Nitric oxide synthase-interacting protein

Overview
NameNitric oxide synthase-interacting protein
Smed IDSMED30032576
Length (bp)988
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nitric oxide synthase-interacting protein (SMED30032576) t-SNE clustered cells

Violin plots show distribution of expression levels for Nitric oxide synthase-interacting protein (SMED30032576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nitric oxide synthase-interacting protein (SMED30032576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nitric oxide synthase-interacting protein (SMED30032576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032576

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30032576h1SMcG0007307 SmedASXL_010226SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30032576h1SMcG0007307 dd_Smed_v4_5489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Match: NOSIP (nitric oxide synthase interacting protein [Source:HGNC Symbol;Acc:HGNC:17946])

HSP 1 Score: 211.46 bits (537), Expect = 3.760e-66
Identity = 116/302 (38.41%), Postives = 167/302 (55.30%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E                              +VG    DK+KV    FW  +  P +K  ++ KP   V CP++   LR  DL PV F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Match: NOSIP (nitric oxide synthase interacting protein [Source:HGNC Symbol;Acc:HGNC:17946])

HSP 1 Score: 210.305 bits (534), Expect = 1.248e-65
Identity = 116/305 (38.03%), Postives = 167/305 (54.75%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN-------------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E                                 +VG    DK+KV    FW  +  P +K  ++ KP   V CP++   LR  DL PV F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPGDSDDVQPGPSVGPPSKDKDKVLPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 303          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Match: NOSIP (nitric oxide synthase interacting protein [Source:HGNC Symbol;Acc:HGNC:17946])

HSP 1 Score: 163.696 bits (413), Expect = 2.943e-48
Identity = 94/242 (38.84%), Postives = 127/242 (52.48%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRP 761
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E                              +VG    DK+KV    FW  +  P +K  ++ KP   V CP++   LR  DL PV F    S+ D  G      +Y C VT D LSNATP   LRP
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRP 241          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Match: NOSIP (nitric oxide synthase interacting protein [Source:HGNC Symbol;Acc:HGNC:17946])

HSP 1 Score: 119.013 bits (297), Expect = 5.024e-32
Identity = 55/116 (47.41%), Postives = 78/116 (67.24%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE 488
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLE 116          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Match: NOSIP (nitric oxide synthase interacting protein [Source:HGNC Symbol;Acc:HGNC:17946])

HSP 1 Score: 110.153 bits (274), Expect = 1.437e-29
Identity = 50/92 (54.35%), Postives = 67/92 (72.83%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQR 416
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQR 92          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Celegans
Match: R05G6.4 (Nitric oxide synthase-interacting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21755])

HSP 1 Score: 149.058 bits (375), Expect = 2.446e-42
Identity = 90/294 (30.61%), Postives = 139/294 (47.28%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSD------------------------------------------QQMRKFIETNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNEG--KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFA 890
            MTRH KN+TA S YTYHE+++D+  SGYG+   RLGA+S  +F CC +TLQP  + ++S  G +FDR A+LE IL Q+     K+KEY+ Q  +E   A+ A  +                                              +++   E   + N+K DK       FW     P +   ++ KP S V CPV+   ++ K+L  VKF      +     K+ C VT D L+N T    L+ S S++       L+K   +DPI    ++E D++ ++RG + ++
Sbjct:    1 MTRHGKNSTAASVYTYHERRRDAKASGYGTLHARLGADSIKEFHCCSLTLQPCRNPVISPTGYIFDREAILENILAQKKAYAKKLKEYEKQVAEESAAAKIAEGQAETFTKRTQFSAIESTPSRTGAVATPRPEVGSLKRQGGVMSTEIAAKVKAHGEEGVMSNMKGDKS-TSLPSFWIPELNPTAVATKLEKPSSKVLCPVSGKPIKLKELLEVKFTPMPGTETAAHRKFLCPVTRDELTNTTRCAYLKKSKSVVKYDVVEKLIKGDGIDPINGEPMSEDDIIELQRGGTGYS 293          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Fly
Match: CG6179 (gene:FBgn0030915 transcript:FBtr0074558)

