYD 292          
BLAST of Protein elav-like protein vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 56.6102 bits (135), Expect = 5.245e-9
Identity = 44/183 (24.04%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNG-LQIDNKII------------KVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFN 1029
            + +I V  L  +   ++L ++F  +G +    +I  K  G     G + F+ +   + AI K +G L +D K++            + S      E+  G  +++ ++P + N   L+D+F  CG ++   V  D  G S+G   + +    E  +AI+ FNG  +E    G V+++    FN
Sbjct:  121 ENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK--GHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVE----GRVLEVREGRFN 297          
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 172.555 bits (436), Expect = 1.549e-48
Identity = 78/169 (46.15%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            ++TN+I+NY+P +M Q+++ K+F  +G + SCKLIRD+ TGQSL Y F+N+ +  DA  A+ ++NG ++ NK +KVS ARPSS  IK ANLY+  +P++  ++++  LF   G IIT +VL D  G+ +G  F+RFDKR EA+ AI+  N K +   +V L VK AN P
Sbjct:    8 ERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANPP 176          

HSP 2 Score: 83.5741 bits (205), Expect = 1.690e-17
Identity = 81/334 (24.25%), Postives = 151/334 (45.21%), Query Frame = 1
Query:  784 NLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDIS---RPVVF------CNSQSTIPGMVWRSLFIEPVRHT--FSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            NL +  VP + +Q+ ++ +F + G + +C+++ D + G+S G AF+ +D   +A KA+   NG  +++ +  L V  A      +   +  +      M          P GK+  +  +KD+S   R   F      C +Q+ I  +  ++L    V+ T  F+ P  S         +P    + P L+  +  A+       F+  P H  +  +  S + + + S        +    ++ +  ++S    + W IFV  L  + T   +++LF+P+GA+ ++ L  D       GYGFV M NY EA  A+ CLNGT    +++ V+ +
Sbjct:   11 NLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKT--LKVSFARPSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLTVKFANPPNS--------RQPAMPLS-PALTSPLGRALTPQRN--FSGGPVHHQMLNMRYSPMTASSFSPACQANCHSPNNSSSNSYTNLSGLTPQGWCIFVYGLPQEATPLFLYKLFSPYGAITNIELKLD------KGYGFVNMSNYEEACHAICCLNGTPQHGKILQVSFK 325          
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 143.665 bits (361), Expect = 2.875e-38
Identity = 64/167 (38.32%), Postives = 106/167 (63.47%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLAN 1017
            KT +IVNY+PQ+M       +F  +  + +CK++R K +G S  +GF++++++ DA+ AI+KLNG  I NK++KV+ +RP  +  KGANLYV ++P+   + + R  F + G I+ CR+L D S G  KG  F+ +DK+ EA+ AI   +G      ++GL ++ A+
Sbjct:    4 KTTLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYAD 170          
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Match: EDO49588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR7])

HSP 1 Score: 84.7297 bits (208), Expect = 6.847e-19
Identity = 58/172 (33.72%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVG------LVVKLAN 1017
            KTN+ +  L  N   D+L+++    G I S K I DK T     YGF++F S   A+ A+  L      NK I+  +A+   +     NLY+ ++P+N ++  L ++FS  G +I+ R+L D    SKGV F R +  ++ E+ I+ FN K++  G V       LVVK A+
Sbjct:   14 KTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAALV-----NKGIQAQMAKQQEQ--DPTNLYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDTNSKGVGFARMESAEKCEQVIKDFNKKMLP-GEVSLRCIQELVVKFAD 177          
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 85.5001 bits (210), Expect = 1.877e-17
Identity = 48/159 (30.19%), Postives = 89/159 (55.97%), Query Frame = 1
Query:  526 NIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMI--------KGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
            NI +  L +++    L   F+  G I SCK+ +D++ G    YGF++F +   A  AI +++G+ +++K + V       E I        K  N+YV +   + + ++++++ +  G I++ +V+TD  GKSKG  F+ F+  +EAE+A+ + NGK I
Sbjct:  102 NIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDEL-GNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEI 259          

