MCM5

Overview
NameMCM5 (AFL48194.1)
Smed IDSMED30032563
Length (bp)2408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MCM5 (SMED30032563) t-SNE clustered cells

Violin plots show distribution of expression levels for MCM5 (SMED30032563) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MCM5 (SMED30032563) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MCM5 (SMED30032563) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30032563

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30032563SMESG000005389.1 JX070081smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30032563SMESG000005389.1 JX070081smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30032563SMESG000005389.1 JX070081smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30032563SMESG000005389.1 SmedASXL_012139SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30032563SMESG000005389.1 SmedASXL_012139SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30032563SMESG000005389.1 dd_Smed_v4_5764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032563SMESG000005389.1 dd_Smed_v4_5764_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000005389.1 Contig44592uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000005389.1 Contig44592newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000005389.1 Contig38745uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000005389.1 Contig38745newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000046807.1 SMESG000005389.1 Contig16874uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000046807.1 SMESG000005389.1 Contig16874newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000046807.1 SMESG000005389.1 Contig17685uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30032563SMESG000046807.1 SMESG000005389.1 Contig17685newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30032563SMESG000005389.1 dd_Smed_v6_5764_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30032563SMESG000005389.1 dd_Smed_v4_5764_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30032563SMESG000005389.1 SMED_00943_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032563SMESG000005389.1 SMED_00943_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032563SMESG000005389.1 SmWIOct06_009256GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032563SMESG000005389.1 SMED_09614_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032563SMESG000005389.1 SMED_09614_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30032563SMESG000005389.1 SmWIOct06_041568GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MCM5 vs. Ensembl Human
Match: MCM5 (minichromosome maintenance complex component 5 [Source:HGNC Symbol;Acc:HGNC:6948])

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 416/758 (54.88%), Postives = 563/758 (74.27%), Query Frame = 2
Query:   71 MAGFDEGAVYLST--GRDTQS-ELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENEN-LPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQ--------QDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S   G D Q+ E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L + E    EVA++VT PR   E  L  IQ+MLK D+ P S+R +KS+ +S L+KI G++++AS +++KA  ++++C+ C+  L +++++PGL GY LPRKC    +            CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI +        +D + +   G++ SYIRVL ++++  GS RS   +  V+ +EE+EFR  +  P V+E+I++SIAP I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HV+++H+            +L    A  G + + KLKK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+G L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++I+DF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGR--------PKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGV---GIRSSYIRVLGIQVDTDGSGRSFAGA--VSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVS-----------ALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. Ensembl Human
Match: MCM5 (minichromosome maintenance complex component 5 [Source:HGNC Symbol;Acc:HGNC:6948])

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 396/754 (52.52%), Postives = 537/754 (71.22%), Query Frame = 2
Query:   71 MAGFDEGAVYLST--GRDTQS-ELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQD-SMNMPKD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S   G D Q+ E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L +                                          S+ +S L+KI G++++AS +++KA  ++++C+ C+  L +++++PGL GY LPRKC    +            CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI +   + +  +D    G++ SYIRVL ++++  GS RS   +  V+ +EE+EFR  +  P V+E+I++SIAP I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HV+++H+            +L    A  G + + KLKK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+G L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++I+DF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQL------------------------------------------SDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGR--------PKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGA--VSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVS-----------ALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK 691          
BLAST of MCM5 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 327.02 bits (837), Expect = 4.340e-99
Identity = 221/611 (36.17%), Postives = 324/611 (53.03%), Query Frame = 2
Query:  254 YLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR--LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTR-SGISSLG----VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            +L V  +H+  FD NL  +L+  P E +P F+  VNE+  D  YP   LE++    IQ+        K++R +    I +LI ISG+V+  S +  +      +C+ C     +  V+        P  C         G   T  S       +  ++   +D Q++KLQE+PE++P G+ P    LF    L +K  PG+RV V GI   +    +N     VK  Y   ++V     T + R  G+         ++K  +  +E S KP ++E +A ++AP IY + DIKK I   LFGG+RK       G F R +IN+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN +   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H+++++    +              AE  ++ +  LK YIA+      PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+RL+      D  EA RL + +   SA
Sbjct:  157 FLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFD-RYPDSILEHQ----IQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH---TTRVEMDRGRIAEPSVC---------GRCHTTHSMA-----LIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPI-RVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKF-RAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEE-------------QAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGS----SRGMVSAYP---RQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSA 723          
BLAST of MCM5 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 326.25 bits (835), Expect = 2.982e-98
Identity = 221/611 (36.17%), Postives = 324/611 (53.03%), Query Frame = 2
Query:  254 YLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR--LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTR-SGISSLG----VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            +L V  +H+  FD NL  +L+  P E +P F+  VNE+  D  YP   LE++    IQ+        K++R +    I +LI ISG+V+  S +  +      +C+ C     +  V+        P  C         G   T  S       +  ++   +D Q++KLQE+PE++P G+ P    LF    L +K  PG+RV V GI   +    +N     VK  Y   ++V     T + R  G+         ++K  +  +E S KP ++E +A ++AP IY + DIKK I   LFGG+RK       G F R +IN+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN +   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H+++++    +              AE  ++ +  LK YIA+      PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+RL+      D  EA RL + +   SA
Sbjct:  207 FLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFD-RYPDSILEHQ----IQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH---TTRVEMDRGRIAEPSVC---------GRCHTTHSMA-----LIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPI-RVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKF-RAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEE-------------QAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGS----SRGMVSAYP---RQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSA 773          
BLAST of MCM5 vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 326.25 bits (835), Expect = 2.982e-98
Identity = 221/611 (36.17%), Postives = 324/611 (53.03%), Query Frame = 2
Query:  254 YLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR--LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTR-SGISSLG----VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            +L V  +H+  FD NL  +L+  P E +P F+  VNE+  D  YP   LE++    IQ+        K++R +    I +LI ISG+V+  S +  +      +C+ C     +  V+        P  C         G   T  S       +  ++   +D Q++KLQE+PE++P G+ P    LF    L +K  PG+RV V GI   +    +N     VK  Y   ++V     T + R  G+         ++K  +  +E S KP ++E +A ++AP IY + DIKK I   LFGG+RK       G F R +IN+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN +   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H+++++    +              AE  ++ +  LK YIA+      PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+RL+      D  EA RL + +   SA
Sbjct:  207 FLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFD-RYPDSILEHQ----IQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH---TTRVEMDRGRIAEPSVC---------GRCHTTHSMA-----LIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPI-RVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKF-RAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEE-------------QAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGS----SRGMVSAYP---RQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSA 773          
BLAST of MCM5 vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 394/746 (52.82%), Postives = 534/746 (71.58%), Query Frame = 2
Query:  116 DTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENE-NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI---IQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQA-----ADVNENISLDSLTAET-----GIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEK-ETGK---NTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFV-KQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            DT  EL +E+    ++ + F++ + +  F  +YRD LK N  + +Y L +   HL  FD ++  KL + P + LP  E     VA+++T PR + E  L  IQ+ L LD +P SLR++KS Q+S+++KISG++V+A+ ++SKA  +TL+C+ C+  +P VS+KPGL G+ LPR C A         GQ  Q CP+DPY + PDKC+C D+Q LKLQE PE+VPHGEMPRH QLF +RYL +K VPGNRVT+VG+ SI   IQ+   +    G++  Y+RVL + +E +G  R+  ++   T +EE+ F+  + +   +E+IA+SIAP IYG+ DIKK+IACLLFGG+RKK+P+G+  RGDIN+++LGDPGTAKSQLLKFVEQ +PI VYTSGKGSSAAGLTASVIRD  +RSF+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WDE++GD+NIDFMPTI+SRFDMI++VKD +D  +D  + +HV+ VH+    A     A V +  + DS    T     G + +  LKK++ + R  CGPRLTP+A + + NHYV MR+     +  ++GK   N++IPIT+RQLEAIVRIAES+AKM L  F  +    EA+RLF+VST+ +A TGNL GVEGFT   + + + ++E  MKKRF IG+ VSE  ++QDFV +Q + + ++ KV+  ++RRG++Q K QR++L RV+
Sbjct:   23 DTGRELIAEYRQLITQFRNFIRDFSTGGFGMIYRDQLKRNYFSHEYRLEINLNHLKNFDEDIEMKLRKFPGKVLPALEEAAKIVADEITTPRPKGEEKLHDIQVTLTLDEYPTSLRQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPDVSIKPGLEGFALPRTCAAPQQ------GQM-QRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTF--TPEEERMFKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGGARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVSPIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRGDDNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVHVNASAAKERDIAGVPKTATTDSDGVMTMFDTDGFLTIEFLKKFVTYARLNCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRLFRVSTIEAAATGNLAGVEGFTSTADQEALNRIEVQMKKRFAIGTHVSEHLIVQDFVARQHYRESLVKKVIDNLVRRGDLQQKMQRKMLYRVR 759          
BLAST of MCM5 vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 394/746 (52.82%), Postives = 534/746 (71.58%), Query Frame = 2
Query:  116 DTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENE-NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI---IQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQA-----ADVNENISLDSLTAET-----GIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEK-ETGK---NTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFV-KQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            DT  EL +E+    ++ + F++ + +  F  +YRD LK N  + +Y L +   HL  FD ++  KL + P + LP  E     VA+++T PR + E  L  IQ+ L LD +P SLR++KS Q+S+++KISG++V+A+ ++SKA  +TL+C+ C+  +P VS+KPGL G+ LPR C A         GQ  Q CP+DPY + PDKC+C D+Q LKLQE PE+VPHGEMPRH QLF +RYL +K VPGNRVT+VG+ SI   IQ+   +    G++  Y+RVL + +E +G  R+  ++   T +EE+ F+  + +   +E+IA+SIAP IYG+ DIKK+IACLLFGG+RKK+P+G+  RGDIN+++LGDPGTAKSQLLKFVEQ +PI VYTSGKGSSAAGLTASVIRD  +RSF+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WDE++GD+NIDFMPTI+SRFDMI++VKD +D  +D  + +HV+ VH+    A     A V +  + DS    T     G + +  LKK++ + R  CGPRLTP+A + + NHYV MR+     +  ++GK   N++IPIT+RQLEAIVRIAES+AKM L  F  +    EA+RLF+VST+ +A TGNL GVEGFT   + + + ++E  MKKRF IG+ VSE  ++QDFV +Q + + ++ KV+  ++RRG++Q K QR++L RV+
Sbjct:   23 DTGRELIAEYRQLITQFRNFIRDFSTGGFGMIYRDQLKRNYFSHEYRLEINLNHLKNFDEDIEMKLRKFPGKVLPALEEAAKIVADEITTPRPKGEEKLHDIQVTLTLDEYPTSLRQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPDVSIKPGLEGFALPRTCAAPQQ------GQM-QRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTF--TPEEERMFKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGGARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVSPIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRGDDNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVHVNASAAKERDIAGVPKTATTDSDGVMTMFDTDGFLTIEFLKKFVTYARLNCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRLFRVSTIEAAATGNLAGVEGFTSTADQEALNRIEVQMKKRFAIGTHVSEHLIVQDFVARQHYRESLVKKVIDNLVRRGDLQQKMQRKMLYRVR 759          
BLAST of MCM5 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 327.405 bits (838), Expect = 1.504e-99
Identity = 212/630 (33.65%), Postives = 340/630 (53.97%), Query Frame = 2
Query:  194 VDFNY-VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSL----GVTDKEEK--EFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRK--KMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSAL 2053
            +D N+  Y + L E  + +  ++ +  KHL+ F   L  K++  P + +P  + VVNEV  +    R       SI++        +++R +  N + +LI ISG+V   S +  +  +   +C  C   + S   K  +   V+   C             +   C    + +  ++    D Q++KLQE+P+++P GE P    ++    L E   PG+R+TV GI       +  M  +  + +   V    I+     +   S L    G T  EE+  +  E S +P + + +A+SIAP IY + D+K+ + CLLFGG+RK  +      LR +IN+++ GDPGT+KSQ+L++V +  P + YTSGKGSSA GLTASV RD+ T+  V++ GA+VLAD GV CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN V   W+  K   ENI    T++SRFD+IF++ D  DE +D+++  H++S++  +    +  E++ ++             L+ YIA+ +    P+L+ EA + I   Y+ MR   +++    G+ T+ P   RQLE+++R++E+ AK+RL+      D  +A  L++ +   SA+
Sbjct:  150 IDVNHPYYMERLLECNDAEVTHINLNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAE----RFNRTLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTNC-------------SNTHC----FQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFR-----ATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGNQEKTEHVDMN------------LLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQH----GQITAYP---RQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQSAV 734          
BLAST of MCM5 vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 327.405 bits (838), Expect = 1.504e-99
Identity = 212/630 (33.65%), Postives = 340/630 (53.97%), Query Frame = 2
Query:  194 VDFNY-VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSL----GVTDKEEK--EFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRK--KMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSAL 2053
            +D N+  Y + L E  + +  ++ +  KHL+ F   L  K++  P + +P  + VVNEV  +    R       SI++        +++R +  N + +LI ISG+V   S +  +  +   +C  C   + S   K  +   V+   C             +   C    + +  ++    D Q++KLQE+P+++P GE P    ++    L E   PG+R+TV GI       +  M  +  + +   V    I+     +   S L    G T  EE+  +  E S +P + + +A+SIAP IY + D+K+ + CLLFGG+RK  +      LR +IN+++ GDPGT+KSQ+L++V +  P + YTSGKGSSA GLTASV RD+ T+  V++ GA+VLAD GV CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN V   W+  K   ENI    T++SRFD+IF++ D  DE +D+++  H++S++  +    +  E++ ++             L+ YIA+ +    P+L+ EA + I   Y+ MR   +++    G+ T+ P   RQLE+++R++E+ AK+RL+      D  +A  L++ +   SA+
Sbjct:  150 IDVNHPYYMERLLECNDAEVTHINLNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAE----RFNRTLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTNC-------------SNTHC----FQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFR-----ATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTKLRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGNQEKTEHVDMN------------LLRDYIAYAKANIHPKLSEEASQFIIEKYLFMRKAGAQH----GQITAYP---RQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQSAV 734          
BLAST of MCM5 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 325.479 bits (833), Expect = 3.156e-98
Identity = 223/676 (32.99%), Postives = 353/676 (52.22%), Query Frame = 2
Query:  161 KLKEFLKSYKSV-DFNYVYRDILKENCNTKKYYLPVEWKHLS--FFDPNLADKLMEKPNEFLPIFESVVNEVANDVT--YPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIE-NTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAAD--VNENISL--DSLTAETGI--MPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRF 2143
            + K FL+S+    +    Y  ++K      +  L V +  LS    + N++  L E PNE L I +    EV  ++   Y R+ NE      I +++   P  + +R ++   ++ LI+ +GVV  ASGI  + A +   C  C              GY+L      +    R  +  + Q     P+ +  +    +++Q + +QE+P  V  G +PR   + +   LC+   PG+ + V G+ +     S+N  K G       V N  I  N  + +  ++S  +TD++ K  RE S  P + + +  SIAP IYG+ D+K+AIA  LF G  K       LRGDIN+++ GDPGTAKSQ L++    AP +V T+G+G+SA GLTA V R   TR + +E GAMVLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L++RC+V+AA+N + G ++ T+   EN+D    I+SRFD++ V++D  D   D+++ + V+  H      A   V E   L  D +   TG+  +P   L+KYI + R++C P L  +  +  +N +  MR       KE+    S+ IT+R +E+++R++E+ AK+ L  +  + D   AIR+                +E F + Q+  ++    ++MKK F
Sbjct:  171 RFKNFLRSFHEPGNKQTKYIQMIKSMAADNRESLEVSFTDLSDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNE------IKVRISQLPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVAC--------------GYLLGPFVQQNDEEVRPTICPSCQG--KGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNY-KQGFP-----VFNTLIHANHITNKDKMASDQLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMR-------KESMATGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVM---------------LESFVNTQKASIM----RMMKKTF 792          
BLAST of MCM5 vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 402/751 (53.53%), Postives = 541/751 (72.04%), Query Frame = 2
Query:   71 MAGFDEGAVYLST--GRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENE-NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI------IQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSL-GVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRV 2293
            M GFD+  V+ S   G D Q +          K KEF++++   +F Y YRD LK N    +Y+L +E + L  FD  LADKL ++P E L IFE    EVA+++T PR E+E ++  IQI+L  +++P ++R++KS+ +SKL+KI+G++V+ASGI +KA  ++++C  C   +P++ V PGL GY LPRKC    +            CP+DP++I PDKCKC DFQ LKLQE P+ VP GE+PRH QLF DR LCE+ VPGNRV + GI SI       ++D       GV+  Y+RV+ + +++ G+    IS    +T  EE+ FR  +    ++E +++S+AP I+G+ DIKKAI C+LFGGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+ APIAVYTSGKGSSAAGLTASV++D  TR+FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANS+FG WD+TKG+ENIDFMPTI+SRFDMIF+VKD++DE RD  + +H+++VH+        + N S  S  AE G + +   KKYI +CR  CGPRL+  A + + + YV MRSGA + EK + K  SIPIT+RQLEA++RI+ESLAK+RL PF  +    EA+RLFQVSTL +A+TG+L G EGFT  ++ + + ++EK +K+RF IGSQVSEQ ++QDF++Q + +R + KV+H MIRRGE+Q + QR++L R+
Sbjct:    1 MEGFDDAGVFFSDNFGGDNQQDAQINLQAVKKKYKEFIRTFNEENFFYKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYALPRKCNTEQAGR--------PKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGA--GAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKGEENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHL--------SSNKSAPSEPAE-GEISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGSLAGAEGFTTEEDQETLNRIEKQLKRRFAIGSQVSEQNILQDFLRQKYEERTVMKVIHTMIRRGELQHRMQRKMLYRI 732          
BLAST of MCM5 vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 329.717 bits (844), Expect = 1.045e-99
Identity = 217/679 (31.96%), Postives = 354/679 (52.14%), Query Frame = 2
Query:  158 SKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDV--TYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSE 2167
            ++ + FL+++      Y YRD ++  C        V +  L+  +  LA  L E P + L IF+ V  ++   +  TY R+  E      I +++   P  + LR  +   +++L++  GVV + +G+  + + +   C  C              GYVL     +  +  + G      SCP      P+ I  ++    ++Q + LQE+P  +P G +PR   + +   LC++  PG+ + V GI +     S+N  +     + + + N  +     ++  + SL  TD++    ++ S  P + E +  S+AP IYG+  IK+A+A  LFGG  K   E   +RGDIN+++ GDPGTAKSQ LK+ E+ AP AV+T+G+G+SA GLTA V R+  +R + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN++    I+SRFD++ VVKD +D  +D+Q+ + V+  HM    + +    +    L     I P   L++YI + ++   P+LT      I   Y  +R       +E+    S+PIT+R +E+++R++E+ A+M L    +EAD   AIR+                +E F + Q+  V+ K+    +K        SE
Sbjct:  182 NRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTE------IHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKC--------------GYVLGPFVQSQNTEIKPG------SCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVV--VKDSKQVVQSL--TDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEI-PQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLR-------QESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMM---------------LESFIEAQKFSVMKKMRSTFQKYLSFQKDHSE 807          
BLAST of MCM5 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 311.227 bits (796), Expect = 5.298e-93
Identity = 220/691 (31.84%), Postives = 363/691 (52.53%), Query Frame = 2
Query:  158 SKLKEFLKSY-----------KSVDFNY-VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPG-LNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGI--SSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTRSGISSLGVTDKEEKEFREF-SLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE--GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRS-GASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA---LTGNLE------GVEGFTDRQEHDVIVKVEKLMKKR 2140
            SK K F+  +           +++D N  +Y   L+E    ++ YL +   HL  FD +L  +L+  P E +P F+  +NE+  +  YP    E+   IQ+        +++R +    + +LI ISG+V+ +S +  +       C  C  +  +V V  G +N   L   C                 C    + +  ++ +  D Q++KLQE+P+++  G+ P +  L+    L +K  PG+RVTV GI  ++ ++   ++     V  +++ V++  +++N            +   E  E  +  + KP +++ +AR+IAP IY N DIKK I   LFGG++KK         R +I++++ GDPGT+KSQ+L++V    P + YTSG+GSSA GLTA V +D  TR  V++ GA+VLAD GV CIDEFDKM +  R  +HE MEQQT+SIAKAGI   LN+R S+LAAAN     W++ K   +N+    T++SRFD+IF+V D  DE  DK++  H++S++              +     E  +  +  L+ YIA+ R+   P L+ EA + +   YV MR  GA       G+ ++ P   RQLE+++R++E+ AK+RL+      D  EA RL + +   SA   L+G ++      G+     ++  D++  +++ +KK+
Sbjct:  166 SKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFE-RYPAALLEH--QIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICS-FSTTVEVDRGRINQPTLCTNC-------------NTNHC----FRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYY-------------VTRHEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGR-----GQISAYP---RQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKK 814          
BLAST of MCM5 vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 311.227 bits (796), Expect = 5.298e-93
Identity = 220/691 (31.84%), Postives = 363/691 (52.53%), Query Frame = 2
Query:  158 SKLKEFLKSY-----------KSVDFNY-VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPG-LNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGI--SSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTRSGISSLGVTDKEEKEFREF-SLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE--GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRS-GASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA---LTGNLE------GVEGFTDRQEHDVIVKVEKLMKKR 2140
            SK K F+  +           +++D N  +Y   L+E    ++ YL +   HL  FD +L  +L+  P E +P F+  +NE+  +  YP    E+   IQ+        +++R +    + +LI ISG+V+ +S +  +       C  C  +  +V V  G +N   L   C                 C    + +  ++ +  D Q++KLQE+P+++  G+ P +  L+    L +K  PG+RVTV GI  ++ ++   ++     V  +++ V++  +++N            +   E  E  +  + KP +++ +AR+IAP IY N DIKK I   LFGG++KK         R +I++++ GDPGT+KSQ+L++V    P + YTSG+GSSA GLTA V +D  TR  V++ GA+VLAD GV CIDEFDKM +  R  +HE MEQQT+SIAKAGI   LN+R S+LAAAN     W++ K   +N+    T++SRFD+IF+V D  DE  DK++  H++S++              +     E  +  +  L+ YIA+ R+   P L+ EA + +   YV MR  GA       G+ ++ P   RQLE+++R++E+ AK+RL+      D  EA RL + +   SA   L+G ++      G+     ++  D++  +++ +KK+
Sbjct:  166 SKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFE-RYPAALLEH--QIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICS-FSTTVEVDRGRINQPTLCTNC-------------NTNHC----FRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYY-------------VTRHEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGR-----GQISAYP---RQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKK 814          
BLAST of MCM5 vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0340476)