HSP 1 Score: 190.274 bits (482), Expect = 3.866e-58
Identity = 102/309 (33.01%), Postives = 163/309 (52.75%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQ--MRKFIETNTVGNIKADKEKVEDR---------------------------------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDN-------EGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH++N TA + YTY+EKK+D+A+SGYG+  +RLG +S   FDCC +TLQP    +++K+G LFD+ A+L+YI+ ++N    ++KEY  +RL+  E+ + + +  S QQ  M +F+         A                                          FW  +  P +   +  KPD+ + CPV++  LR KDL  VKF    + D        E +Y C +T DVLSNA P   LRP+G ++T      L+++ M+ P+ +RK+ EKD++ ++RG + +A    D L ++   P++Q
Sbjct:    1 MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTLQPCRRPVITKDGYLFDKEAILQYIVTKKNEYSRRLKEY--ERLRRAEEDKLSQEANSKQQARMERFVNAEKPAMTPAHSSAAASEKPSTSSAAAAASSESSSASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIYCPVSQKPLRVKDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGDVVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATT-NDHLQAKEKRPMLQ 306          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 183.341 bits (464), Expect = 2.330e-55
Identity = 104/305 (34.10%), Postives = 159/305 (52.13%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF------IETNTVGNIKADKEKVEDR------------------------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPD--------NEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCC ++LQP  D +++++G L+++ A+L+YIL Q+  I  KMK Y+ Q+     + +  SK +  ++  KF      I +  +    + K K E                           FW  +  P +K   + KP   V CP++   L+  DL  V+F    +P          + +Y C VT D L N+ P   LRPSG ++T      L+K+ M+DPI   K+ EKD++ ++RG + FA  G D L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKFKQRENNIVSKPINPFTSGKSKDEGNQNGSTSSSSTDTSSGESSSSSALPSFWIPSLTPEAKPTLLKKPSKTVSCPMSGRPLKMSDLITVRFTPL-DPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGVVVTMECVEKLIKKDMVDPITGDKLKEKDIIPIQRGGTGFAGSGVD-LKAKEARPVMQ 303          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 183.341 bits (464), Expect = 2.330e-55
Identity = 104/305 (34.10%), Postives = 159/305 (52.13%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF------IETNTVGNIKADKEKVEDR------------------------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPD--------NEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCC ++LQP  D +++++G L+++ A+L+YIL Q+  I  KMK Y+ Q+     + +  SK +  ++  KF      I +  +    + K K E                           FW  +  P +K   + KP   V CP++   L+  DL  V+F    +P          + +Y C VT D L N+ P   LRPSG ++T      L+K+ M+DPI   K+ EKD++ ++RG + FA  G D L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKFKQRENNIVSKPINPFTSGKSKDEGNQNGSTSSSSTDTSSGESSSSSALPSFWIPSLTPEAKPTLLKKPSKTVSCPMSGRPLKMSDLITVRFTPL-DPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGVVVTMECVEKLIKKDMVDPITGDKLKEKDIIPIQRGGTGFAGSGVD-LKAKEARPVMQ 303          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 183.341 bits (464), Expect = 2.330e-55
Identity = 104/305 (34.10%), Postives = 159/305 (52.13%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF------IETNTVGNIKADKEKVEDR------------------------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPD--------NEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCC ++LQP  D +++++G L+++ A+L+YIL Q+  I  KMK Y+ Q+     + +  SK +  ++  KF      I +  +    + K K E                           FW  +  P +K   + KP   V CP++   L+  DL  V+F    +P          + +Y C VT D L N+ P   LRPSG ++T      L+K+ M+DPI   K+ EKD++ ++RG + FA  G D L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKFKQRENNIVSKPINPFTSGKSKDEGNQNGSTSSSSTDTSSGESSSSSALPSFWIPSLTPEAKPTLLKKPSKTVSCPMSGRPLKMSDLITVRFTPL-DPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGVVVTMECVEKLIKKDMVDPITGDKLKEKDIIPIQRGGTGFAGSGVD-LKAKEARPVMQ 303          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 106.686 bits (265), Expect = 3.154e-28
Identity = 50/114 (43.86%), Postives = 77/114 (67.54%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF 482
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCC ++LQP  D +++++G L+++ A+L+YIL Q+  I  KMK Y+ Q+     + +  SK +  ++  KF
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKF 114          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 108.997 bits (271), Expect = 3.271e-28
Identity = 55/122 (45.08%), Postives = 80/122 (65.57%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQR--LKEVEDAEKASKEKSDQQMRKFIETNTV 500
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCC ++LQP  D +++++G L+++ A+L+YIL Q+  I  KMK Y+ Q+  LK     E  S+E+   +  K  E N V
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCSLSLQPCRDPVLTEDGYLYEKEAILQYILHQKTEIAKKMKAYEKQKQALKSEGQLESKSEERERAEKFKQRENNIV 122          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Xenopus
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:394625])