HSP 2 Score: 82.4185 bits (202), Expect = 1.908e-16
Identity = 49/170 (28.82%), Postives = 87/170 (51.18%), Query Frame = 1
Query:  523 TNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEM------------------IKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
            TN+ V     +M  +++ ++ A  G I S K++ D   G+S  +GF++F +  +A+ A+  LNG +I  + +    A+  +E                    +G NLY+ ++    + ++LR+ FS  GTI + +V+ D  G SKG  F+ F   +EA KA+   NG+I+
Sbjct:  194 TNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDP-EGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMNGRIL 362          
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 80.8777 bits (198), Expect = 2.310e-16
Identity = 48/153 (31.37%), Postives = 86/153 (56.21%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIK-GANLYVGSVPRNYNQDKLRDLFSSCGTII-TCRVLTDS-YGKSKGVAFIRFDKRKEAEKAIEMFNGKII 978
            I V  L + + +  + ++F   GP+ +  + +D++T     YGF+ F    DA  AI+ +N +++  K I+V+ A   ++ +  GANL++G++    ++  L D FS+ G I+ T +++ DS  G SKG AFI F     ++ AIE  NG+ +
Sbjct:   15 IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYL 167          
BLAST of Protein elav-like protein vs. Ensembl Medaka
Match: ENSORLT00000000111.2 (ELAV-like protein 1 [Source:NCBI gene;Acc:101172398])

HSP 1 Score: 189.504 bits (480), Expect = 4.001e-54
Identity = 95/169 (56.21%), Postives = 119/169 (70.41%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTD-SYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +TN+IVNYLPQ+M QDEL  +F+ +G +ES KLIRDKV G SL YGF+NF + +DA+ AI  LNGL++ +K IKVS ARPSS+ IK ANLY+  +PR   Q  L D+F+S G II  RVL D + G S+GVAFIRFDKR EAE A++  NG     GS  + VK A  P
Sbjct:   51 QTNLIVNYLPQSMTQDELRSLFSSVGEVESAKLIRDKVAGHSLGYGFVNFVNPNDAERAISTLNGLRLQSKTIKVSFARPSSDTIKDANLYISGLPRTLGQQDLEDMFASFGRIINSRVLVDQASGLSRGVAFIRFDKRSEAEDAVKHLNGHTPPGGSEPITVKFAVNP 219          

HSP 2 Score: 87.8113 bits (216), Expect = 2.191e-18
Identity = 36/77 (46.75%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1519 WIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            W IF+ NL+ D  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY EA +A+  LNG   GD+V+ V+ +
Sbjct:  274 WCIFIYNLTQDADEGMLWQMFGPFGAVVNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIHSLNGYRMGDKVLQVSFK 350          

HSP 3 Score: 53.5286 bits (127), Expect = 3.253e-7
Identity = 24/74 (32.43%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            I +  L Q+  +  L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +K+++VS 
Sbjct:  276 IFIYNLTQDADEGMLWQMFGPFGAVVNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIHSLNGYRMGDKVLQVSF 349          
BLAST of Protein elav-like protein vs. Ensembl Medaka
Match: elavl4 (ELAV like RNA binding protein 4 [Source:NCBI gene;Acc:101162996])

HSP 1 Score: 189.889 bits (481), Expect = 9.961e-54
Identity = 95/169 (56.21%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   81 KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNP 249          

HSP 2 Score: 97.8265 bits (242), Expect = 1.697e-21
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +I  +    W IFV NLSPD+ +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  297 PITIDSMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 395          

HSP 3 Score: 50.0618 bits (118), Expect = 5.261e-6
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  335 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 394          
BLAST of Protein elav-like protein vs. Ensembl Medaka
Match: elavl3 (ELAV like RNA binding protein 3 [Source:NCBI gene;Acc:101155436])