HSP 1 Score: 288.115 bits (736), Expect = 6.998e-85
Identity = 177/472 (37.50%), Postives = 261/472 (55.30%), Query Frame = 2
Query:  737 DFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQ----AADVNENISLDSLTAETG---------------------IMPVLKLKKYIAFCRDQC-GPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSAL 2053
            D Q L +QE PE  P G++PR   +  D  L ++  PG+RV +VG         +   + G      R   V + N  S  S  S+L ++ ++    ++ +    + E++++S+AP I+G+  +K+AI CLL GG  K +P G  LRGDIN++++GDP  AKSQLL++V   AP A+ T+G+GSS  GLTA+V  D  T    +E GAMVLAD GVVCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN V+G +D+ K   ENI    +++SRFD++FV+ DV D   D+ I +HV+ +H        DG+     +   +++S  S + E                       I+ V  ++KYI   +  C  P+L  +A + I N Y  +R   S+   ET    + PIT R LE ++R++ + A+ R++      DA  AI L Q +     L
Sbjct:  192 DHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVG-----SYRCLPGKRGGYTSGTFRT--VLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAK--CMKPKLGEQACEAIANEYSRLR---SQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVL 651          
BLAST of MCM5 vs. Ensembl Zebrafish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 416/757 (54.95%), Postives = 551/757 (72.79%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHS----KLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI---IQQDSMNMPKD---GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  VY S        +  E  +  S    K +EFL+ ++       F Y YRD LK +    +Y++ VE + L+ FD +L+D L + P E LP+ E    EVA++VT PR +  E +  IQ+MLK D+HP S+R +KS Q+S+L+KI G+++S++ +++KA  + L+C+GC+  + ++ + PGL GY LPRKC  +  + R         CPVDPY+I PD+C C DFQ  +LQEAP+ VPHGEMPRH QL+ DRYLC++ VPGNRVTV+GI SI    Q  +    K    G++ +Y+RV+ ++++  G+ R    S  V+ +EE+E R  +  P V++ +ARS+AP IYG+ D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  TR FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WD+TKG++NIDFMPTI+SRFDMIF++KD +D++RD  +  HVM+VH+    A    E +         G +P+  LKKYIA+ R +CGPRL+  A + + N YV MRSGA E+E+ET +  SIPIT+RQLEA+VRIAESLAKM+L P   E +  EA+RLFQVSTL +AL+G+L GVEGFT +++ ++I ++EK +K+RF IGSQVSE ++IQDF KQ +P+  I KVL+ M+RRGE+Q + QR+VL RVK
Sbjct:    1 MSGFDDPGVYYSDSFGGGESVGDEGVVKRSQIKKKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTRPRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYALPRKC-NTEQAGRV-------KCPVDPYFIIPDRCVCVDFQTQRLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTVMGIYSIKKVAQTKAKGRDKGTGVGIRSAYLRVVGIDVDTEGAGRGATGS--VSPQEEEELRSLAASPSVYDSLARSLAPSIYGSDDLKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPTTRGFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKGEDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHL---SAQTQTEGVE--------GEIPLATLKKYIAYSRVKCGPRLSAAAAEKLKNRYVLMRSGAKEHERETDRRVSIPITVRQLEAVVRIAESLAKMKLQPIAGEEEVDEALRLFQVSTLDAALSGSLSGVEGFTTQEDQEMISRIEKQLKRRFAIGSQVSEHSIIQDFAKQKYPEHAIQKVLYLMLRRGELQHRMQRKVLYRVK 736          
BLAST of MCM5 vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 320.087 bits (819), Expect = 2.028e-96
Identity = 221/611 (36.17%), Postives = 327/611 (53.52%), Query Frame = 2
Query:  257 LPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR--LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPG-LNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSY-IRVLNVEIENTGSTR-SGISSLGVTDKEEKE----FREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            L V   H+  FD +L  +L+  P E +P F+  VNE+  D  +P   LE++    IQ+        +++R +    I +LI ISG+V+  S +  +      RC+ C  +   V V  G +    + R C  + S A                 +  ++   +D Q++KLQE+PE++P G+ P  + ++    L +K  PG+RV + GI        +N  +  VK  Y   +  +    T   R  G+   G      KE     +E + KP V+E ++ ++AP IY + DIKK I   LFGG+RK   +   G F R ++N+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM ++ R  +HE MEQQT+SIAKAGI   LN+R S+LAAAN V   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H++S++    Q+ +  E   LD        M V  LK YIAF R    PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+R +      D  EA RL + +   SA
Sbjct:  190 LNVNCTHIQTFDADLYRQLICYPQEVIPTFDMSVNELFFD-RFPDSVLEHQ----IQVRPYSAIKTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCA-FNTRVEVDRGRIAEPAVCRNCNTTHSMA-----------------LVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPM-RLNPRQSQVKSVYKTHIDAIHFRKTDEKRLHGLDEDGEQKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGNF-RAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYY---QSEEQIEEEHLD--------MAV--LKDYIAFARTTVHPRLSEEASQALIEAYVDMRKIGS----GRGMVSAYP---RQLESLIRLAEAHAKVRFSGKVETIDVEEAKRLHREALKQSA 755          
BLAST of MCM5 vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 319.701 bits (818), Expect = 8.001e-96
Identity = 227/713 (31.84%), Postives = 353/713 (49.51%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENE------NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            + + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV  A    Y R+ +E      NLP ++ +       +SLR++  NQ   LI+ SGVV S +G+  +   +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + GI       S+NM       + + + N    +      G++   +TD++ K     S    + E I  SI P IY + DIK+ +A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   +R + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+       +G  A + E +  +  T +   +P   L+KYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  + +E D   AIR+                +E F D Q+  V+  + K   +             F++   VSEQ   Q
Sbjct:  184 YHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEEL-------RSLRQLHLNQ---LIRTSGVVTSCTGVLPQLGMVKYNCNKCNFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIYHNNYDGSLNMANGFPVFATVILAN----HIARKDEGVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYAHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPN--TFDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMAIRVM---------------LESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFILKQLVSEQVSYQ 832          
BLAST of MCM5 vs. Ensembl Zebrafish
Match: mcm6 (minichromosome maintenance complex component 6 [Source:ZFIN;Acc:ZDB-GENE-030909-6])