HSP 1 Score: 196.438 bits (498), Expect = 2.570e-60
Identity = 104/298 (34.90%), Postives = 165/298 (55.37%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETNTV-----------------------GNIKADKEKVEDR-CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-------DNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTY+EKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G ++++ A+LEYIL Q+  I  +MK YD Q+  +  + ++ +K   + QM+ F++                           G+ ++ +EK +    FW  +  P +K   V KPD  V CP++   L+ KDL PV F             + + +Y C VT D+L N+ P   LRPSG+++T      L+K+ M+DPI   K+ E+D++ ++RG + F+   G  L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYYEKKKDTAASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTSDGYIYEKEAILEYILHQKKEIARQMKAYDKQKNAKKAEMDELNKAAKESQMKAFLDKEMTIVSKPLNPFTRKSDSGADTAEPSGSQQSSEEKGKQLPSFWIPSLTPEAKTSLVKKPDKTVYCPMSGKPLKMKDLIPVHFTAVDEKVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGAVVTMECVEKLIKKDMIDPISGDKLHERDIIMLQRGGTGFSG-SGVLLQAKEARPVMQ 297          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Match: Nosip (nitric oxide synthase interacting protein [Source:MGI Symbol;Acc:MGI:1913644])

HSP 1 Score: 206.838 bits (525), Expect = 1.790e-64
Identity = 112/302 (37.09%), Postives = 168/302 (55.63%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-DNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  ++K Y+ QR    E+ ++  +  +  Q+R F+E                              +VG +  DK+K     FW  +  P +K  ++ KP   V CP++   LR  DL  V+F +  +  D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+    +TE+D++ ++RG + FA   G KL +++S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAG-SGVKLQAEMSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Match: Nosip (nitric oxide synthase interacting protein [Source:MGI Symbol;Acc:MGI:1913644])

HSP 1 Score: 183.341 bits (464), Expect = 1.180e-55
Identity = 105/298 (35.23%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKP--DSIVRCP-VTKDQLRYKDLFPVKFAKFSNPDNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  ++K Y+ QR    E+ ++  +  +  Q+R F+E                              +VG +  DK+K     FW  +  P +K  ++ KP  DS+ R   +T+ +                     +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+    +TE+D++ ++RG + FA   G KL +++S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPS-FWIPSLTPEAKATKLEKPLDDSVDRVGLITRSE---------------------RYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAG-SGVKLQAEMSRPVMQ 275          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Match: Nosip (nitric oxide synthase interacting protein [Source:MGI Symbol;Acc:MGI:1913644])

HSP 1 Score: 150.599 bits (379), Expect = 1.904e-43
Identity = 87/240 (36.25%), Postives = 125/240 (52.08%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-DNEG------KYKCVVTGDVLSNATPLVAL 755
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+   E+  + Y+ QR    E+ ++  +  +  Q+R F+E                              +VG +  DK+K     FW  +  P +K  ++ KP   V CP++   LR  DL  V+F +  +  D  G      +Y C VT D LSNATP   L
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKR--EIARQAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVL 237          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Match: Nosip (nitric oxide synthase interacting protein [Source:MGI Symbol;Acc:MGI:1913644])

HSP 1 Score: 117.857 bits (294), Expect = 4.953e-32
Identity = 54/116 (46.55%), Postives = 79/116 (68.10%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE 488
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  ++K Y+ QR    E+ ++  +  +  Q+R F+E
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLE 116          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Match: Nosip (nitric oxide synthase interacting protein [Source:MGI Symbol;Acc:MGI:1913644])