HSP 1 Score: 187.963 bits (476), Expect = 1.583e-53
Identity = 94/169 (55.62%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+E   +F  IG IESCKL+RDK+TGQSL YGF+N+   +DA  AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+  +Q  +  LFS  G IIT R+L D   G S+GV FIRFDKR EAE+AI+  NG+     +  + VK AN P
Sbjct:   37 KTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAEPITVKFANNP 205          

HSP 2 Score: 95.9005 bits (237), Expect = 5.411e-21
Identity = 43/99 (43.43%), Postives = 61/99 (61.62%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+T    T+    +++      W IFV NLSP+  +  +WQLF PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  253 PITIDSMTSLAGVNLTGPTGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFK 351          

HSP 3 Score: 50.8322 bits (120), Expect = 2.343e-6
Identity = 20/60 (33.33%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  571 LLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSL 750
            L ++F P G + + K+IRD  T +   +GF+  ++  +A MAI  LNG ++ +++++VS 
Sbjct:  291 LWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSF 350          
BLAST of Protein elav-like protein vs. Ensembl Medaka
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:NCBI gene;Acc:101165347])

HSP 1 Score: 186.037 bits (471), Expect = 5.831e-53
Identity = 94/169 (55.62%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  N +     +  + VK AN P
Sbjct:   38 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNCQKPPGATEPITVKFANNP 206          

HSP 2 Score: 95.9005 bits (237), Expect = 4.418e-21
Identity = 42/99 (42.42%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1453 PLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            P+     T+    +I  +    W IFV NL+PD  +  +WQ+F PFGAV +V + +D  TN C G+GFV M NY+EA +A+  LNG   GDRV+ V+ +
Sbjct:  244 PMAIDGVTSLAGINIPGHAGTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAVAIASLNGYRLGDRVLQVSFK 342          
BLAST of Protein elav-like protein vs. Ensembl Medaka
Match: ELAVL2 (ELAV like RNA binding protein 2 [Source:NCBI gene;Acc:101165347])

HSP 1 Score: 186.422 bits (472), Expect = 2.064e-52
Identity = 94/169 (55.62%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  520 KTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            KTN+IVNYLPQNM Q+EL  +F  IG IESCKL+RDK+TGQSL YGF+N+    DA+ AI  LNGL++  K IKVS ARPSS  I+ ANLYV  +P+   Q +L  LFS  G IIT R+L D   G S+GV FIRFD+R EAE+AI+  N +     +  + VK AN P
Sbjct:   67 KTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNCQKPPGATEPITVKFANNP 235          
BLAST of Protein elav-like protein vs. Planmine SMEST
Match: SMESG000073310.1 (SMESG000073310.1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 522/524 (99.62%), Postives = 523/524 (99.81%), Query Frame = 1
Query:  184 MFIEKLERTKFKPIQPTXXXXXXXXXXISYQQIMNSKLRNSKIDCDDNSKSKCVSSSXXXXXXXXXXXXXXXXCVDTNGSEIDQIKEDNNEMPDSXXXXXXXXXXXXXXXXDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF 1755
            MFIEKLERTKFKPIQPTKNDSSNDKSKISYQQIMNSKLRNSKIDCDDNSKSKCVSSSIFIGNFDDIINNNEEICVDTNGSEIDQIKEDNNEMPDSGNGSLLNNENNQSNNEDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNPKSKSVPKSSPIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEP+RHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTL PVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF
Sbjct:    1 MFIEKLERTKFKPIQPTKNDSSNDKSKISYQQIMNSKLRNSKIDCDDNSKSKCVSSSIFIGNFDDIINNNEEICVDTNGSEIDQIKEDNNEMPDSGNGSLLNNENNQSNNEDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNPKSKSVPKSSPIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPIRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLTPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF 524          
BLAST of Protein elav-like protein vs. Planmine SMEST
Match: SMESG000073310.1 (SMESG000073310.1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 502/524 (95.80%), Postives = 503/524 (95.99%), Query Frame = 1
Query:  184 MFIEKLERTKFKPIQPTXXXXXXXXXXISYQQIMNSKLRNSKIDCDDNSKSKCVSSSXXXXXXXXXXXXXXXXCVDTNGSEIDQIKEDNNEMPDSXXXXXXXXXXXXXXXXDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF 1755
            MFIEKLERTKFKPIQPTKNDSSNDKSKISYQQIMNSKLRNSKIDCDDNSKSKCVSSSIFI                    EIDQIKEDNNEMPDSGNGSLLNNENNQSNNEDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNPKSKSVPKSSPIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEP+RHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTL PVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF
Sbjct:    1 MFIEKLERTKFKPIQPTKNDSSNDKSKISYQQIMNSKLRNSKIDCDDNSKSKCVSSSIFI--------------------EIDQIKEDNNEMPDSGNGSLLNNENNQSNNEDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNPKSKSVPKSSPIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPIRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLTPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLRFF 504          
BLAST of Protein elav-like protein vs. Planmine SMEST
Match: SMESG000027406.1 (SMESG000027406.1)