HSP 1 Score: 296.975 bits (759), Expect = 5.564e-88
Identity = 213/675 (31.56%), Postives = 331/675 (49.04%), Query Frame = 2
Query:  164 LKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVK-HSYIRVLNVE-IENTGSTRSGISSLGVTD----------------------------------------KEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMR----SGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL 2041
             + FL+ +++ D    Y    +E    ++  L V +  L  F+  LA  + E   EF  ++  +   V N   + R   E   S +  +     P    +RE+ + ++  L++ISG VV    +  +  + T  C  CQ  +  V  +     Y  P  C     + R              + ++ +K K  DFQ +++QE    +P G +PR  ++ +     E A  G++   +G S I+  D   +   GV+  +  R   V+  EN G    G+ +LGV +                                        +E ++  E S    ++  +  S+ P I+GN ++K+ I  +LFGG  K   EG  LRGDIN+ ++GDP TAKSQ LK VE+  P AVYTSGK SSAAGLTA+V+RD  +  FV+E GA++LAD GV CIDEFDKM+  D+VAIHEAMEQQTISI KAG+   LN+R S+LAAAN V G +D +K   +N++    IMSRFD+ F++ D  +E  D  I   ++ +H     + D     SLD            ++++Y+ F R Q  P+++ E+ + I   Y  +R    SG ++        ++  IT+RQLE+++R++ES+A+M           +EA RL   S +
Sbjct:   28 FQAFLEEFQNSDGEVKYLRDAEELIRPERNTLAVSFTDLEGFNQELATAIQE---EFYRLYPYLCRAVRN---FARDHGEVPTSKEFYVAFQDLPTRHKIRELTTVKVGSLVRISGQVVRTHPVHPELVSGTFLCLDCQGVIKDVEQQ---FKYTQPSICRNPVCNNR------------RRFLLDTNKSKFIDFQKVRIQETQAELPRGSIPRSMEVILRAEAVESAQAGDKCDFIG-SLIVVPDISQLATPGVRAETSSRTAGVQGYENEGL--RGLKALGVRELSYKLAFLACHVAPTNPRFGGKEIRDEEQTAESIKKQMSVQEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGILLMLFGGVPKTTMEGTSLRGDINVCVVGDPSTAKSQFLKHVEEFCPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMETRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPVSGRYDRSKSLKQNVNLTAPIMSRFDLFFILVDDCNEVTDYAIARRIVDLHSRIENSVD--RVYSLD------------EIRRYLLFAR-QFKPKISKESEEFIVEQYKRLRQRDGSGVTK--------SAWRITVRQLESLIRLSESMARMHCCDEVQPKHVKEAFRLLNKSII 655          
BLAST of MCM5 vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 292.352 bits (747), Expect = 2.644e-86
Identity = 201/670 (30.00%), Postives = 325/670 (48.51%), Query Frame = 2
Query:  170 EFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLP-SIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSII-------------QQDSMNMPKDGVKHSYIRVLNV---------------------------EIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNT--SIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL 2041
            EFL+ ++  + + +Y    +E    ++  L V + ++  ++  LA  + E+     P     V   A D       + N+P S +  +     P  + +RE+ + +I  L++ISG VV    +  +  + T  C  CQ  +  V  +     Y  P  C     + R              + ++ +K +  DFQ +++QE    +P G +PR  ++ +     E A  G+R    G   ++             +  S    K+G +   I+ L                             E+     T   + +     + EK F E S    ++  +  S+ P I+GN +IK+ I  +LFGG  K   EG  LRGDIN+ ++GDP T+KSQ LK VE  AP AVYTSGK SSAAGLTA+V++D  +  FV+E GA++LAD GV CIDEFDKM   D+VAIHEAMEQQTISI KAG+   LN+R S+LAAAN + G ++  K   +N++    IMSRFD+ F++ D  +E  D  I   ++ +H  + ++ +               +    ++++YI F R Q  P++T EA + + + Y  +R      +++ G  T  +  IT+RQLE+++R++E +A++  +        +EA RL   S +
Sbjct:   26 EFLEEFQDKNGDALYLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFLCRAVRHFARD-------HGNIPPSKEFYVAFSEFPSRQKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQ---FKYTQPTICKNPVCANR------------RRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVQEWEKVF-EMSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTMEGTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVESVE--------------RVYSTDEIQRYILFAR-QFQPKITVEAQEFVVDQYKRLR------QRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRLLNKSII 651          
BLAST of MCM5 vs. Ensembl Xenopus
Match: ccpg1 (cell cycle progression 1 [Source:Xenbase;Acc:XB-GENE-1017213])

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 374/757 (49.41%), Postives = 525/757 (69.35%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMP-KD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM-GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  +Y S     +  +  +     S+LK    EFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L + E    EVA++VT PR    E +  IQ+ML+ D++P ++R +KS Q+S L+KI G++++A+ +++KA  ++++C+ C+  + +++V+PGL GY +PRKC    +            CP+DPY+I PDKCKC DFQ LKLQE+P+ VPHGE+PRH QL+ DRYLC+K VPGNRVT++GI SI +    +   +D    G++ SYIRV+ ++++  G+  S   +  +T +EE+EFR  S KP ++E +A+SIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGD+N++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  +R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAG     +++  +       FG    +K    I  +        +IF+          + + +HVM+VH+    Q++ V   I L++            LKKYIA+CR +CGPRL+ E+ + + N Y+ MRSGA ++E+ET K +SIPIT+RQLEAIVRI+ESL KM+L PF  E D  EA+RLFQVSTL +A++G+L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++IQDF+KQ +P+  I KVLH M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDLGIYYSDSFGGEQPVGDDGQAKKSQLKKRFREFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPTEHLQLLEEAAQEVADEVTRPRPAGEETIQEIQVMLRSDANPANIRSLKSEQMSHLVKIPGIIIAATAVRAKATKISIQCRSCRNTIGNIAVRPGLEGYAMPRKCNTEQAGR--------PKCPLDPYFIIPDKCKCVDFQTLKLQESPDAVPHGELPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIRKSGKTSTKGRDRVGVGIRSSYIRVVGIQVDTEGTGESAAGA--ITPQEEEEFRRLSAKPDIYETVAKSIAPSIYGSSDIKKAIACLLFGGSRKRLPDGLTRRGDVNLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGSWHHYHTKLQMFC-----FG----SKEHRVIGLL--------LIFL----------QTLAKHVMNVHLSARTQSSSVEGEIDLNT------------LKKYIAYCRAKCGPRLSAESAEKLKNRYILMRSGARDHERETEKRSSIPITVRQLEAIVRISESLGKMKLQPFATETDVEEALRLFQVSTLDAAMSGSLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIQDFLKQKYPEHAIHKVLHLMMRRGEIQHRLQRKVLYRIK 708          
BLAST of MCM5 vs. Ensembl Xenopus
Match: ccpg1 (cell cycle progression 1 [Source:Xenbase;Acc:XB-GENE-1017213])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 356/756 (47.09%), Postives = 496/756 (65.61%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMP-KD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM-GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  +Y S     +  +  +     S+LK    EFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L +                                          S Q+S L+KI G++++A+ +++KA  ++++C+ C+  + +++V+PGL GY +PRKC    +            CP+DPY+I PDKCKC DFQ LKLQE+P+ VPHGE+PRH QL+ DRYLC+K VPGNRVT++GI SI +    +   +D    G++ SYIRV+ ++++  G+ RS   +  +T +EE+EFR  S KP ++E +A+SIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGD+N++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  +R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAG     +++  +       FG                 +    +IF+          + + +HVM+VH+    Q++ V   I L++            LKKYIA+CR +CGPRL+ E+ + + N Y+ MRSGA ++E+ET K +SIPIT+RQLEAIVRI+ESL KM+L PF  E D  EA+RLFQVSTL +A++G+L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++IQDF+KQ +P+  I KVLH M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDLGIYYSDSFGGEQPVGDDGQAKKSQLKKRFREFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPTEHLQL------------------------------------------SEQMSHLVKIPGIIIAATAVRAKATKISIQCRSCRNTIGNIAVRPGLEGYAMPRKCNTEQAGR--------PKCPLDPYFIIPDKCKCVDFQTLKLQESPDAVPHGELPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIRKSGKTSTKGRDRVGVGIRSSYIRVVGIQVDTEGTGRSAAGA--ITPQEEEEFRRLSAKPDIYETVAKSIAPSIYGSSDIKKAIACLLFGGSRKRLPDGLTRRGDVNLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGSWHHYHTKLQMFC-----FG-----------------IIGLLLIFL----------QTLAKHVMNVHLSARTQSSSVEGEIDLNT------------LKKYIAYCRAKCGPRLSAESAEKLKNRYILMRSGARDHERETEKRSSIPITVRQLEAIVRISESLGKMKLQPFATETDVEEALRLFQVSTLDAAMSGSLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIQDFLKQKYPEHAIHKVLHLMMRRGEIQHRLQRKVLYRIK 660          
BLAST of MCM5 vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 321.242 bits (822), Expect = 2.780e-96
Identity = 227/720 (31.53%), Postives = 361/720 (50.14%), Query Frame = 2
Query:  107 TGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLG-VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLK--LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            T R+  S   +   I H + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV   V YP+ +     + +I +++   P  + LR ++   +++LI+ SGVV   +G+  + + +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + G        S+N       + +     V + N  + +    ++G +TD++ K     S    + E I  SIAP IYG+ DIK+ +A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+++AA+N + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+    ++    N    +L    G+ P+ +  LKKYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  + VE D   AIR+                +E F D Q+  V+  + K   +             FV+   V+EQT  Q
Sbjct:  165 TVREWVSMAATRLEIYH-RFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVL-VMYPKYDR---IAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLN-----TANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHHPSSKDIANGEEFALPNTFGVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVM---------------LESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQ 826          
BLAST of MCM5 vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 321.242 bits (822), Expect = 2.864e-96
Identity = 227/720 (31.53%), Postives = 361/720 (50.14%), Query Frame = 2
Query:  107 TGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLG-VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLK--LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            T R+  S   +   I H + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV   V YP+ +     + +I +++   P  + LR ++   +++LI+ SGVV   +G+  + + +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + G        S+N       + +     V + N  + +    ++G +TD++ K     S    + E I  SIAP IYG+ DIK+ +A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+++AA+N + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+    ++    N    +L    G+ P+ +  LKKYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  + VE D   AIR+                +E F D Q+  V+  + K   +             FV+   V+EQT  Q
Sbjct:  166 TVREWVSMAATRLEIYH-RFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVL-VMYPKYDR---IAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLN-----TANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHHPSSKDIANGEEFALPNTFGVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVM---------------LESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQ 827          
BLAST of MCM5 vs. Ensembl Xenopus
Match: adat3 (adenosine deaminase, tRNA-specific 3 [Source:Xenbase;Acc:XB-GENE-6258400])

HSP 1 Score: 321.627 bits (823), Expect = 3.026e-96
Identity = 227/720 (31.53%), Postives = 361/720 (50.14%), Query Frame = 2
Query:  107 TGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLG-VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLK--LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            T R+  S   +   I H + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV   V YP+ +     + +I +++   P  + LR ++   +++LI+ SGVV   +G+  + + +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + G        S+N       + +     V + N  + +    ++G +TD++ K     S    + E I  SIAP IYG+ DIK+ +A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   T+ + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+++AA+N + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+    ++    N    +L    G+ P+ +  LKKYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  + VE D   AIR+                +E F D Q+  V+  + K   +             FV+   V+EQT  Q
Sbjct:  185 TVREWVSMAATRLEIYH-RFKNFLRTHVDEHGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKIFDEAAKEVVL-VMYPKYDR---IAREIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTCCTGVLPQLSMVKYNCNKCNFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGTYHNNYDGSLN-----TANGFPVFATVILANHITKKDDKVAVGELTDEDVKAIIALSKDERIGERIFASIAPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTIIAASNPIGGRYDPSLTFSENVDLTEPIVSRFDILCVVRDTVDPVQDEMLARFVVGSHIKHHPSSKDIANGEEFALPNTFGVEPLPQEVLKKYIMYSKEKIHPKLNQMDQDKVAKMYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVVEDDVNMAIRVM---------------LESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFVLKQLVAEQTSYQ 846          
BLAST of MCM5 vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 418/757 (55.22%), Postives = 562/757 (74.24%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQ-SCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD------GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S    G     E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD  LAD L ++P E L + E    EVA++VT PR   +E L  IQ+MLK D+ P S+R +KS+ +S L+KI G+++SAS +++KA  ++++C+ C   L +++++PGL GY LPRKC          + Q  +  CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI ++  +N  K       G++ SYIRVL ++++  GS RS   S  V+ +EE+EFR  +  P ++E+I++SI+P I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASVIRD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM++H+            +L    A  G + + K+KK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+GNL GVEGFT +++ +++ ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDPGAEEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYALPRKC---------NMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSI-KKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGS--VSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVS-----------ALTQTQAVEGEIDLAKMKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 418/757 (55.22%), Postives = 562/757 (74.24%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQ-SCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD------GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S    G     E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD  LAD L ++P E L + E    EVA++VT PR   +E L  IQ+MLK D+ P S+R +KS+ +S L+KI G+++SAS +++KA  ++++C+ C   L +++++PGL GY LPRKC          + Q  +  CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI ++  +N  K       G++ SYIRVL ++++  GS RS   S  V+ +EE+EFR  +  P ++E+I++SI+P I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASVIRD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM++H+            +L    A  G + + K+KK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+GNL GVEGFT +++ +++ ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDPGAEEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYALPRKC---------NMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSI-KKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGS--VSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVS-----------ALTQTQAVEGEIDLAKMKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 418/757 (55.22%), Postives = 562/757 (74.24%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQ-SCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD------GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S    G     E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD  LAD L ++P E L + E    EVA++VT PR   +E L  IQ+MLK D+ P S+R +KS+ +S L+KI G+++SAS +++KA  ++++C+ C   L +++++PGL GY LPRKC          + Q  +  CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI ++  +N  K       G++ SYIRVL ++++  GS RS   S  V+ +EE+EFR  +  P ++E+I++SI+P I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASVIRD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM++H+            +L    A  G + + K+KK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+GNL GVEGFT +++ +++ ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDPGAEEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYALPRKC---------NMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSI-KKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGS--VSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVS-----------ALTQTQAVEGEIDLAKMKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. Ensembl Mouse
Match: Mcm4 (minichromosome maintenance complex component 4 [Source:MGI Symbol;Acc:MGI:103199])