HSP 1 Score: 119.013 bits (297), Expect = 1.363e-31
Identity = 54/116 (46.55%), Postives = 79/116 (68.10%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE 488
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  ++K Y+ QR    E+ ++  +  +  Q+R F+E
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLE 116          
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Match: sp|Q4R7H4|NOSIP_MACFA (Nitric oxide synthase-interacting protein OS=Macaca fascicularis OX=9541 GN=NOSIP PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.711e-65
Identity = 116/302 (38.41%), Postives = 167/302 (55.30%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E                              +VG    DK+KV    FW  +  P +K  ++ KP   V CP++   LR  DL PV F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDNAQPGPSVGPPSKDKDKVLPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Match: sp|Q9Y314|NOSIP_HUMAN (Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.806e-65
Identity = 116/302 (38.41%), Postives = 167/302 (55.30%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  S   +R F+E                              +VG    DK+KV    FW  +  P +K  ++ KP   V CP++   LR  DL PV F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Match: sp|Q3SWY5|NOSIP_BOVIN (Nitric oxide synthase-interacting protein OS=Bos taurus OX=9913 GN=NOSIP PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.714e-65
Identity = 114/303 (37.62%), Postives = 168/303 (55.45%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE-----------------------------TNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ ++  +  +   +R F+E                              ++ G    DK+K     FW  +  P +K  ++ KP  IV CP++   LR  DL PV+F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGARREEQKELQRAAAQDHVRGFLEKEAAIVSRPLNPFTPKAASAGNGPDDAQPGSSAGPAGKDKDKALPS-FWIPSLTPEAKATKLEKPSRIVTCPMSGKPLRMSDLTPVRFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGEKLTDRDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 301          
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Match: sp|Q9D6T0|NOSIP_MOUSE (Nitric oxide synthase-interacting protein OS=Mus musculus OX=10090 GN=Nosip PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.252e-63
Identity = 112/302 (37.09%), Postives = 168/302 (55.63%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-DNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  ++K Y+ QR    E+ ++  +  +  Q+R F+E                              +VG +  DK+K     FW  +  P +K  ++ KP   V CP++   LR  DL  V+F +  +  D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+    +TE+D++ ++RG + FA   G KL +++S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPS-FWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAG-SGVKLQAEMSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Match: sp|Q6P829|NOSIP_XENTR (Nitric oxide synthase-interacting protein OS=Xenopus tropicalis OX=8364 GN=nosip PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.361e-59
Identity = 104/298 (34.90%), Postives = 165/298 (55.37%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETNTV-----------------------GNIKADKEKVEDR-CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-------DNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTY+EKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G ++++ A+LEYIL Q+  I  +MK YD Q+  +  + ++ +K   + QM+ F++                           G+ ++ +EK +    FW  +  P +K   V KPD  V CP++   L+ KDL PV F             + + +Y C VT D+L N+ P   LRPSG+++T      L+K+ M+DPI   K+ E+D++ ++RG + F+   G  L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYYEKKKDTAASGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTSDGYIYEKEAILEYILHQKKEIARQMKAYDKQKNAKKAEMDELNKAAKESQMKAFLDKEMTIVSKPLNPFTRKSDSGADTAEPSGSQQSSEEKGKQLPSFWIPSLTPEAKTSLVKKPDKTVYCPMSGKPLKMKDLIPVHFTAVDEKVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGAVVTMECVEKLIKKDMIDPISGDKLHERDIIMLQRGGTGFSG-SGVLLQAKEARPVMQ 297          
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Match: V3Z1G9 (zf-NOSIP domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_196769 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.173e-64
Identity = 109/294 (37.07%), Postives = 176/294 (59.86%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE-------------------TNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNE-------GKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQC 944
            MTRH++N+TA + YTYHE+KKD+  SGYGS++ R G +S  +FDCCC+TLQP  + +V+  G L+D+ A+LEYI+ ++  I  +MK ++ Q+ K  +D +     ++ +  +KFI+                   T+++ N+K  KEKV    FW  N  P+++  +V KPD  VRCP+++  ++ KDL PVKF +  + D +        +Y C VT DVL N+ P   LRPSG ++T      L+++ M+DPI   K+ +KD+++++RGAS F+   G  L +++    +QC