HSP 1 Score: 265.003 bits (676), Expect = 4.730e-82
Identity = 158/412 (38.35%), Postives = 217/412 (52.67%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDS-YGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNXXXXXXXXXXXIMSNGSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRHTFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFHPSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFVENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEAVIAVQCLNGTLFGDRVMYVNLR 1749
            +KTN+IVNYLP NM Q+E+  +F+ IG +ESCKL+RDK TG+SL Y F+ + +  DA+ AI  LNGL++ NK IKVSLARPSSE IKGANLY+  +P+   Q +L +LFS CG IIT R+L D+  G S+GVAFIRFD+R EA+ AI+  N    E+ +  ++VK AN+                             PS     NI +  + +     N  +       RS  I P++   S   L  P                        ++D           F PSL         + N S LAP            +T +++  G   W IFV NL+P+T D  +WQLF PFGAVQ+V + +D  TN C G+GFV M NY EA++A+Q LNG   G+R++ V+ +
Sbjct:   51 NKTNLIVNYLPPNMTQEEVRALFSSIGVVESCKLVRDKTTGESLGYSFVKYLNYPDAEKAIRTLNGLRLQNKTIKVSLARPSSEAIKGANLYICGLPKKMTQMELENLFSQCGKIITARILYDNKTGLSRGVAFIRFDQRSEAQLAIKKLNSYQPENSTEPIIVKFANS-----------------------------PSTSRQDNISLAILKQAAQIPNQNAQSANPQSRSSLISPLQQLASVARLKYP-----------------------TSMD-----------FMPSL---------TGNNSLLAPAF--------AASTGALTATG---WCIFVYNLAPETDDATLWQLFGPFGAVQTVKIIRDTATNKCKGFGFVTMSNYEEALLAIQSLNGFTLGNRILQVSFK 379          
BLAST of Protein elav-like protein vs. Planmine SMEST
Match: SMESG000049916.1 (SMESG000049916.1)

HSP 1 Score: 218.779 bits (556), Expect = 2.261e-62
Identity = 106/175 (60.57%), Postives = 133/175 (76.00%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSY-GKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLN 1038
            ++TN+IVNYLPQNM Q+E+  +F+ +G +ESCKLIRDK TGQSLSYGF+N+    DA  AI + NGL++ NKIIKVSLARPSSE IKGANLY+  +P++  Q +L  LFS  GTIITCR+L DS  G SKGVAFIR+D+R EAE AI+  N     +G+  + VKLANTPFN+ N
Sbjct:  201 NRTNLIVNYLPQNMSQEEMRNLFSSLGEVESCKLIRDKTTGQSLSYGFVNYQDGKDASNAIRQFNGLRLQNKIIKVSLARPSSETIKGANLYICGLPKSMTQLELEQLFSQYGTIITCRILVDSVTGNSKGVAFIRYDQRYEAETAIKKLNNYTPPNGTEPITVKLANTPFNINN 375          