HSP 1 Score: 326.635 bits (836), Expect = 1.260e-98
Identity = 225/624 (36.06%), Postives = 330/624 (52.88%), Query Frame = 2
Query:  209 VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNV-EIENTGSTR-SGISSLG----VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            +Y   L E   T + +L V  +H+  F  NL  +L+  P E +P F+  VNE+  D  YP    E+   ++    L +  KS+R +    I +LI ISG+V+  S +  +      +C+ C     +  V+        P  C+   ++    +                ++   +D Q++KLQE+PE++P G+ P    LF    L +K  PG+RV V GI   +    +N     VK  Y   ++V     T + R  G+         ++K  K  +E S KP ++E +A ++AP IY + DIKK I   LFGG+RK       G F R +IN+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM E  R  +HE MEQQT+SIAKAGI   LN+R SVLAAAN +   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H++S++    Q+ +  E   LD        M V  LK YIA+      PRL+ EA + +   YV+MR   S      G  ++ P   RQLE+++R+AE+ AK+R +      D  EA RL + +   SA
Sbjct:  191 LYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAVNEIFFD-RYPDSILEHQIQVRPFNALKT--KSMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAH---TTRVEIDRGRIAEPCSCVHCHTTHSMALIH--------------NRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPI-RVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKF-RAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYY---QSEEQVEEEFLD--------MAV--LKDYIAYAHSTIMPRLSEEASQALIEAYVNMRKIGS----SRGMVSAYP---RQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSA 772          
BLAST of MCM5 vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 321.242 bits (822), Expect = 3.050e-96
Identity = 220/705 (31.21%), Postives = 358/705 (50.78%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLG-VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENI----SLDSLTAET-GIMPVLK--LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            H + K FL+++     + V+++ + + C   +  L V ++ L+  +  LA  L E P E L IF+    EV  A    Y R+ N       I +++   P  + LR ++   +++LI+ SGVV S +G+  + + +   C  C               +VL   C +     + G      SCP      P+ I  ++    ++Q +++QE+P  V  G +PR     +   L +   PG+ + + GI       S+N       + +     + + N  + +    ++G +TD++ K     S    + E I  SIAP IYG+ DIK+ +A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK++E+ +  A++T+G+G+SA GLTA V R   +R + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+    +   +E +    +L+     T G+ P+ +  LKKYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  + +E D   AIR+                +E F D Q+  V+  + K   +             F++   V+EQ   Q
Sbjct:  196 HHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITN------HIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKC--------------NFVLGPFCQSQNQEVKPG------SCPECQSAGPFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLN-----TANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLEPAMPNTYGVEPLPQEVLKKYIIYAKERVRPKLNQMDQDKVARMYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVM---------------MESFIDTQKFSVMRSMRKTFARYLSFRRDNNDLLLFILKQLVAEQVTYQ 847          
BLAST of MCM5 vs. UniProt/SwissProt
Match: sp|P55862|MCM5A_XENLA (DNA replication licensing factor mcm5-A OS=Xenopus laevis OX=8355 GN=mcm5-a PE=1 SV=2)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 416/757 (54.95%), Postives = 565/757 (74.64%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMP-KD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM-GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  VY S     + ++  +     S+LK    EFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L + E    EVA++VT PR    E +  IQ+ML+ D++P ++R +KS Q+S L+KI G++++A+ +++KA  ++++C+ C+  + +++V+PGL GY +PRKC    +           +CP+DPY+I PDKCKC DFQ LKLQE+P+ VPHGE+PRH QL+ DRYLC+K VPGNRVT++GI SI +    +   +D    G++ SYIRV+ ++++  G+ RS   +  +T +EE+EFR  + KP ++E +A+SIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGD+N++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  +R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WD+TKG+ENIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM+VH+    Q++ V   + L++            LKKYIA+CR +CGPRL+ EA + + N Y+ MRSGA E+E+ET K +SIPIT+RQLEAIVRI+ESL KM+L PF  E D  EA+RLFQVSTL +A++G+L GVEGFT +++ +++ ++EK MKKRF IGSQVSE ++IQDF+KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDLGVYYSDSFGGEQQVGDDGQAKKSQLKKRFREFLRQYRIGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPTEHLQLLEEAAQEVADEVTRPRPAGEETIQEIQVMLRSDANPANIRSLKSEQMSHLVKIPGIIIAATAVRAKATKISIQCRSCRNTIGNIAVRPGLEGYAMPRKCNTEQAGR--------PNCPLDPYFIIPDKCKCVDFQTLKLQESPDAVPHGELPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIRKSGKTSTKGRDRVGVGIRSSYIRVVGIQVDTEGTGRSAAGA--ITPQEEEEFRRLAAKPDIYETVAKSIAPSIYGSSDIKKAIACLLFGGSRKRLPDGLTRRGDVNLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKGEENIDFMPTILSRFDMIFIVKDEHNEQRDMTLAKHVMNVHLSARTQSSSVEGEVDLNT------------LKKYIAYCRAKCGPRLSAEAAEKLKNRYILMRSGAREHERETEKRSSIPITVRQLEAIVRISESLGKMKLQPFATETDVEEALRLFQVSTLDAAMSGSLSGVEGFTTQEDQEMLSRIEKQMKKRFAIGSQVSEHSIIQDFLKQKYPEHAIHKVLSLMMRRGEIQHRLQRKVLYRIK 735          
BLAST of MCM5 vs. UniProt/SwissProt
Match: sp|Q561P5|MCM5_XENTR (DNA replication licensing factor mcm5 OS=Xenopus tropicalis OX=8364 GN=mcm5 PE=2 SV=1)

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 414/757 (54.69%), Postives = 564/757 (74.50%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMP-KD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM-GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  +Y S     +  +  +     S+LK    EFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L + E    EVA++VT PR    E +  IQ+ML+ D++P ++R +KS Q+S L+KI G++++A+ +++KA  ++++C+ C+  + +++V+PGL GY +PRKC    +            CP+DPY+I PDKCKC DFQ LKLQE+P+ VPHGE+PRH QL+ DRYLC+K VPGNRVT++GI SI +    +   +D    G++ SYIRV+ ++++  G+ RS   +  +T +EE+EFR  S KP ++E +A+SIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGD+N++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  +R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WD+TKG+ENIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM+VH+    Q++ V   I L++            LKKYIA+CR +CGPRL+ E+ + + N Y+ MRSGA ++E+ET K +SIPIT+RQLEAIVRI+ESL KM+L PF  E D  EA+RLFQVSTL +A++G+L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++IQDF+KQ +P+  I KVLH M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDLGIYYSDSFGGEQPVGDDGQAKKSQLKKRFREFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPTEHLQLLEEAAQEVADEVTRPRPAGEETIQEIQVMLRSDANPANIRSLKSEQMSHLVKIPGIIIAATAVRAKATKISIQCRSCRNTIGNIAVRPGLEGYAMPRKCNTEQAGR--------PKCPLDPYFIIPDKCKCVDFQTLKLQESPDAVPHGELPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIRKSGKTSTKGRDRVGVGIRSSYIRVVGIQVDTEGTGRSAAGA--ITPQEEEEFRRLSAKPDIYETVAKSIAPSIYGSSDIKKAIACLLFGGSRKRLPDGLTRRGDVNLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPVSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKGEENIDFMPTILSRFDMIFIVKDEHNEQRDMTLAKHVMNVHLSARTQSSSVEGEIDLNT------------LKKYIAYCRAKCGPRLSAESAEKLKNRYILMRSGARDHERETEKRSSIPITVRQLEAIVRISESLGKMKLQPFATETDVEEALRLFQVSTLDAAMSGSLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIQDFLKQKYPEHAIHKVLHLMMRRGEIQHRLQRKVLYRIK 735          
BLAST of MCM5 vs. UniProt/SwissProt
Match: sp|Q0V8B7|MCM5_BOVIN (DNA replication licensing factor MCM5 OS=Bos taurus OX=9913 GN=MCM5 PE=2 SV=1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 415/755 (54.97%), Postives = 562/755 (74.44%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQD-SMNMPKD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S    G +   E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD  LAD L ++P E L + E    EVA++VT PR   +E L  IQ+MLK D+ P S+R +KS+ +S L+KI G+V++ASG+++KA  ++++C+ C   L +++++PGL+GY LPRKC    +            CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI +   + N  +D    G++ +YIRVL ++++  GS R+   ++  T +EE+EFR  +  P ++E+I++SIAP I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HV+++H+            +L    A  G + + KLKK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+G L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++IQDF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDNAADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADYLYKQPAEHLQLLEEAAKEVADEVTRPRPAGDEVLQDIQVMLKSDASPSSIRSLKSDTMSHLVKIPGIVIAASGVRAKATRISIQCRSCHSTLTNIAMRPGLDGYALPRKCNTDQAGR--------PKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTSNRGRDRVGVGIRSAYIRVLGIQVDTDGSGRTFAGAM--TPQEEEEFRRLAALPNIYELISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVS-----------ALTQAQAVEGEIDLAKLKKFIAYCRAKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQELLSRIEKQLKRRFAIGSQVSEHSIIQDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. UniProt/SwissProt
Match: sp|P49718|MCM5_MOUSE (DNA replication licensing factor MCM5 OS=Mus musculus OX=10090 GN=Mcm5 PE=1 SV=2)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 418/757 (55.22%), Postives = 562/757 (74.24%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQ-SCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD------GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S    G     E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD  LAD L ++P E L + E    EVA++VT PR   +E L  IQ+MLK D+ P S+R +KS+ +S L+KI G+++SAS +++KA  ++++C+ C   L +++++PGL GY LPRKC          + Q  +  CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI ++  +N  K       G++ SYIRVL ++++  GS RS   S  V+ +EE+EFR  +  P ++E+I++SI+P I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASVIRD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HVM++H+            +L    A  G + + K+KK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+GNL GVEGFT +++ +++ ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDPGAEEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYALPRKC---------NMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSI-KKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGS--VSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVS-----------ALTQTQAVEGEIDLAKMKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGVEGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. UniProt/SwissProt
Match: sp|P33992|MCM5_HUMAN (DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 416/758 (54.88%), Postives = 563/758 (74.27%), Query Frame = 2
Query:   71 MAGFDEGAVYLST--GRDTQS-ELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENEN-LPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQ--------QDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  ++ S   G D Q+ E  +  +    + KEFL+ Y+       F + YRD LK + N  +Y++ VE + L+ FD +LAD L ++P E L + E    EVA++VT PR   E  L  IQ+MLK D+ P S+R +KS+ +S L+KI G++++AS +++KA  ++++C+ C+  L +++++PGL GY LPRKC    +            CP+DPY+I PDKCKC DFQ LKLQE P+ VPHGEMPRH QL+ DRYLC+K VPGNRVT++GI SI +        +D + +   G++ SYIRVL ++++  GS RS   +  V+ +EE+EFR  +  P V+E+I++SIAP I+G  D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD ++R+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WDETKG++NIDFMPTI+SRFDMIF+VKD ++E+RD  + +HV+++H+            +L    A  G + + KLKK+IA+CR +CGPRL+ EA + + N Y+ MRSGA ++E+++ + +SIPIT+RQLEAIVRIAE+L+KM+L PF  EAD  EA+RLFQVSTL +AL+G L GVEGFT +++ +++ ++EK +K+RF IGSQVSE ++I+DF KQ +P+  I KVL  M+RRGEIQ + QR+VL R+K
Sbjct:    1 MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGR--------PKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGV---GIRSSYIRVLGIQVDTDGSGRSFAGA--VSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVS-----------ALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK 734          
BLAST of MCM5 vs. TrEMBL
Match: M9NPT0 (DNA helicase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1531.54 bits (3964), Expect = 0.000e+0
Identity = 739/742 (99.60%), Postives = 740/742 (99.73%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            MAGFDEGAVYLSTGRDTQSELNSEFAIAHSK KEFLKS+KSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKL SHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK
Sbjct:    1 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKFKEFLKSHKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLGSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 742          
BLAST of MCM5 vs. TrEMBL
Match: A0A0R3UM46 (DNA helicase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8798 PE=3 SV=1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 447/763 (58.58%), Postives = 584/763 (76.54%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLE-NENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDG--------VKHSYIRVLNVEIENTGSTRSGISSLG---------VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD GAVY S    G+ T  +  + F  A  K KEFL+ Y     ++ YRD LK+NC  + Y L ++ + L+ FD  LA +L+++P +++  FE    EVA+++    +  +++LPSIQ+ML  ++ P +LRE++S+ +SKL+KISG+VVSAS IK+KA  LTL+C+GC+QYLP++ V+PG  GY+LPRKC  S +    GVG T   CP+DPY+I PDKCKC D+Q+LKLQEAP++VP GEMPRH QL+VDRY+ E+  PGNR+TVVG+ SI+    +N P+ G        V+ SYIRVL + +   G  RSG+ S G         +T+ EE+E R+ +  P ++E+++RSIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+CAP+ +YTSGKGSSAAGLTASVIRD A+ +FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WD+TKG+ NIDFMPTI+SRFDMIFVV+DV+D  RD  +  HVM VH+  G  A  N   S D  T++   +P+ KL+++IA+ R++CGPRL+P A + + N YV MRSGAS +E++TGK  +IPIT+RQLEAIVRI+ESLAKMRL PF  EAD  EA+RLFQVST+ + +TG+LEG EGFT ++EHD++V+VEK +KKRFVIGSQVSE  ++QDF +QGF ++ ++KVL++MIRRGEIQ + QRR+L RVK
Sbjct:    1 MSGFDVGAVYHSDSLFGQTTDHDNFANFQQAKRKFKEFLRQYNVGGLSFTYRDQLKQNCALRIYNLNLKMQDLNNFDGYLAQELIQRPADYIATFEEAATEVASEIMKSSMAPDDSLPSIQLMLDWEASPVNLRELRSDLVSKLVKISGIVVSASSIKAKAFRLTLQCRGCRQYLPNIRVRPGFEGYMLPRKCPTSQTG---GVGVT---CPIDPYFIVPDKCKCVDYQVLKLQEAPDSVPQGEMPRHMQLYVDRYMVEQVAPGNRITVVGVYSILT-SPLNKPRSGAHERVNVGVRTSYIRVLGLTLNTEGPGRSGVFSGGKLATTKTSTITENEEEEMRKLASTPNIYELVSRSIAPSIYGSTDIKKAIACLLFGGSRKRLPDGLCRRGDINLLLLGDPGTAKSQLLKFVERCAPVGIYTSGKGSSAAGLTASVIRDPASHNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTSLNSRCSVLAAANSVYGRWDDTKGESNIDFMPTILSRFDMIFVVRDVHDATRDSILAHHVMQVHL-HGNDASANIGSSGDKSTSDE--IPLSKLRRFIAYARERCGPRLSPAAAEKLANQYVLMRSGASRHEQQTGKRCAIPITVRQLEAIVRISESLAKMRLEPFATEADVEEALRLFQVSTIEAFMTGSLEGAEGFTSQEEHDLVVRVEKQLKKRFVIGSQVSEHAILQDFTRQGFSEKTVAKVLYYMIRRGEIQYRMQRRILYRVK 753          
BLAST of MCM5 vs. TrEMBL
Match: A0A0X3PT13 (DNA helicase OS=Schistocephalus solidus OX=70667 GN=MCM5 PE=3 SV=1)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 450/767 (58.67%), Postives = 573/767 (74.71%), Query Frame = 2
Query:   71 MAGFDEGAVYLS---TGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLE-NENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDG--------VKHSYIRVLNVEIENTGSTRSGISSLGV-----------TDKEE-KEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM-GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            MAGFD G VY S    G+ T  +  S    A +K KEFL+ Y     ++ YRD LK+N + K Y LP+  + L+ FD  LA +L+++P +++  FE    EVAN++    L+ +E LP  QI+L  ++ P SLRE+ S Q+SKL+KISG+VVS+SG+++KA  LTL+C+GC+QYLP++ V+PG  GY+LPRKC  S +      G  A SCP+DPY+I PDKCKC D+Q+LKLQE+PE+VPHGEMPRH QL+ DRYL EK  PGNR+TVVGI SI        PK G        V+ +Y+RVL + + N G  RSG+ S G            TD EE +E R+ +  P +++IIARSIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+C+P+ VYTSGKGSSAAGLTAS+IRD  TR+FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WD+TKG+ NIDFMPTI+SRFDMIFVV+D +D  RD  +  HVM VH+ G+   A      S+++     G +P+ KL+++IA+ R+ CGPRL+P A + + N YV MRSGAS +E++TGK  +IPIT+RQLEA++RI+ESLAKMRL  F  E+D  EA+RLFQVSTL + +TG+LEG EGFT ++EHD+IV+VEK +KKRFVIGSQVSE  ++QDF +QGF +  ++KVLH+MIRRGEIQ + QRR+L RVK
Sbjct:    1 MAGFDAGGVYYSDSLLGQTTDQDNFSNLQQAKTKFKEFLRQYNVGGLSFTYRDHLKKNYSMKLYNLPLNLRDLANFDGYLAQELVQRPVDYIATFEEAATEVANEIMKSSLQTDEPLPMAQILLNWEASPVSLRELHSEQVSKLVKISGIVVSSSGVRAKATRLTLQCRGCRQYLPNLRVRPGFEGYMLPRKCPTSQT------GGAAVSCPIDPYFIVPDKCKCVDYQVLKLQESPESVPHGEMPRHMQLYCDRYLVEKVSPGNRITVVGIFSI-HASVPTKPKAGAAERVNVGVRSAYVRVLGLTLSNDGPGRSGLLSEGSAVRAAASGGSQTDCEEVEEIRKLANTPNIYDIIARSIAPSIYGSSDIKKAIACLLFGGSRKRLPDGLCRRGDINLLLLGDPGTAKSQLLKFVERCSPVGVYTSGKGSSAAGLTASIIRDPVTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTSLNSRCSVLAAANSVFGRWDDTKGESNIDFMPTILSRFDMIFVVRDEHDVTRDTVLAHHVMQVHLRGNDPTA------SVEAAEKSAGEIPLSKLRRFIAYARECCGPRLSPSAAEKLVNQYVLMRSGASRHEQQTGKRAAIPITVRQLEAVIRISESLAKMRLEAFANESDVDEALRLFQVSTLEAFMTGSLEGAEGFTSQEEHDLIVRVEKQLKKRFVIGSQVSEHAILQDFSRQGFSEHAVAKVLHYMIRRGEIQYRMQRRILYRVK 754          
BLAST of MCM5 vs. TrEMBL
Match: A0A0R3S9V4 (DNA helicase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1069 PE=3 SV=2)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 448/762 (58.79%), Postives = 573/762 (75.20%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAI---AHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLE-NENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDG--------VKHSYIRVLNVEIENTGSTRSGISSLGVT--------DKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            MAGFD GAVY S    TQ+     FA    A  K K+FL+ Y     ++ YRD LK+NC  K Y L ++ + L+ FD  LA +L+  P +++  FE    EVA+++    LE NE LP IQ++L  D+ P  +R+++S +++KL+KISG+VVSAS +KSKA  LTL+C+GC+QYLP++ VKPG  GY+LPRKC +S +      G  +  CPVDP++I PDKC+C D+Q+LKLQE+P++VP GEMPRH Q++ DRYL E+  PGNR+TVVGI SI      N P+ G        V++SYIR L + +   G  RSG+ S G +        + EE+E R+ +  P ++E+IARSIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGDIN+++LGDPGTAKSQ LKFVE+CAP+ VYTSGKGSSAAGLTAS+IRD AT +FVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WD++KG+ NIDFMPTI+SRFDMIFVVKD +D  RD  +  HVM VH+  G     N  ++ D  T+  G +P+ KL+++IAF R++CGPRL+P A++ ++N YV MRSGAS +E++TGK  +IPIT+RQLEAIVRI+E+LAKMRL  F  EAD  EA+RLFQVSTL + +TG+LEG EGFT ++EHD+IV+VEK +KKRFVIGSQVSE  ++QDF +QGF +R ++KVLH+MIRRGEIQ + QRR+L RVK
Sbjct:    1 MAGFDSGAVYRSDSLFTQTGDRDNFASFQQAKKKFKDFLRQYNVGGLSFGYRDQLKQNCTLKIYNLTLKIQDLNNFDTFLAQELIIHPADYIATFEEAATEVASEIMKSSLEANETLPPIQLLLDWDAAPVHIRDMQSERVAKLVKISGIVVSASSVKSKATRLTLQCRGCRQYLPNIRVKPGFEGYMLPRKCPSSQA------GGVSVPCPVDPFFIVPDKCECVDYQVLKLQESPDSVPQGEMPRHMQIYCDRYLVEQVAPGNRITVVGIYSIQTSAPSNKPRSGTHERVNVGVRNSYIRALGLSLNTEGPGRSGVFSTGRSLNTATITTEVEEEEMRKLASTPNIYELIARSIAPSIYGSLDIKKAIACLLFGGSRKRLPDGLCRRGDINLLLLGDPGTAKSQFLKFVERCAPVGVYTSGKGSSAAGLTASIIRDPATHNFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTSLNSRCSVLAAANSVFGRWDDSKGESNIDFMPTILSRFDMIFVVKDEHDAARDSILAHHVMQVHL-HGNDPIANNEMAED--TSSNGEIPLSKLRRFIAFARERCGPRLSPAAVEKLSNQYVLMRSGASRHERQTGKRGAIPITVRQLEAIVRISEALAKMRLDAFATEADVDEAMRLFQVSTLEAFMTGSLEGAEGFTSQEEHDLIVRVEKQLKKRFVIGSQVSEHAILQDFTRQGFSERTVAKVLHYMIRRGEIQYRMQRRILYRVK 753          
BLAST of MCM5 vs. TrEMBL
Match: W6V191 (DNA helicase OS=Echinococcus granulosus OX=6210 GN=EGR_05513 PE=3 SV=1)