Sbjct:    1 MTRHARNSTAGTVYTYHERKKDTNASGYGSKEVRFGKDSVKEFDCCCLTLQPCKNPVVTPQGYLYDKEAILEYIIHKKREIARQMKAFEKQKEKAQKDDQSLIDAETAKNTQKFIDRETNPIVGVGNKSEESKPSTSSLCNMKNGKEKVLPS-FWIPNLTPSAEPTKVKKPDEKVRCPMSEKPIKMKDLIPVKFTEIKDGDTKTALITKTARYVCAVTNDVLGNSVPCAVLRPSGCVVTVDCVEKLIRKDMLDPINGEKLQDKDIIYLQRGASGFSG-SGVGLEAKLDGAAIQC 292          
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Match: A0A1S3G4F5 (Nitric oxide synthase-interacting protein OS=Dipodomys ordii OX=10020 GN=Nosip PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.527e-64
Identity = 120/303 (39.60%), Postives = 169/303 (55.78%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE-------------TNTV-----------GNIKADKEKVEDR-----CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-DNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +VS +G LF+R A+LEYIL Q+  I  +MK Y+ QR    E+ +K  +  +  Q+R F+E             T+ V           G   A   K +DR      FW  +  P +K  ++ KP   V CP++   LR  DL PV+F    +  D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ MMDP+    +TE+D++ ++RG + FA   G KL +++S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVSPDGYLFEREAILEYILHQKKEIARQMKAYEKQRGARREEQKKLQRAAAQDQVRGFLEKEEAIVSRPLNPFTSKVASGPSTEEGQPGPSAAAPSKDKDRDKALPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVRFTPLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVERLIRKDMMDPVSGDALTERDIIVLQRGGTGFAG-SGVKLQAEMSRPVMQ 302          
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Match: I3MNA8 (Nitric oxide synthase-interacting protein OS=Ictidomys tridecemlineatus OX=43179 GN=NOSIP PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.329e-64
Identity = 117/302 (38.74%), Postives = 169/302 (55.96%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETN----------------------------TVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP-DNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR  + E+ +K  +  +  Q+R F+E                              +VG    DK+K     FW  +  P +K  ++ KP  IV CP++   LR  DL PV+F    +  D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+TE+D++ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGAKREEQKKLQRAAAQDQVRGFLEKEAAIVSRPLNPFTSKVIGGTGPDDTQPGPSVGPPSKDKDKALPS-FWIPSLTPEAKATKLEKPSRIVTCPMSGKPLRMSDLTPVRFTPLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDKLTERDIIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Match: A0A182LJ35 (Nitric oxide synthase-interacting protein homolog OS=Anopheles coluzzii OX=1518534 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.821e-64
Identity = 113/294 (38.44%), Postives = 171/294 (58.16%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQ-RLKEVEDAEKASKEKSDQQMRKFIET-------------------NTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDN-------EGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH++N TA + YTYHEKKKD+A SG+G+  RR+G +S   FDCC +TLQP  + +++K+G LFD+ A+L YI+ ++N    KMKEY+ Q +  E EDA KA+ E   +++ KFI T                     + N+   K K E   FW  +  PA+K  R+ KPDS + CPV+   L+ KDL  VKF    +P +       E +Y C VT D+LSN+ P   L+P+G ++T      ++K+ M+ P+ N K++E D++ ++RG + FA    +KL ++   P +Q
Sbjct:    1 MTRHARNCTAGAVYTYHEKKKDAANSGFGTTSRRIGKDSVKSFDCCSLTLQPCRNPVITKDGYLFDKEAILTYIISKKNEYSRKMKEYEKQMKQDEEEDAAKANAE-HQKKLDKFISTEKNIVSNKAVTLNEQPSTSGAISNVSLGKRK-ELPSFWVPSQTPAAKVSRIEKPDSKIYCPVSNKPLKAKDLIEVKFTLVKDPADKKSLIAKENRYMCAVTHDILSNSVPCAVLKPTGDVVTIECIEKIIKKDMIHPLTNEKLSESDIIPLQRGGTGFATT-NEKLEAKEQKPCLQ 291          
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Match: A0A341DBW0 (Nitric oxide synthase-interacting protein OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=NOSIP PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.027e-63
Identity = 116/302 (38.41%), Postives = 168/302 (55.63%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE----------------------------TNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKF-SNPDNEG------KYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEKKKD+A SGYG++  RL  ++   FDCCC++LQP  D +V+ +G L++R A+LEYIL Q+  I  +MK Y+ QR    E+ +   +  +  Q+R F+E                             ++ G    DK+K     FW  +  P +K  ++ KP  IV CP++   LR  DL PV+F    S+ D  G      +Y C VT D LSNATP   LRPSG+++T      L+++ M+DP+   K+T++DV+ ++RG + FA   G KL ++ S PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGARREEQKGLRRAAAQDQVRGFLEKEAAIVSRPLNPFTPKAASGNCPDDARPGSSAGPTGKDKDKALPS-FWIPSLTPEAKATKLEKPSRIVTCPMSGKPLRMSDLTPVRFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTVECVEKLIRKDMVDPVTGEKLTDRDVIVLQRGGTGFAG-SGVKLQAEKSRPVMQ 300          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Cavefish
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:103045142])