HSP 2 Score: 56.225 bits (134), Expect = 5.857e-8
Identity = 23/76 (30.26%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  529 IIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLAR 756
            ++V  L  + ++  L + F P G ++S  L RD  TG+   +G I   + H+A +AI+ LNG  +DN+ ++++ ++
Sbjct:  546 LVVYNLSPDTKEATLWQTFGPFGAVQSVNLARDPQTGKCRGFGLITMPNYHEALLAIQHLNGNSLDNRALQIAFSQ 621          
BLAST of Protein elav-like protein vs. Planmine SMEST
Match: SMESG000006390.1 (SMESG000006390.1)

HSP 1 Score: 196.823 bits (499), Expect = 2.079e-56
Identity = 96/170 (56.47%), Postives = 122/170 (71.76%), Query Frame = 1
Query:  517 DKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKVTGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGANLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDS-YGKSKGVAFIRFDKRKEAEKAIEMFNGKIIEDGSVGLVVKLANTP 1023
            +KTN+IVNYLPQNM QDE+  +F+ +G +ESCKLIRD+ +G SL YGF+N+    DA  AI  LNGL++ +K IKVSLARPSS+ IKGANLYV  +P+N+    L  LF  CG IIT R+L D+  G SKGV FIRFD+R EA  AI+ FNG +    +  +VVK AN+P
Sbjct:   39 NKTNLIVNYLPQNMSQDEIKNLFSTVGEVESCKLIRDRNSGHSLGYGFVNYFKEEDAGKAILALNGLRLQSKTIKVSLARPSSDSIKGANLYVSGLPKNFTNKDLELLFCRCGKIITSRILNDTNTGHSKGVGFIRFDQRYEAAVAIQNFNGYVPSGATDPIVVKFANSP 208          
The following BLAST results are available for this feature:
BLAST of Protein elav-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELAVL18.517e-5557.40ELAV like RNA binding protein 1 [Source:HGNC Symbo... [more]
ELAVL18.517e-5557.40ELAV like RNA binding protein 1 [Source:HGNC Symbo... [more]
ELAVL22.686e-5459.87ELAV like RNA binding protein 2 [Source:HGNC Symbo... [more]
ELAVL33.380e-5456.80ELAV like RNA binding protein 3 [Source:HGNC Symbo... [more]
ELAVL33.427e-5456.80ELAV like RNA binding protein 3 [Source:HGNC Symbo... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exc-73.558e-5253.25pep chromosome:WBcel235:II:9575971:9581490:1 gene:... [more]
pab-22.611e-1932.97Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-22.611e-1932.97Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-22.611e-1932.97Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-22.611e-1932.97Polyadenylate-binding protein [Source:UniProtKB/T... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbp99.911e-5758.58gene:FBgn0010263 transcript:FBtr0290237[more]
Rbp99.911e-5758.58gene:FBgn0010263 transcript:FBtr0077640[more]
Rbp99.911e-5758.58gene:FBgn0010263 transcript:FBtr0100468[more]
Rbp99.911e-5758.58gene:FBgn0010263 transcript:FBtr0077638[more]
Rbp93.008e-5656.90gene:FBgn0010263 transcript:FBtr0077639[more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elavl23.955e-5456.21ELAV like neuron-specific RNA binding protein 2 [S... [more]
elavl45.680e-5456.21ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl27.529e-5456.21ELAV like neuron-specific RNA binding protein 2 [S... [more]
elavl27.971e-5456.21ELAV like neuron-specific RNA binding protein 2 [S... [more]
elavl49.857e-5456.21ELAV like neuron-specific RNA binding protein 4 [S... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnpla25.426e-5557.40patatin like phospholipase domain containing 2 [So... [more]
pnpla21.278e-5457.40patatin like phospholipase domain containing 2 [So... [more]