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 439/762 (57.61%), Postives = 569/762 (74.67%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQ---SELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLE-NENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI-------IQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLG---------VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            MAGFD GAVY S     Q    ++ ++F  A  K K+FL+ Y     ++ YRD LK+NC  K Y L ++ + L+ FD  LA  L+++P +++ +FE    EVA ++    L  NE LPSIQ++L+ ++ P ++RE+ S Q+SKL+KISG+VVSAS +KSKA  LTL+C+GC+Q+LP++ V+PG  GY+LPRKC    SS + G G TA  CP+DPY+I PDKC+C D+Q+LKLQE+P++VP GEMPRH QL+ DRYL E+  PGNR+TVVGI SI       ++         GV+ SYIRVL + +   G  RSG+ S G          T+ EE+E R+ +  P ++E+IARSIAP IYG+ DIKKAIACLLFGGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+CAP+ VYTSGKGSSAAGLTAS++RD  + +FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSV AAANSV+G WD+TKG+ NIDFMPTI+SRFDMIFVV+D +D  RD  +  HVM VH+      DV  N+      + +  +P+ KL+++IAF R+ CGPRL+  A + + N YV MRSGAS  E++TGK  +IPIT+RQLEAIVRI+E+LAKMRL PF  E+D  EA+RLFQVSTL + +TG+LEG EGFT ++EH+++++VEK +KKRFVIGSQVSE  ++QDF +QGF +R + KVLH+MIRRGEIQ + QRR+L R+K
Sbjct:    1 MAGFDAGAVYHSDSLFAQPADHDIFADFQQAKRKFKDFLRQYNVGGLSFTYRDQLKQNCTLKIYNLVLKLQDLNNFDSYLAQMLIQRPTDYIAVFEEATTEVATEIMKSSLSANETLPSIQLLLEWEATPINIRELHSEQVSKLVKISGIVVSASSVKSKAIRLTLQCRGCRQFLPNIRVRPGFEGYMLPRKC----SSVQAG-GVTA-PCPIDPYFIVPDKCQCVDYQVLKLQESPDSVPQGEMPRHMQLYCDRYLVEQVAPGNRITVVGIYSIQASAPTKVKTSVHERVNVGVRMSYIRVLGLTVNTEGPGRSGVFSGGKPLNTVTITSTELEEEEMRKLASTPNIYELIARSIAPSIYGSLDIKKAIACLLFGGSRKRLPDGLCRRGDINLLLLGDPGTAKSQLLKFVERCAPVGVYTSGKGSSAAGLTASIVRDPTSHNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTSLNSRCSVFAAANSVYGRWDDTKGESNIDFMPTILSRFDMIFVVRDEHDAARDSVLAHHVMQVHL---HGNDVTGNMEFTEDGSTSDEIPLSKLRRFIAFAREHCGPRLSAAAAEKLVNQYVLMRSGASRLEQQTGKRAAIPITVRQLEAIVRISEALAKMRLDPFATESDVDEALRLFQVSTLEAFMTGSLEGAEGFTSQEEHELVLRVEKQLKKRFVIGSQVSEHAILQDFTRQGFSERTVMKVLHYMIRRGEIQYRMQRRILYRMK 753          
BLAST of MCM5 vs. Ensembl Cavefish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:103021452])