HSP 1 Score: 185.652 bits (470), Expect = 3.306e-56
Identity = 105/309 (33.98%), Postives = 157/309 (50.81%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQR--LKEVEDAEKASKEKS-------------DQQMRKFIETNT-------------------VGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPD--------NEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCCC++LQP  D +V+++G L++R A+LEYIL Q+  I  KMK Y+ Q+  LK     E  S+E+               + +  FI   T                                  FW  +  P +K   + KP   V CP++   ++  +L  V+F    +P          + +Y C VT D L N+ P   LRPSGS++T      L+++ MMDP+   K+ EKD++ ++RG + +A  G D L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSVRLGKDAIKDFDCCCLSLQPCRDPVVTEDGFLYEREAILEYILHQKLDIAKKMKAYEKQKQALKSEGQLESCSEEREKVEKFKKREGSIVSKPINPFISGQTKEAPSPSGSVGSLISSSSSASAAGESSSSCSLPSFWIPSLTPEAKPTLLKKPSKTVTCPMSGKSVKMNELITVRFTPL-DPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGSVVTLECVEKLIRKDMMDPVSGDKLKEKDIIVLQRGGTGYAASGVD-LCAKEARPVMQ 307          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Sea Lamprey
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:492793])

HSP 1 Score: 184.882 bits (468), Expect = 1.255e-56
Identity = 108/306 (35.29%), Postives = 166/306 (54.25%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQ------RLKEVEDAEKASKEKS---------DQQMRKFIETNTV---GNIKAD------------KEKVEDR---CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDN-------EGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVM 938
            MTRH +N TA + YTY+EKKKD+A SGYG+++ RL  +S   FDCCC++LQP  + +V+ +G L+++ A+LEYIL Q+     K K Y+ Q       L+E+  AEK SK K+          + +  F   +     G   A+            K  + D+    FW  +  P +K   + KPD  V CP++   LR KDL+ VKF   ++ D        + ++ C VT DVLSN+ P   LRPSG+++T      L+++ M+DP     ++EKD++ ++RG + F+   G  L +Q + PVM
Sbjct:    1 MTRHGRNCTAGAVYTYYEKKKDTAVSGYGTQRARLSKDSIKDFDCCCLSLQPCKEPVVTPDGFLYEKEAILEYILHQKCETVRKTKLYEKQKKKKSTELQELAKAEKESKVKAFLAKEGSIISKPLNPFAPKSAAAWHGPASAEEPAAGSSSSSSAKANLHDKQLPSFWIPSLTPEAKATELKKPDKNVYCPMSGRPLRLKDLYAVKFTAVNDRDTKTALISKQERFVCAVTNDVLSNSVPCAVLRPSGAVVTMECVERLIRKDMIDPTTGEALSEKDIIQLQRGGTGFSG-SGVALEAQEARPVM 305          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Nematostella
Match: EDO40060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S885])

HSP 1 Score: 187.578 bits (475), Expect = 1.778e-57
Identity = 108/307 (35.18%), Postives = 162/307 (52.77%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIE---------------TNTVGNIKADKEKVEDR----------------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDN---------EGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH+KNATA+  Y+ HEK KD+  SGYGS+K RLG +S   FDCC +TLQP  + +++ +G L+D+ A+LE IL Q+  +  KMKEY+ Q+ K + +  +   EK   ++  F+E               T T          ++D                  FW  +  P +K   V KPD+   CP++K  ++ KDL PVKF + ++ +          E +YKC VTGD L N+ P   LR +G ++T      ++K+ M  P  + K+ EKD++ M+RG + FA   G KL ++   PVMQ
Sbjct:    1 MTRHAKNATANPVYSRHEKNKDTKTSGYGSQKVRLGKDSVKDFDCCSLTLQPCREPVITPDGFLYDKEAILECILHQKTEMARKMKEYEKQKKKLLAEESEKISEKEKSKLASFLEMERRITTKPSKAFTATKTTAESSTATVSLDDAKPSTSQGSIIDYKNLPSFWVPSLTPEAKPTLVTKPDNKTYCPMSKKPIKIKDLIPVKFTRANDSEQDASKALVAKEVRYKCAVTGDTLGNSVPCAVLRNTGHVVTLDCVEKIIKKDMFCPFTSVKLKEKDIIPMQRGGTGFAAT-GTKLEAKKDRPVMQ 306          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Medaka
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:101157457])

HSP 1 Score: 189.119 bits (479), Expect = 8.736e-58
Identity = 100/296 (33.78%), Postives = 164/296 (55.41%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF-----------IETNTVGNIKADKEKVEDR----------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP--------DNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQ 941
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCCC++LQP  D +V+ +G L+++ A+LEYIL ++     KMK Y+ Q+  +    +  S+ +  Q++ KF           I   T G  K  + +               FW  +  P +K  ++ KP   V CP++   ++  +L PV+F    +P        + + +Y C VT D L N+ P   LRPSG+++T+     L+++ M+DP+   K++++D++ ++RG + FA  G D L ++ + PVMQ
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSIRLGKDAIKDFDCCCLSLQPCKDPVVTPDGFLYEKQAILEYILHKKTEAAKKMKAYEKQKQAQKSSNQLESQSEEIQKVEKFKSSESSIVSKPINPFTSGQSKDGEAEEPSAAAASSSRTLPSFWIPSLTPEAKPTQLKKPSKAVLCPMSGRPIKMNELIPVRFTPL-DPGLDRVALLNRQDRYVCAVTRDALGNSVPCAVLRPSGAVVTQECVERLIRKDMLDPVSGDKLSDRDIIPLQRGGTGFAGSGVD-LRAKEARPVMQ 294          
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Medaka
Match: nosip (nitric oxide synthase interacting protein [Source:NCBI gene;Acc:101157457])