trerf12.441e-5455.75transcriptional regulating factor 1 [Source:Xenbas... [more]
trerf14.188e-5455.75transcriptional regulating factor 1 [Source:Xenbas... [more]
trerf15.329e-5455.75transcriptional regulating factor 1 [Source:Xenbas... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elavl36.891e-5656.80ELAV like RNA binding protein 3 [Source:MGI Symbol... [more]
Elavl12.076e-5456.80ELAV (embryonic lethal, abnormal vision)-like 1 (H... [more]
Elavl12.076e-5456.80ELAV (embryonic lethal, abnormal vision)-like 1 (H... [more]
Elavl32.182e-5456.80ELAV like RNA binding protein 3 [Source:MGI Symbol... [more]
Elavl23.433e-5456.80ELAV like RNA binding protein 1 [Source:MGI Symbol... [more]
back to top
BLAST of Protein elav-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91584|ELAV3_XENLA3.319e-5457.40ELAV-like protein 3 OS=Xenopus laevis OX=8355 GN=e... [more]
sp|Q15717|ELAV1_HUMAN4.090e-5457.40ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELA... [more]
sp|B5DF91|ELAV1_RAT1.452e-5356.80ELAV-like protein 1 OS=Rattus norvegicus OX=10116 ... [more]
sp|P70372|ELAV1_MOUSE1.452e-5356.80ELAV-like protein 1 OS=Mus musculus OX=10090 GN=El... [more]
sp|Q60900|ELAV3_MOUSE1.526e-5356.80ELAV-like protein 3 OS=Mus musculus OX=10090 GN=El... [more]
back to top
BLAST of Protein elav-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7M1Y85.663e-8240.45Embryonic lethal abnormal vision 4 (Fragment) OS=S... [more]
A0A164QM891.366e-8139.06ELAV protein 2 OS=Daphnia magna OX=35525 GN=APZ42_... [more]
A0A195ESB52.257e-8138.09ELAV-like protein 3 OS=Trachymyrmex septentrionali... [more]
A0A3M7SHD23.750e-7939.81ELAV 3 isoform X8 OS=Brachionus plicatilis OX=1019... [more]
E2IXF81.701e-7838.35ELAV2 OS=Schmidtea mediterranea OX=79327 GN=elav2 ... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELAVL23.903e-5456.80ELAV like RNA binding protein 2 [Source:NCBI gene;... [more]
elavl44.007e-5456.21ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl44.535e-5456.21ELAV like neuron-specific RNA binding protein 4 [S... [more]
elavl45.015e-5456.21ELAV like neuron-specific RNA binding protein 4 [S... [more]
ELAVL28.099e-5456.80ELAV like RNA binding protein 2 [Source:NCBI gene;... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBMS28.587e-2132.47RNA binding motif single stranded interacting prot... [more]
ENSPMAT00000008168.12.623e-2032.03pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
pabpc41.416e-1830.60poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
tia1l1.694e-1728.35cytotoxic granule-associated RNA binding protein 1... [more]
pabpc41.655e-1630.98poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB13.640e-1929.87Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB15.494e-1730.46Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR11.114e-1224.56Nucleolar protein that binds nuclear localization ... [more]
HRP16.973e-1227.21Subunit of cleavage factor I; cleavage factor I is... [more]