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 413/758 (54.49%), Postives = 552/758 (72.82%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTG-RDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQ-DSMNMPKD-----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  VY S         +  E ++  S++K    EFL+ ++       F Y YRD LK +    +Y++ VE + L+ FD +L+D L + P E LP+ E    EVA++VT PR +  E +  IQ+MLK D+HP S+R +KS Q+S+L+KI G+++S+S +++KA  + L+C+GC+  + ++ + PGL GY LPRKC  +  + R         CPVDPY+I PD+C C DFQ L+LQE+P+ VPHGEMPRH QL+ DRYLC++ VPGNRVT++GI SI +   S    +D     G++ +Y+RV+ ++++  G+ R    S  V+  EE+E R  +  P V++ IARS+AP IYG+ D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  TR F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WD+TKG++NIDFMPTI+SRFDMIF++KD +D +RD  +  HVM+VH+    A    E +         G +P+  LKKYIA+ R +CGPRL+  A + + N YV MRSGA E+E+E+ +  SIPIT+RQLEA+VRIAESLAKM+L     E +  EA+RLFQVSTL +AL+G+L GVEGFT +++ ++I ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVLH M+RRGE+Q + QR+VL R+K
Sbjct:    1 MSGFDDPGVYYSDSFGGGGEGVGDEGSVKRSQIKKRFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWVEVEMEDLASFDEDLSDCLYKLPTENLPLLEEAAQEVADEVTRPRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSSAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYALPRKC-NTEQAGRV-------KCPVDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTIMGIYSIKKMATSKTKGRDKGAGVGIRSAYLRVVGIQVDTEGAGRGATGS--VSPLEEEELRALAASPAVYDSIARSLAPSIYGSDDLKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPNTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKGEDNIDFMPTILSRFDMIFIIKDQHDHQRDMTLARHVMNVHL---SAQTQTEGVE--------GEIPLATLKKYIAYARVKCGPRLSAAAAEKLKNRYVVMRSGAREHERESDRRASIPITVRQLEAVVRIAESLAKMKLQAIAGEEEVDEALRLFQVSTLDAALSGSLSGVEGFTTQEDQEMISRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIHKVLHLMLRRGELQHRMQRKVLYRIK 737          
BLAST of MCM5 vs. Ensembl Cavefish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:103021452])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 393/757 (51.92%), Postives = 524/757 (69.22%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTG-RDTQSELNSEFAIAHSKLK----EFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQ-DSMNMPKD-----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  VY S         +  E ++  S++K    EFL+ ++       F Y YRD LK +    +Y++ VE + L+ FD +L+D L + P E LP+                                          S Q+S+L+KI G+++S+S +++KA  + L+C+GC+  + ++ + PGL GY LPRKC  +  + R         CPVDPY+I PD+C C DFQ L+LQE+P+ VPHGEMPRH QL+ DRYLC++ VPGNRVT++GI SI +   S    +D     G++ +Y+RV+ ++++  G+ R    S  V+  EE+E R  +  P V++ IARS+AP IYG+ D+KKAIACLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD  TR F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSVFG WD+TKG++NIDFMPTI+SRFDMIF++KD +D +RD  +  HVM+VH+    A    E +         G +P+  LKKYIA+ R +CGPRL+  A + + N YV MRSGA E+E+E+ +  SIPIT+RQLEA+VRIAESLAKM+L     E +  EA+RLFQVSTL +AL+G+L GVEGFT +++ ++I ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVLH M+RRGE+Q + QR+VL R+K
Sbjct:    1 MSGFDDPGVYYSDSFGGGGEGVGDEGSVKRSQIKKRFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWVEVEMEDLASFDEDLSDCLYKLPTENLPL------------------------------------------SEQVSRLVKIPGIIISSSAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYALPRKC-NTEQAGRV-------KCPVDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTIMGIYSIKKMATSKTKGRDKGAGVGIRSAYLRVVGIQVDTEGAGRGATGS--VSPLEEEELRALAASPAVYDSIARSLAPSIYGSDDLKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPNTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKGEDNIDFMPTILSRFDMIFIIKDQHDHQRDMTLARHVMNVHL---SAQTQTEGVE--------GEIPLATLKKYIAYARVKCGPRLSAAAAEKLKNRYVVMRSGAREHERESDRRASIPITVRQLEAVVRIAESLAKMKLQAIAGEEEVDEALRLFQVSTLDAALSGSLSGVEGFTTQEDQEMISRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIHKVLHLMLRRGELQHRMQRKVLYRIK 694          
BLAST of MCM5 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 321.242 bits (822), Expect = 1.337e-96
Identity = 230/688 (33.43%), Postives = 348/688 (50.58%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENE------NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRF 2143
            + + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV  A    Y R+ +E      NLP ++ +       +SLR++  NQ   LI+ SGVV S +G+  +   +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + GI       S+NM  +G       +L   I      R  ++ L  TD++ K     S    + E I  SI P IYG+ DIK+ +A  LFGG  K       +RGDIN++M GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   TR + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+       +G  A + E +  +S  ++   +P   L+KYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  +  E D   AIR+                +E F D Q+  V+    K M+K F
Sbjct:  175 YHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEEL-------RSLRQLHLNQ---LIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARK-DDRVAVAEL--TDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNS--SDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM---------------LESFIDTQKFSVM----KSMRKTF 794          
BLAST of MCM5 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 321.242 bits (822), Expect = 1.547e-96
Identity = 230/688 (33.43%), Postives = 348/688 (50.58%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENE------NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRF 2143
            + + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV  A    Y R+ +E      NLP ++ +       +SLR++  NQ   LI+ SGVV S +G+  +   +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + GI       S+NM  +G       +L   I      R  ++ L  TD++ K     S    + E I  SI P IYG+ DIK+ +A  LFGG  K       +RGDIN++M GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   TR + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+       +G  A + E +  +S  ++   +P   L+KYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  +  E D   AIR+                +E F D Q+  V+    K M+K F
Sbjct:  175 YHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEEL-------RSLRQLHLNQ---LIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARK-DDRVAVAEL--TDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNS--SDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM---------------LESFIDTQKFSVM----KSMRKTF 794          
BLAST of MCM5 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 320.857 bits (821), Expect = 2.234e-96
Identity = 230/688 (33.43%), Postives = 348/688 (50.58%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENE------NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL------PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCP----VDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRF 2143
            + + K FL+++     + V+++ + + C   K  L V ++ L+  +  LA  L E P E L IF+    EV  A    Y R+ +E      NLP ++ +       +SLR++  NQ   LI+ SGVV S +G+  +   +   C  C   L       +  VKPG                          SCP    + P+ I  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + GI       S+NM  +G       +L   I      R  ++ L  TD++ K     S    + E I  SI P IYG+ DIK+ +A  LFGG  K       +RGDIN++M GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   TR + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+       +G  A + E +  +S  ++   +P   L+KYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ A+M L  +  E D   AIR+                +E F D Q+  V+    K M+K F
Sbjct:  184 YHRFKNFLRTHVDEHGHNVFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHEIHVRIGNLPLVEEL-------RSLRQLHLNQ---LIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPG--------------------------SCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNM-ANGFPVFATVILANHIARK-DDRVAVAEL--TDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNS--SDVPPIPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLR-------KESMATGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVM---------------LESFIDTQKFSVM----KSMRKTF 803          
BLAST of MCM5 vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 332/544 (61.03%), Postives = 426/544 (78.31%), Query Frame = 2
Query:  686 SCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSI------IQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAK-AGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            SCP+DPY+I PDKCKC D+Q LKLQEAP+ VPHGEMPRH QL+ DRYLC++ VPGNR+TV+GI SI      +Q    +    G+++ Y+RV+ + ++  G+ RS    + +  +EE+E R+ +  P V+E IARSIAP IYG  DIKKAIA LL GGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD ATR+F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTIS  +  GITT LNSRCSVLAAANSVFG WD++KG+ENIDFMPTI+SRFDMIF++KD ++EKRD  + +HVM+VH+        N    + ++  E   + +  LKK+IA+CR +CGPR++ EA + + N YV MRSGA E++++     SIPIT+RQLEAIVRI+ES AKMRL PF  EA   EA+RLFQVSTL +AL+G+L G EGFT +++ +++ +VEK +K+RF IGSQVSE +++QDF+KQ +P+  I KVLH M+RRGE+Q + QR+VL RVK
Sbjct:   14 SCPIDPYFIMPDKCKCVDYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKAFTKMQGKGRDRTGAGIRNPYLRVVGITVDTDGAGRS--MGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKGEENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVHL--------NAKTQMQAVEGE---IELSTLKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTLDAALSGSLSGAEGFTTQEDQELLARVEKQLKRRFAIGSQVSEHSIVQDFLKQKYPEHAIYKVLHLMLRRGELQHRVQRKVLYRVK 544          
BLAST of MCM5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.054 bits (632), Expect = 2.808e-74
Identity = 160/463 (34.56%), Postives = 248/463 (53.56%), Query Frame = 2
Query:  308 KLMEKPNEFLPIFESVVNEVANDV--TYPRLENENLPSIQIMLKLDSHPKSL--REIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVH 1681
            +L+    E L  F+  + E+  +V  TY +       S  + L+     + L  R + S  +  ++ + G+V   S ++ K       C   Q+   S+  K     Y       A  SSA +   +  +S P++  Y         D Q + LQE PE  P G++PR + + +D  L ++  PG+RV V+G    +        K G      R + +        +  + +    D  + +    +    + + +++S+AP I+G+  IKKA+ CLL GG+ K +  G  +RGDIN++++GDP  AKSQ+L++V   AP A+ T+G+GSS  GLTA+V  D  T    +E GAMVL D GVVCIDEFDKM + DR AIHE MEQ  ++IAKAGI   LN+RCSVLAAAN ++G +D+ K   ENI    +++SRFD++F+V D  D + D++I +HV+ +H
Sbjct:    1 RLLNSSFEELLAFQQALKELVGNVDGTYAK----QFESFYVGLEGSFGARHLSPRTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQK---SIERK-----YSDLTSLDAFPSSAAYPT-KDEESNPLETEY---GLSIYRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGK-----KAGYTSGTFRTILIGNNVKQMNKEVVPTFSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMH 442          
BLAST of MCM5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.751 bits (639), Expect = 1.293e-72
Identity = 199/679 (29.31%), Postives = 327/679 (48.16%), Query Frame = 2
Query:  140 EFAIAHSKLKEFLKSYKSVDF----NYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKL---------DSH-------------------------PKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGC--QQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGIS-SIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFM-----PTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKL-KKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVS 2035
            ++A      K+FL+ +   D      + Y + L      ++  L ++   L+  +P LA++++E    +  +F   V+E+  +        ++   + I  +L         D+H                         P S+R++K+N I +L+ + GVV  A+ +K      T  C  C  + Y P  S           R C  + S  R               Y++    K   FQ LK+QE  + VP G +PR   + V       A PG+ +++ GI   +++Q    M +  +  +++    V   N    ++  + L V +  E E R+ + +   +E +A SIAP IYG+ D+KKA+  LL  G   + P G+ +RG+IN+ ++GDPG AKSQLL ++++ AP + YT+G+GSS  GLTA+V++D  T    +EGGA+VLAD GV CIDEFDKM + DR +IHE MEQQTISIAK       ++R  VL     + G+     G     ++       ++SRFD++++++D  D   D ++ +H+  VH    Q    +++  LD           +KL ++YIA C+ +  P +       IT  YV MR      E    K+T+   + R L AI+R++ +LA++RL     + D  EA RL ++S
Sbjct:    5 DYAAEKDNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLMLQNRHGDADAHDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRL--------------YLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMN----KTEDNELDVEELSESELRQIT-EEDFYEKLAASIAPEIYGHEDVKKALL-LLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVL----QLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPP--SQHTPLD-----------MKLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRK-----EARVSKDTTF-TSARTLLAILRLSTALARLRLVDVVEKEDVNEA-RLMEMS 638          
BLAST of MCM5 vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 249.98 bits (637), Expect = 1.834e-71
Identity = 216/714 (30.25%), Postives = 342/714 (47.90%), Query Frame = 2
Query:  263 VEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLE------------------NENLPSI---QIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGC--QQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDK----CKCNDFQILKLQEA--PENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLN-VEIENTGSTRS---------GISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEG--VFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAA---------------------DVNENISL-DSLTAETG----IMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIG-SQVSEQTVIQDFVKQ 2197
            VE   L+   P LAD L E P+  L      V++V    T PRLE                    NLP++   QI+   +   + L+ +++N   +L+ I G VV    IK     L   C  C  +Q L     +     + LP K +  A           + C    +   P++     +  D+Q +K+QE    E    G +PR  +  +   L +  VPG+ +T+ GI  +   D      +  K  ++  +  V + NT   RS         G++ L  + KE    +E   +P +  ++  SI P IYG+  +K  +A  LFGG ++   +   + +RGD +++++GDPG  KSQ+L+ V   AP  VY  G  ++ AGLT ++ +D  +  + +E GA+VL D G+ CIDEFDKM    + A+ EAMEQQ+IS+AKAG+   L +R S++AAAN V GH++++K   EN+     ++SRFD++F++ D  DE+RD  + EHVM++H G    A                     DV   +SL D L A  G     +P   L+KY+ + R    P L+ EA + + + Y+ +R      +   G  T  PIT RQLE+++R+ E+ A++ L     + DA + I + + S  S  L+  L G   F +R +H   +   +   KRFV   ++ SEQ     F  Q
Sbjct:  128 VEDHCLTVAMPTLADDLAETPDRVLQYMGLAVHQVYLHCT-PRLEIRISDLEEQKITSHGAVLRANLPTLPYRQIIYNYEPLTQ-LKNLRANCYGRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVL-----RLPYGKFTLPTKRVKCAD----------EDCRSRTFM--PNRRSQLTETVDWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQRSDGGGEDTAPGVA-LDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPNQHQ-ALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEALDPVPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRR-----QHHGGDGT--PITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHS-FSDTLSDEL-GTLHF-ERTQHGSGMS-NRSAAKRFVTALARCSEQICNTMFTMQ 809          
BLAST of MCM5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.128 bits (627), Expect = 6.937e-71
Identity = 198/680 (29.12%), Postives = 327/680 (48.09%), Query Frame = 2
Query:  140 EFAIAHSKLKEFLKSYKSVDF----NYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKL---------DSH-------------------------PKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGC--QQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGI-SSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKA--GITTMLNSRCSVLAAANSVFGHWDETKGDENI----DFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKL-KKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVS 2035
            ++A      K+FL+ +   D      + Y + L      ++  L ++   L+  +P LA++++E    +  +F   V+E+  +        ++   + I  +L         D+H                         P S+R++K+N I +L+ + GVV  A+ +K      T  C  C  + Y P  S           R C  + S  R               Y++    K   FQ LK+QE  + VP G +PR   + V       A PG+ +++ GI   +++Q    M +  +  +++    V   N    ++  + L V +  E E R+ + +   +E +A SIAP IYG+ D+KKA+  LL  G   + P G+ +RG+IN+ ++GDPG AKSQLL ++++ AP + YT+G+GSS  GLTA+V++D  T    +EGGA+VLAD GV CIDEFDKM + DR +IHE MEQQTISIAK   G+     + CS         G    ++ D+ +         ++SRFD++++++D  D   D ++ +H+  VH    Q    +++  LD           +KL ++YIA C+ +  P +       IT  YV MR      E    K+T+   + R L AI+R++ +LA++RL     + D  E +RL ++S
Sbjct:    5 DYAAEKDNCKKFLQEFYKDDGLGKKQFKYGEQLVHLAQREQVSLCIDLDDLAELEPELAERVVENARRYAALFADAVSELLPEYRQGEPVQKDALDVYIEHRLMLQNRHGDADAHDPKNQYPPELMRRFELYFKAPGTLKPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRL--------------YLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMN----KTEDNELDVEELSESELRQIT-EEDFYEKLAASIAPEIYGHEDVKKALL-LLLVGGVDRSPRGMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCSDGGGRTVAAGR--ASRIDDCVWLALMLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPP--SQHTPLD-----------MKLMRRYIALCQRR-QPAVPDTLADYITAAYVEMRK-----EARVSKDTTF-TSARTLLAILRLSTALARLRLVDVVEKEDVNE-MRLMEMS 641          
BLAST of MCM5 vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 325/758 (42.88%), Postives = 479/758 (63.19%), Query Frame = 2
Query:  170 EFLKSYKS------VDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVT-YPRLENEN--------------------LPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKP----GLNGYVLPRKCIAS-------ASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD----------GVKHSYIRVLNVEIE-NTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFV-KQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMR 2290
            E +KS+K+      +D  ++YRD L+ N   K Y L V  +HL  ++ ++  KL ++P++ +P+FE+ + +VA  ++   R ++ N                    LP+ Q++L  +++   LR++ S  +SK++++SG+++S S + S+A  L++ C+ C+ +  S+++        N   LPR C+++       A+ +  G   T ++C  DPY I  +  K  D Q LKLQE PE VP GEMPR+  +  DRYL  K +PG RVT+VGI SI    +                 ++  YI++L ++ +  T S  + ++    T++EE+EF + S  P ++EI+  SIAP I+GN DIKKAI CLL GGS+K +P+G+ LRGDIN+++LGDPGTAKSQLLKFVE+ +PIAVYTSGKGSSAAGLTASV RD  TR F +EGGAMVLADGGVVCIDEFDKM+++DRVAIHEAMEQQTISIAKAGITT+LNSR SVLAAAN ++G +D+ K   +NIDF  TI+SRFDMIF+VKD ++E+RD  I  HV+++H G+  A    +  +   ++ E       K+K+YI +CR +C PRL+P+A + +++++V++R      E E+ + +SIPITIRQLEAI+RI ESLAK+ L+P   E    EAIRLFQ ST+ +A    + G+   +     + I + E+ +K+R  IG   S QT+ ++FV    F    + K L+ + +   IQ +HQ + + R
Sbjct:   26 EIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCR-HTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMF--TEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIE-------KMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSE-IRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYR 772          
BLAST of MCM5 vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 343.584 bits (880), Expect = 5.877e-106
Identity = 239/706 (33.85%), Postives = 366/706 (51.84%), Query Frame = 2
Query:  161 KLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYP---RLENENLPSIQIMLKLDSHPK--SLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDG-------VKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM----------------GDGQAA------DVNENISLDSLTA------ETGIMPVLK--LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVI 2149
            +LK FL  Y       VY   ++         L V ++HL+     LA  L + P E L IF+ V  E A ++ YP   R+ +E      I +++   P   SLRE++ + +S L++++GVV   +G+  +   +   C  C              G +L      S    R       +S    P+ +  +K    ++Q + LQEAP  VP G +PRH ++ +   L + + PG  V V GI       ++N  K+G       ++ + I+       N G    G+     T++EE+EFR+ S   G+ + I  S+AP IYG+ DIK A+AC LFGG  K +     +RGDIN+++LGDPGTAKSQ+LK+VE+ A  AV+ +G+G+SA GLTASV +D  T+ + +EGGA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RCS++AAAN   G ++ T    +N+     I+SRFD++ VV+D+ DE+ D+++   V+  H+                 +G++A      ++NE ++            E  I P+ +  L KYI + R +  P+L    +  ++  Y  +R       +E+    S PIT+R LE+I+RIAES AKMRL+ F    D   AI++                V+ F D Q+    V V + +++ F I
Sbjct:  210 ELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAME-ATELHYPDYARIHSE------IHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKC--------------GSILGPFFQDSNEEIRISFCTNCKSK--GPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNA-KNGFPVFATIIEANSIKRREGNTANEGE--EGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLR-------RESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVV---------------VDSFVDAQK----VSVRRQLRRSFAI 863          
BLAST of MCM5 vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 315.464 bits (807), Expect = 8.055e-95
Identity = 191/548 (34.85%), Postives = 297/548 (54.20%), Query Frame = 2
Query:  449 KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGI--SSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSL------------------GVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWD-ETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQ 2029
            K +RE+  N I KLI + G+V+ ++ +         +C  C   + +V +  G+     P +C       R    +      +       ++C   D Q++KLQE P+ VP G+ P    L V   L +    G+R+ V G   S  I+ +S       +  +Y+ V++V+  +        S++                   +TD++  + RE + +  ++ ++ARSIAP IY   D+KK I   LFGG+ K   +G   RGDIN+++ GDP T+KSQ+L++V +  P  VYTSGKGSSA GLTA + RD  T+  V+E GA+VL+DGGV CIDEFDKM +  R  +HE MEQQTISIAKAGI T LN+R S+LA+AN +   ++      ENID  P ++SRFD++++V D  DEK D+++ +H+ ++++ D       E+IS D       ++PV  L  YI++ ++   P +T  A   +   YV MR    +   +  +   I  T RQLE+++R+AE+ AKM+L       D +EA+RL +
Sbjct:  312 KGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTM-AVEIDRGV--IQEPARC------ERIDCNEPNSMSLIH------NRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKP-----EHISQDD------VLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKR---ITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIR 830          
BLAST of MCM5 vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 305.449 bits (781), Expect = 5.942e-91
Identity = 216/682 (31.67%), Postives = 341/682 (50.00%), Query Frame = 2
Query:  233 NCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVAN---DVTYPRLENENLPSIQIMLKLD------SHPKSLREIKSNQISKLIKISGVVVSASGIKSKA-ATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSY-IRVLNVEIENTGSTRSGISSLG-VTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVH--------------------MGDGQAADVN-----------ENISLDS-----------------LTAETG---------IMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLE 2068
            + N   + + +    L  FD +    ++ +P  F+P  E  + ++A+   DV +P   N +  S +   KL       +H  S R + +  ++KL+ + G+V   S ++ K   ++    K  + +    +         +P   I              +    +    E       D Q + +QE PE  P G++PR   + +D  L +K  PG+RV VVG+   +    MN         +   +L   +    +  +G+++   +TD + +   + S K  + +I+++S+AP IYG+  IKKAI  +L GG  K +  G  LRGDIN++M+GDP TAKSQLL+FV   A +A+ T+G+GSS  GLTA+V  D  T    +E GAMVLAD GVVCIDEFDKM + DRVAIHE MEQQT++IAKAGI T LN+RCSV+AAAN VFG +D  +   +NI    +++SRFD++FVV D  +E RD+ I EHV+  H                    +  G+ AD+N           EN   D                  L    G         ++ +  L+KY+ + +++  P+LT EA+ +I  +Y  +R+     +  T K+   PIT R LE ++R+A + AK+RL+    + DA+ A  L + + L   +  +++
Sbjct:   88 SLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHP---NASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAI-----------YPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRN-----DDNTKKS---PITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDID 747          
BLAST of MCM5 vs. Ensembl Yeast
Match: MCM7 (Component of the Mcm2-7 hexameric helicase complex; MCM2-7 primes origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation in S-phase; forms an Mcm4p-6p-7p subcomplex [Source:SGD;Acc:S000000406])