HSP 1 Score: 175.637 bits (444), Expect = 1.856e-52
Identity = 92/281 (32.74%), Postives = 153/281 (54.45%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKF-----------IETNTVGNIKADKEKVEDR----------CFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNP--------DNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQV 896
            MTRH KN TA + YTYHEK+KD+A SGYG++  RLG ++   FDCCC++LQP  D +V+ +G L+++ A+LEYIL ++     KMK Y+ Q+  +    +  S+ +  Q++ KF           I   T G  K  + +               FW  +  P +K  ++ KP   V CP++   ++  +L PV+F    +P        + + +Y C VT D L N+ P   LRPSG+++T+     L+++ M+DP+   K++++D++ ++R +   A V
Sbjct:    1 MTRHGKNCTAGAVYTYHEKRKDTAASGYGTQSIRLGKDAIKDFDCCCLSLQPCKDPVVTPDGFLYEKQAILEYILHKKTEAAKKMKAYEKQKQAQKSSNQLESQSEEIQKVEKFKSSESSIVSKPINPFTSGQSKDGEAEEPSAAAASSSRTLPSFWIPSLTPEAKPTQLKKPSKAVLCPMSGRPIKMNELIPVRFTPL-DPGLDRVALLNRQDRYVCAVTRDALGNSVPCAVLRPSGAVVTQECVERLIRKDMLDPVSGDKLSDRDIIPLQRVSRHAAAV 280          
BLAST of Nitric oxide synthase-interacting protein vs. Planmine SMEST
Match: SMESG000047838.1 (SMESG000047838.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 266/268 (99.25%), Postives = 267/268 (99.63%), Query Frame = 3
Query:  141 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQC 944
            MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETNTVGNIKADKEKVEDRCFWSNNGAP +KKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQC
Sbjct:    1 MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITLQPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAEKASKEKSDQQMRKFIETNTVGNIKADKEKVEDRCFWSNNGAPTTKKDRVNKPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNEGKYKCVVTGDVLSNATPLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFAQVGGDKLVSQVSAPVMQC 268          
The following BLAST results are available for this feature:
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOSIP3.760e-6638.41nitric oxide synthase interacting protein [Source:... [more]
NOSIP1.248e-6538.03nitric oxide synthase interacting protein [Source:... [more]
NOSIP2.943e-4838.84nitric oxide synthase interacting protein [Source:... [more]
NOSIP5.024e-3247.41nitric oxide synthase interacting protein [Source:... [more]
NOSIP1.437e-2954.35nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R05G6.42.446e-4230.61Nitric oxide synthase-interacting protein homolog ... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG61793.866e-5833.01gene:FBgn0030915 transcript:FBtr0074558[more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nosip2.330e-5534.10nitric oxide synthase interacting protein [Source:... [more]
nosip2.330e-5534.10nitric oxide synthase interacting protein [Source:... [more]
nosip2.330e-5534.10nitric oxide synthase interacting protein [Source:... [more]
nosip3.154e-2843.86nitric oxide synthase interacting protein [Source:... [more]
nosip3.271e-2845.08nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nosip2.570e-6034.90nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nosip1.790e-6437.09nitric oxide synthase interacting protein [Source:... [more]
Nosip1.180e-5535.23nitric oxide synthase interacting protein [Source:... [more]
Nosip1.904e-4336.25nitric oxide synthase interacting protein [Source:... [more]
Nosip4.953e-3246.55nitric oxide synthase interacting protein [Source:... [more]
Nosip1.363e-3146.55nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R7H4|NOSIP_MACFA1.711e-6538.41Nitric oxide synthase-interacting protein OS=Macac... [more]
sp|Q9Y314|NOSIP_HUMAN1.806e-6538.41Nitric oxide synthase-interacting protein OS=Homo ... [more]
sp|Q3SWY5|NOSIP_BOVIN2.714e-6537.62Nitric oxide synthase-interacting protein OS=Bos t... [more]
sp|Q9D6T0|NOSIP_MOUSE1.252e-6337.09Nitric oxide synthase-interacting protein OS=Mus m... [more]
sp|Q6P829|NOSIP_XENTR1.361e-5934.90Nitric oxide synthase-interacting protein OS=Xenop... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3Z1G91.173e-6437.07zf-NOSIP domain-containing protein OS=Lottia gigan... [more]
A0A1S3G4F51.527e-6439.60Nitric oxide synthase-interacting protein OS=Dipod... [more]
I3MNA84.329e-6438.74Nitric oxide synthase-interacting protein OS=Ictid... [more]
A0A182LJ356.821e-6438.44Nitric oxide synthase-interacting protein homolog ... [more]
A0A341DBW01.027e-6338.41Nitric oxide synthase-interacting protein OS=Neoph... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nosip3.306e-5633.98nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nosip1.255e-5635.29nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400601.778e-5735.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nosip8.736e-5833.78nitric oxide synthase interacting protein [Source:... [more]
nosip1.856e-5232.74nitric oxide synthase interacting protein [Source:... [more]
back to top
BLAST of Nitric oxide synthase-interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000047838.10.000e+099.25SMESG000047838.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032576 ID=SMED30032576|Name=Nitric oxide synthase-interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=988bp
TAAAATTAAATATTTTTATAGATTTCGGTTTGCTATTTATTATCTAAATT
AATTATTTTTTGCTAATTAGTTTGTCTCAGATTGTATTTGATATCGATAA
TTAAAATAATTGAATATTATTTCAATTTTTATTTTATAACATGACAAGGC
ATTCAAAAAATGCAACTGCCCATTCTACATACACTTATCATGAAAAAAAG
AAAGATAGTGCAAAATCTGGTTATGGATCACGTAAACGAAGATTAGGAGC
TGAATCAGGATATCAATTTGATTGCTGTTGCATTACACTGCAACCAAGTG
ACGATTTGCTTGTTTCTAAAAATGGAATTTTGTTCGATCGTACTGCAGTA
TTAGAATATATACTTGAACAAAGGAATATTATTGAAGTAAAAATGAAAGA
ATATGATGTTCAAAGGTTAAAAGAAGTCGAAGATGCCGAGAAGGCTTCTA
AAGAGAAAAGTGATCAGCAAATGAGGAAATTCATTGAAACGAATACAGTC
GGTAATATTAAAGCTGACAAAGAGAAGGTTGAAGATCGATGTTTCTGGTC
TAATAATGGCGCTCCAGCATCAAAAAAAGATAGGGTAAACAAGCCGGACT
CAATTGTTCGATGTCCGGTAACAAAGGATCAGTTGCGCTACAAAGATTTG
TTCCCGGTGAAATTCGCGAAATTTTCCAATCCCGATAACGAAGGAAAATA
CAAGTGTGTAGTGACTGGAGATGTTCTATCAAATGCTACTCCGTTGGTGG
CTTTGCGCCCGAGCGGCTCCATCATCACTGAAGCGGCTTACAATAATTTA
GTCAAGCAATCAATGATGGATCCGATCGTGAACAGGAAGATAACGGAGAA
GGATGTTGTGTTTATGAAGCGTGGAGCATCGTCATTTGCACAAGTCGGCG
GGGATAAACTGGTGTCCCAAGTTTCTGCTCCTGTGATGCAGTGCTGAGAT
TATTGTTTTAATAAATATTTTTGATGCTTGAAAAAAAA
back to top