GBP25.245e-924.04Poly(A+) RNA-binding protein; key surveillance fac... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348791.549e-4846.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426732.875e-3838.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495886.847e-1933.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332061.877e-1730.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424172.310e-1631.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein elav-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000111.24.001e-5456.21ELAV-like protein 1 [Source:NCBI gene;Acc:10117239... [more]
elavl49.961e-5456.21ELAV like RNA binding protein 4 [Source:NCBI gene;... [more]
elavl31.583e-5355.62ELAV like RNA binding protein 3 [Source:NCBI gene;... [more]
ELAVL25.831e-5355.62ELAV like RNA binding protein 2 [Source:NCBI gene;... [more]
ELAVL22.064e-5255.62ELAV like RNA binding protein 2 [Source:NCBI gene;... [more]
back to top
BLAST of Protein elav-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073310.10.000e+099.62SMESG000073310.1[more]
SMESG000073310.10.000e+095.80SMESG000073310.1[more]
SMESG000027406.14.730e-8238.35SMESG000027406.1[more]
SMESG000049916.12.261e-6260.57SMESG000049916.1[more]
SMESG000006390.12.079e-5656.47SMESG000006390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032581 ID=SMED30032581|Name=Protein elav-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1925bp
CATTGGCCAGAAATTCCGCCAATGAAAAACAAGCTGATAATGATGGGATT
TTATTATTCTTCATGCTAACCACTTTTGGTTAACATTGATTTGGTTTTCT
CATTTTTACCAACCAACCAAAATAAAAACTCCAACAAAAAAAAACCAAAC
CGAAATAGATTTCAAATAGAAATTCCAAAACACATGTTCATTGAAAAACT
TGAACGAACGAAATTCAAACCGATCCAGCCGACAAAAAATGATTCCTCCA
ATGACAAATCTAAAATCTCCTATCAACAGATTATGAATAGCAAGTTACGT
AATAGCAAAATCGATTGCGATGACAACAGCAAGTCAAAATGCGTTTCTTC
ATCGATTTTTATTGGTAATTTTGATGATATCATTAACAATAATGAAGAGA
TTTGCGTTGACACTAACGGATCAGAGATCGACCAAATCAAAGAAGACAAC
AATGAAATGCCAGATTCTGGAAATGGGTCACTGTTGAATAATGAGAACAA
TCAATCAAATAATGAGGACAAAACGAACATTATCGTTAATTATTTGCCTC
AGAATATGCGTCAAGACGAATTGTTGAAAGTCTTTGCTCCTATAGGACCG
ATTGAAAGCTGTAAACTGATTCGAGACAAAGTAACCGGCCAAAGTTTAAG
TTATGGATTTATAAACTTTTCCAGTTCTCATGACGCTAAAATGGCTATCG
AAAAATTGAATGGTCTTCAAATCGACAACAAAATTATAAAAGTTTCTCTA
GCCAGACCAAGTTCGGAAATGATAAAAGGAGCAAATCTTTATGTTGGTTC
TGTTCCGAGAAATTACAATCAAGATAAACTGCGTGATCTTTTCAGTAGTT
GCGGCACTATAATAACTTGCAGAGTTTTGACGGATTCTTATGGTAAATCA
AAAGGAGTTGCTTTTATTCGGTTCGACAAACGAAAAGAAGCAGAAAAGGC
AATTGAAATGTTTAATGGGAAAATTATCGAAGACGGCTCAGTTGGCCTGG
TGGTGAAATTGGCAAATACTCCGTTCAATTTGCTGAATCCGAAATCAAAA
TCTGTTCCCAAATCGAGTCCGATCATGTCAAATGGGTCAAATGGGAAATC
CGTAGTACCTTCAGGAAAGGTCTCACAGAATATTCCTATCAAAGACATTT
CACGGCCTGTCGTGTTTTGCAACAGCCAATCAACCATTCCCGGTATGGTC
TGGAGATCTCTTTTCATTGAACCAGTCCGACACACTTTCTCTGCGCCAGC
GCTGTCTCTTCCAAAACTTTCAAATTTAAAATCTGAGCCTGAATTTGTAT
GTACAAGGCCCATTCTTTCAGAATCAATATCAAATGCAATCGATTCCTCA
AACACTTGCACTTTCAACAATACGCCATTTCATCCGTCACTTCCAATTCT
ACCTTTAAGTGCTCTGGAATCTTTCAATCAAAGCACATTGGCACCCGTCG
TTCCGCTAACATGTATACCTTGCACAACTCAAACGACAGCATCAATATCT
GACTACGGGTTCAGGAATTGGATCATTTTCGTCGAAAATCTCAGTCCCGA
TACTACAGATGACAATATATGGCAATTATTCAATCCATTTGGGGCGGTTC
AGTCGGTATTTCTATCTAAAGACATGGTGACAAATTCATGTTCTGGGTAC
GGATTTGTTCAAATGATCAATTACAATGAAGCAGTTATTGCTGTCCAGTG
TTTAAATGGAACTTTATTCGGTGATCGAGTGATGTATGTGAATTTGCGAT
TTTTCTAACTGTTGAAATGTTTCGTTTGAATATACTGTTGAAATTTCCTG
ACTAGAACAGATTAAAATGTCTCATTGAAATCCCAAAGATAAAATTGATA
TCCTTGAAAAATTACTATTGTTTCATATTTTCTCTTGTTCTAGCTTTGAT
ATGTTTTGTGAAAAACTATTTTTGA
back to top