HSP 1 Score: 286.189 bits (731), Expect = 8.830e-85
Identity = 192/543 (35.36%), Postives = 291/543 (53.59%), Query Frame = 2
Query:  434 LDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQ----QYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLN---VEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGAS-EYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVS 2035
            + S P S+R+IK + + +LI + G++   S +K     +   C  C     Q + S +  P         +C +   S     GQ          ++     K + FQ  K+QE  + VP G +PR   + V+  L     PG+ V V GI        +  P  G K     +L    +E +     +   +S  +T   E+   E      V+  +A+SIAP IYGN D+KKA+  LL GG  K++ +G+ +RGDIN+ ++GDPG AKSQLLK + + +P  VYT+GKGSS  GLTA+V++D  T   ++EGGA+VLAD G+ CIDEFDKM E DR AIHE MEQQTISI+KAGI T LN+R S+LAAAN ++G ++      +NI+    ++SRFD++F++ D+     D+++ EHV  VHM + Q         LD    E       K+++YIA+ + +  P ++      +   Y+ +R  +  E + +     + P   R L  I+R++++LAK+RLA      D  EA+RL +VS
Sbjct:  220 ISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTP-------LSECTSEECSQNQTKGQ---------LFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIF-------LPAPYTGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQP-------DLDFTPVEPS-----KMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATP---RTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVS 723          
BLAST of MCM5 vs. Ensembl Nematostella
Match: EDO48453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT1])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 409/752 (54.39%), Postives = 546/752 (72.61%), Query Frame = 2
Query:   71 MAGFDEGAVYLST---GRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQS-CPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQ-QDSMNMPKD----GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+G +++S      D   E +     A  + KEFL+ +    F + YRD LK++ N  +YYL V+ + LS FD NLADKL + P+E+LP+FE+   EVA++VT PR +  E +  +QI L+  ++P  +RE++S  ++ L+KI G+++SAS I+SKA  +T++C+ CQ  + S+ +KPGL GY +PRKC            QT +  CP+DP++I PDKCKC DFQ+LKLQE+P+ VP+GEMPRH QL+ DRYL E+ VPGNRVTV+GI SI +     N  +D    G++  Y+RV+ + ++  G  RS  + +   D+EE  FR  + +P V ++IARSIAP IYG+ DIKK IACLLFGGSRK++P+G+  RGDIN+++LGDPGTAKSQLLKFVE+ +PI VYTSGKGSSAAGLTASV+RD  +R+FVMEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRC+VLAAANSVFG WD+TKGD+NIDFMPTI+SRFD IF+VKD +++ +D  + +HVM VH+   Q    NE           G + +  LKKYI++C+ +CGPRL+  A + + N YV MRSGA E+E++T K  SIPIT+RQLEAI+RI+ESLAKM L+PF  E    EA+RLFQVSTL +A++G+L G   FT   +   I ++EK +K+RF IG+QVSEQ +I DF+KQ + +R +  VL+ MIRRGE++ + QR+VL RV+
Sbjct:    1 MSGFDQGEIFVSDPFGSEDQSDERDLNRVSAKKRFKEFLREFHEGTFAFPYRDQLKQHYNLGQYYLEVDLEDLSSFDENLADKLRKNPSEYLPLFETAAKEVADEVTRPRPIGEEEVQDVQITLRSGANPFQIRELRSEHMAALVKIPGIIISASSIRSKATNITIQCRSCQNTISSIPLKPGLEGYAMPRKC---------PTDQTGRPPCPLDPFFIMPDKCKCVDFQVLKLQESPDAVPNGEMPRHMQLYCDRYLTERVVPGNRVTVIGIYSIKKVAQKANKERDAIGVGIRKPYLRVVGIYVDTEGPGRSTGAPMNPADEEE--FRRLATRPDVADVIARSIAPSIYGSVDIKKCIACLLFGGSRKRLPDGLTRRGDINVLLLGDPGTAKSQLLKFVEKVSPIGVYTSGKGSSAAGLTASVMRDPVSRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCAVLAAANSVFGRWDDTKGDQNIDFMPTILSRFDTIFIVKDEHNQAKDIHLAKHVMQVHLNAAQTTQANE-----------GELSLSFLKKYISYCKSKCGPRLSESAAEKLKNRYVLMRSGAKEHERDTEKKISIPITVRQLEAIIRISESLAKMSLSPFATETHVDEALRLFQVSTLDAAMSGSLAGASDFTPEHDMQEIRQIEKQLKRRFAIGTQVSEQRIIADFLKQNYSERAVQTVLYMMIRRGEVEHRLQRKVLYRVR 730          
BLAST of MCM5 vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 343.199 bits (879), Expect = 9.097e-106
Identity = 224/668 (33.53%), Postives = 353/668 (52.84%), Query Frame = 2
Query:  158 SKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVF-LRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGD--GQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRF 2143
            ++ K+FL+++     + VYR+ +++ C   K  L +++  L+     LA  L E P E L IF    +E A +V      N +  + +I +++   P  + LR ++   +++LI+  GVV S++GI  + + +   C  C     S  + P   G           S      G   +     P+ I  ++    ++Q +K+QE+P  V  G +PR+  + +   L +   PG+ + + GI  I    S+N   +G    +  ++          +  ++SL  TD++ K     S    + E I  SI P IYG+ DIK+A+A  LFGG  K  P G   +RGDIN+++ GDPGTAKSQ LK+VE+ AP AV+T+G+G+SA GLTA V R   T+ + +E GA+VLAD G+  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RCS+LAAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V++ H+        + +E++ +   T     +P   LKKY+ + R++  PRL       +   +  +R       KE+    SIPIT+R +E+++R+AES AKM L  + +E D   AIR+                +E F D Q+  V+    + MKK F
Sbjct:  121 NRFKQFLRTFVDDQGHSVYREKIRQMCEANKQSLVIDYNILANEQQVLAYFLPEAPTEMLQIF----DEAAKEVVLAMFPNYDRITTEIHVRIAELPLMEELRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKC-----SFILGPFFQG-----------SDQEVKPGSCPECQSRGPFEINMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNR-SNGFP-VFATIIEANFITKQDDKMAVTSL--TDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKD-PGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNTPENEDEDMEVHMFTLRRNAIPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLR-------KESMATGSIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVM---------------LESFIDTQKFSVM----RNMKKAF 737          
BLAST of MCM5 vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 286.189 bits (731), Expect = 1.519e-84
Identity = 205/670 (30.60%), Postives = 329/670 (49.10%), Query Frame = 2
Query:  164 LKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP--KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVK-HSYIRVLNVEIENTGSTRSGISSLGVTD----------------------------------------KEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL 2041
             ++FL+ ++ +D    Y    +E    ++  L V ++ +  ++  LA  + E   ++  +F  +   V N   + R   +  P+ +  +     P    +RE+ S +I  L++ISG VV    +  +  T T  C  CQ  +  V  +       + R  I   + ARF               ++ +K +  DFQ +++QE    +P G +PR  ++ +     E+A  G++    G + I+  D   +   G +  +  R  + E       R G+ +LGV D                                        +E ++  E S    +++ I  SI P I+GN ++K+ +  +LFGG  KK  E   LRGDIN+ ++GDP TAKSQ LK VE+ +  AVYTSGK SSAAGLTA+V++D  +  FV+E GAM+LAD GV CIDEFDKM   D+VAIHEAMEQQTIS+ KAG+   LN+R SVLAAAN + G +D TK   +N++    IMSRFD+ F++ D  +E  D  I   ++ +H    Q+ +               +  V ++++Y+ F R Q  P +T EA   +   Y  +R    E +  +   ++  IT+RQLE+++R++E++A++           +EA RL   S +
Sbjct:   25 FQDFLEEFE-LDGEVKYLADAQELIRPERNTLVVSYQDVESYNAQLATLIQE---DYYRVFPYLCQAVRN---FARDRGQVPPNKEFYVSFIDLPTRHKIRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQQFKYTQPTVCRNPICQ-NRARFA--------------LDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTG-TLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVR-GLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRREQSVE--------------RVYAVDEVQRYLTFAR-QFKPTITKEAQDYMVEQYKHLR----ERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSII 651          
BLAST of MCM5 vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 285.034 bits (728), Expect = 1.969e-84
Identity = 187/556 (33.63%), Postives = 281/556 (50.54%), Query Frame = 2
Query:  458 REIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHM------GDGQAADVNENISL-----DSLTAETGIMPVLK----------------------LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRL 2023
            R + S  I  ++ + G+V   S ++ K       C   ++ L        +  Y       A  +S+ +      +    +P   E   C   D Q   +QE PE  P G++PR   +  D  L +K  PG+RV V+G    +          G   + + V NV++     ++    +   +D  + +    S +  V E++A+S+AP I+G+  IKKA+ CLL GG+ K +  G  LRGDIN++++GDP TAKSQ+L++V   AP A+ T+G+GSS  GLTA+V  D  T    +E GAMVLAD GVVCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN VFG +DE K   +NI    +++SRFD++F+V D  D   D++I EHV+ +H        +G+A    E   +          E    PV +                      +KKYI   +    P LT  A  +I+  Y  +R    +      K  + P+T R LE ++R++ + AK R++    E DA+ A+ +
Sbjct:  111 RSLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTL--------IRKYTDMTSLEAVPTSSVY----PTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPAGQLPRSVDIIADNDLVDKCKPGDRVQVIGTYRCLPSKRSGF-TSGTFRTVLIVNNVQV----MSKEVAPNFSASDISKIKKFSKSKQ-DVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSAPRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPFGEESDVLATRDPDQEEEDEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAK-AIKPALTKPAADLISKAYSELR---DQENIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQAAVDM 644          
BLAST of MCM5 vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 283.108 bits (723), Expect = 3.079e-84
Identity = 180/545 (33.03%), Postives = 290/545 (53.21%), Query Frame = 2
Query:  449 KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGC----QQYLPSVSVKPGLNGYVLP-RKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGV-------KHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETK-GDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLS 2044
            +S+R +K++ I KL  + G+V+  + +K      T  C  C     Q + S +  P L   + P  +C  + +  R               Y++    K   FQ LK+QE  + VP G +PR   +         A PG+ V+V GI   + +        G+        H  +R+   E +           +   D  ++E R  S +   ++ +A S+AP IYG+ DIKKA+  LL  G     P G+ +RG+IN++++GDPG AKSQ+L ++++ AP + YT+G+GS+  GLTA+V++D  T   ++EGGA+VLAD GV CIDEFDKM + DR AIHE MEQQT+SIAKAGI T LN+R S+LAAAN  +G ++  K  ++NI     ++SRFD++++++D  D++ D ++ +H+  VH          + + ++             +++YIA C+++  P +  E    I + YV MR  A         + +   + R L A++R+A +LA++RLA    + D  EA+RL ++S  S
Sbjct:  146 ESVRNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTIQSQTFMPLL---MCPSEECKTNRAGGRL--------------YLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIFLPMMKTGFRQMTQGLLSDTFLEAHRIVRMNKTEDD----------EMPTDDLSDEEIRALSTEADFYDKLASSLAPEIYGHEDIKKALL-LLLVGGVDCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQHSAHPPSHYDPLDMNL------------MRRYIAACKEK-QPIVPGELSDYIVSAYVEMRKDAR------NNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLMEMSKAS 643          
BLAST of MCM5 vs. Ensembl Medaka
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:101167880])