protein sequence of SMED30032576-orf-1

>SMED30032576-orf-1 ID=SMED30032576-orf-1|Name=SMED30032576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=269bp
MTRHSKNATAHSTYTYHEKKKDSAKSGYGSRKRRLGAESGYQFDCCCITL
QPSDDLLVSKNGILFDRTAVLEYILEQRNIIEVKMKEYDVQRLKEVEDAE
KASKEKSDQQMRKFIETNTVGNIKADKEKVEDRCFWSNNGAPASKKDRVN
KPDSIVRCPVTKDQLRYKDLFPVKFAKFSNPDNEGKYKCVVTGDVLSNAT
PLVALRPSGSIITEAAYNNLVKQSMMDPIVNRKITEKDVVFMKRGASSFA
QVGGDKLVSQVSAPVMQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016818NOSIP
IPR031790Znf-NOSIP
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0016740transferase activity
GO:0061630ubiquitin protein ligase activity
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016567protein ubiquitination
GO:0043086negative regulation of catalytic activity
GO:0050999regulation of nitric-oxide synthase activity
GO:0051001negative regulation of nitric-oxide synthase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031790Nitric oxide synthase-interacting protein, zinc-fingerPFAMPF15906zf-NOSIPcoord: 4..78
e-value: 1.8E-24
score: 85.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 13..30
IPR016818Nitric oxide synthase-interacting proteinPANTHERPTHR13063ENOS INTERACTING PROTEINcoord: 117..267
coord: 1..122