protein sequence of SMED30032581-orf-1

>SMED30032581-orf-1 ID=SMED30032581-orf-1|Name=SMED30032581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MFIEKLERTKFKPIQPTKNDSSNDKSKISYQQIMNSKLRNSKIDCDDNSK
SKCVSSSIFIGNFDDIINNNEEICVDTNGSEIDQIKEDNNEMPDSGNGSL
LNNENNQSNNEDKTNIIVNYLPQNMRQDELLKVFAPIGPIESCKLIRDKV
TGQSLSYGFINFSSSHDAKMAIEKLNGLQIDNKIIKVSLARPSSEMIKGA
NLYVGSVPRNYNQDKLRDLFSSCGTIITCRVLTDSYGKSKGVAFIRFDKR
KEAEKAIEMFNGKIIEDGSVGLVVKLANTPFNLLNPKSKSVPKSSPIMSN
GSNGKSVVPSGKVSQNIPIKDISRPVVFCNSQSTIPGMVWRSLFIEPVRH
TFSAPALSLPKLSNLKSEPEFVCTRPILSESISNAIDSSNTCTFNNTPFH
PSLPILPLSALESFNQSTLAPVVPLTCIPCTTQTTASISDYGFRNWIIFV
ENLSPDTTDDNIWQLFNPFGAVQSVFLSKDMVTNSCSGYGFVQMINYNEA
VIAVQCLNGTLFGDRVMYVNLRFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR002343Hud_Sxl_RNA
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002343Paraneoplastic encephalomyelitis antigenPRINTSPR00961HUDSXLRNAcoord: 171..186
score: 55.0
coord: 220..232
score: 53.59
coord: 187..204
score: 72.78
coord: 260..277
score: 33.33
coord: 114..129
score: 78.12
coord: 205..220
score: 30.21
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 447..520
e-value: 4.0E-21
score: 86.2
coord: 115..188
e-value: 3.2E-22
score: 89.8
coord: 201..275
e-value: 3.9E-21
score: 86.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 116..186
e-value: 9.4E-19
score: 67.0
coord: 202..267
e-value: 5.8E-19
score: 67.7
coord: 448..517
e-value: 2.4E-18
score: 65.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 114..192
score: 17.779
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 200..279
score: 17.728
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 446..520
score: 14.556
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 79..196
e-value: 2.5E-27
score: 97.4
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 197..281
e-value: 8.2E-22
score: 79.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 431..521
e-value: 8.5E-19
score: 69.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availablePANTHERPTHR10352EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT Gcoord: 102..521
NoneNo IPR availablePANTHERPTHR10352:SF25FOUND IN NEURONS, ISOFORM A-RELATEDcoord: 102..521
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 111..268
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 440..521