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 404/758 (53.30%), Postives = 547/758 (72.16%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTG-----RDTQSELNSEFAIAHSKLKEFLKSYK----SVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPR-LENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKD------GVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            M+GFD+  VY S            E   +      + +EFL+ ++       F Y YRD LK +    +++L VE + L+ FD +L+D L + P E LP+ E    EVA++VT PR +  E +  IQ+MLK D+H  S+R +KS Q+S+L+K+ G+++SA+ +K+KA  + L+C+GC+  +P++ + PGL GY LPRKC  S ++ R         CP+DPY+I PD+C C DFQ L+LQE+P+ VPHGEMPRH QL+ DRYLC++ VPGNRVT++GI SI +  ++           G++ SY+RV+ ++++  G+ R       V+ +EE+E R  S  P ++  +A+S+AP IYG+ D+KKAI CLLFGGSRK++P+G+  RGDIN++MLGDPGTAKSQLLKFVE+C+PI VYTSGKGSSAAGLTASV+RD +TR F+MEGGAMVLADGGVVCIDEFDKM+EDDRVAIHEAMEQQTISIAKAGITT LNSRCSVLAAANSV+G WD+TKG++NIDFMPTI+SRFDMIF++KD +D++RD  +  HVM+VH+    A    E +         G +P+   KKYIA+ R +CGPRL+  A + + N YV MRSGA E+E+E+ K  SIPIT+RQLEA++RIAESLAKM+L     E +  EA+RLFQVSTL +AL+G+L GVEGFT +++ +++ ++EK +K+RF IGSQVSE +++QDF KQ +P+  I KVLH M+RRGE+Q + QR+VL RVK
Sbjct:   15 MSGFDDPGVYYSDSFGGGEGPGGDEGGQKRVQIKKRFREFLRQFREGTDQTGFTYKYRDELKRHYTLGEFWLEVEVEDLASFDEDLSDCLYKLPTENLPLLEEAAKEVADEVTRPRPVGEEAVQDIQVMLKSDAHHTSIRNLKSEQVSRLVKVHGIIISATAVKAKATKVCLQCRGCRSVIPNIPLPPGLQGYALPRKC-NSENAGRV-------KCPMDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHLQLYCDRYLCDRVVPGNRVTIMGIYSIKKMAAVKAKGKEKGIGVGIRSSYLRVVGIQVDTEGAGRGATGP--VSAQEEEELRALSTSPNIYSSLAQSLAPSIYGSDDLKKAITCLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPSTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKGEDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHL---SAQTQTEGVE--------GEIPLATFKKYIAYARAKCGPRLSAAAAEKLKNRYVVMRSGAREHERESDKRPSIPITVRQLEAVIRIAESLAKMKLQAVAGEEEVDEALRLFQVSTLDAALSGSLSGVEGFTSQEDQEMVSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIYKVLHLMLRRGELQHRMQRKVLYRVK 751          
BLAST of MCM5 vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 320.472 bits (820), Expect = 2.905e-96
Identity = 225/703 (32.01%), Postives = 357/703 (50.78%), Query Frame = 2
Query:  155 HSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTYPRLENE------NLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYL-PSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRS-GISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDET-KGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSL----TAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKR------------FVIGSQVSEQTVIQ 2182
            +++ K FL+++   + + V+++ + + C   K  L V ++ L+  +  LA  L E P E L +F+    EV  A    Y R+ +E      NLP ++ +       ++LR++  NQ   LI+ SGVV   +G+  + + +   C  C   L P    +   N  V P  C    S                P+ +  ++    ++Q + +QE+P  V  G +PR     +   L +   PG+ + + GI       S+NM      + +     V + N  S R  G++   +TD++ K     S    + E I  S+AP IYG+ DIK+A+A  LFGG  K       +RGDIN+++ GDPGTAKSQ LK+VE+ A  AV+T+G+G+SA GLTA V R   +R + +E GA+VLAD GV  IDEFDKM + DR +IHEAMEQQ+ISI+KAGI T L +RC+V+AAAN + G +D +    EN+D    I+SRFD++ VV+D  D  +D+ +   V+  H+     +     ++L+ +    T +   +P   L+KYI + +++  P+L       +   Y  +R       KE+    SIPIT+R +E+++R+AE+ AKM L  + +E D   AIR+                +E F D Q+  V+  + K   +             F++   V+EQ   Q
Sbjct:  184 YNRFKNFLRTHVDENGHNVFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKVFDEAAKEVVLAMYPKYDRIAHEIHVRVSNLPLVEEI-------RALRQLHLNQ---LIRTSGVVSCCTGVLPQLSMVKYNCSKCSFVLGPFFQSQ---NQEVKPGSCPECQSQG--------------PFEVNMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNM-----ANGFPVFATVILANHISRRDEGVAVAELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKH-HPSTKEGGVALEEMVLPNTTDVSPIPQDLLRKYIIYAKERVHPKLNQMDQDKVARIYSDLR-------KESMATGSIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVM---------------LESFIDTQKFSVMRSMRKTFARYLAFRRDNNELLLFILKQLVAEQVAYQ 831          
BLAST of MCM5 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 314.694 bits (805), Expect = 1.254e-94
Identity = 214/616 (34.74%), Postives = 324/616 (52.60%), Query Frame = 2
Query:  257 LPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP------KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPG-LNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSII-------QQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            L V  +H+  FD  L  +L+  P E +P F+  VNE         L  E  P   +  ++   P      K++R +    I +LI + G+V+  S +  +      +C+ C  +   V V  G +    + R C  + S                   +  ++   +D Q++K+QE+PE++P G+ P  + L+    L +K  PG+RV + GI   +       Q +  ++ K  +   + R  + E    G  + G   L   D+ +   +E + KP V+E +A ++AP IY + DIKK I   LFGG+RK   +   G F R ++N+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM ++ R  +HE MEQQT+SIAKAGI   LN+R +VLAAAN V   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H++S++    Q+ +  E   LD        M V  LK YIA+ R    PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+R +      D  EA RL + +   SA
Sbjct:  167 LNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNE---------LFFERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCA-FSARVEVDRGRIAEPAVCRNCNNTHSMT-----------------LVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTD-EKRLHGLDQDGEQKLFTEDRVQT-LKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNF-RAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYY---QSEEQMEEEFLD--------MAV--LKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGS----GRGMVSAYP---RQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSA 732          
BLAST of MCM5 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 312.768 bits (800), Expect = 8.666e-94
Identity = 220/633 (34.76%), Postives = 324/633 (51.18%), Query Frame = 2
Query:  257 LPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHP------KSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGV--GQTAQSCPVDPYYIEPDKCK-CN---------------DFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSII-------QQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPE---GVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA 2050
            L V  +H+  FD  L  +L+  P E +P F+  VNE         L  E  P   +  ++   P      K++R +    I +LI + G+V+  S +  +      +C+ C                         A SAR  V  G+ A          EP  C+ CN               D Q++K+QE+PE++P G+ P  + L+    L +K  PG+RV + GI   +       Q +  ++ K  +   + R  + E    G  + G   L   D+ +   +E + KP V+E +A ++AP IY + DIKK I   LFGG+RK   +   G F R ++N+++ GDPGT+KSQLL++V    P   YTSGKGSSA GLTA V++D  TR  V++ GA+VL+D G+ CIDEFDKM ++ R  +HE MEQQT+SIAKAGI   LN+R +VLAAAN V   W+  K   ENI    T++SRFD+IF++ D  DE  D+++  H++S++    Q+ +  E   LD        M V  LK YIA+ R    PRL+ EA + +   YV MR   S      G  ++ P   RQLE+++R+AE+ AK+R +      D  EA RL + +   SA
Sbjct:  203 LNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNE---------LFFERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVC-------------------------AFSARVEVDRGRIA----------EPAVCRNCNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTD-EKRLHGLDQDGEQKLFTEDRVQT-LKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNF-RAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYY---QSEEQMEEEFLD--------MAV--LKDYIAYARTYISPRLSEEASQALIEAYVDMRKIGS----GRGMVSAYP---RQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSA 768          
BLAST of MCM5 vs. Ensembl Medaka
Match: mcm7 (minichromosome maintenance complex component 7 [Source:NCBI gene;Acc:101165815])

HSP 1 Score: 303.138 bits (775), Expect = 3.720e-91
Identity = 219/680 (32.21%), Postives = 348/680 (51.18%), Query Frame = 2
Query:  140 EFAIAHSKLKEFLKSYKSVDFN----YVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNE----------VAND----------VTYPRLE---------NENLPSIQIMLKLDSHPKS------LREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGC--QQYLPSVSVKPGLNGYVL--PRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGV-KHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDE-NIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPV-LKL-KKYIAFCRDQCGPRLTPEAL-KIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVS 2035
            ++A    K K FL+ + + D N    + Y   L    + ++  L VE   ++  DP L + + E    +  +F   V+E          VA D          +   RL+         N+  P +    +L   P S      +R+I+++ I +L+ + G+V  A+ +K   A  T  C  C  + Y P  S  P     ++   ++C+ + S  R               Y++    K   FQ L++QE  + VP G +PR   ++        A PG+ V + G+   + +   +    G+   +Y+   N+ + N    ++    L   +  ++E R  + + G +E +A SIAP IYG+ D+KKA+  LL  G  ++ P+G+ +RG IN+ ++GDPG AKSQLL ++++ AP + YT+G+GSS  GLTA+V+RD  T    +EGGA+VLAD GV CIDEFDKM + DR AIHE MEQQTISIAKAGI T LN+RCS+LAAAN  +G ++  K  E NI     ++SRFD++++++D  D   D ++ +H+  VH    Q                T   P+ +KL ++YIA C+ +    + PEAL   IT  YV MR      E    K+T+   + R L +I+R++ +LA++R+     + D  EA+RL ++S
Sbjct:    5 DYAAEKEKCKRFLQEFYTEDGNGKKVFKYGAQLVALAHREQVGLFVELDDVAEEDPELVESISENAKRYTGLFADAVHELLPEYKERDVVAKDSLDVYIEHRLMMEQRLQDSADTRDSRNQYPPELMRRFELYFKPASTSKSKVVRDIRADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIQS--PSFMPLIMCPSQECVTNKSGGRL--------------YLQTRGSKFVKFQELRIQEHSDQVPVGNIPRSMTVYARGENTRLAQPGDHVAITGVFLPLLRSGYSQAIQGLLSETYLEAHNITLMN----KTEDDELATEELSDEELRSIT-EEGFYEKLAGSIAPEIYGHEDVKKALL-LLLVGGVEQAPKGMKIRGSINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPLTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAANPAYGRYNPRKSIEANIQLPAALLSRFDLLWLIQDKPDADADLRLAQHITYVHQHCRQPP--------------THFTPIDMKLMRRYIALCKKR--QPVVPEALADYITAAYVEMRK-----EARVSKDTTF-TSARTLLSILRLSTALARLRMMDTVEKEDVNEAMRLMEMS 640          
BLAST of MCM5 vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 1538.47 bits (3982), Expect = 0.000e+0
Identity = 742/742 (100.00%), Postives = 742/742 (100.00%), Query Frame = 2
Query:   71 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 2296
            MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK
Sbjct:    1 MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK 742          
BLAST of MCM5 vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 321.627 bits (823), Expect = 7.596e-98
Identity = 226/700 (32.29%), Postives = 362/700 (51.71%), Query Frame = 2
Query:  209 VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTY--PRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVL-PRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQ--DSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEK--------EFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGG---SRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA---LTGNLE------GVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISK 2224
            +Y   +KE    ++ ++ ++  HL+ +D +L + L+  P E +P  + V + +  +N V +  P L       I          ++LR +    + +L+ ++G+V+  S I  +      +C  C     +V+  P   G ++ P  C    +       Q   +C           C+  D Q++KLQE+PE++P GE P    L+  + L +   PG+RVTV GI     Q  +S       V  +Y+ VL+ +           S   + D+EE         E R  S KP ++E ++ +IAP IYGN  IKK +  +LFGG     KK+  G  +R +I++++ GDPGT+KSQLL++V    P   YTSGKGSS  GLTA + +D  T S  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  K   ENI   PT++SRFD+IF++ D  DE+ D ++  H++ ++ G  +             T E G +    L+ YIA+ ++   P L+ EA   +T  YV MR   +  +   G+ ++ P   RQLE+++R+AE+ A+MRL+     AD  EA RL + +   +A   LTG ++      GV G   ++  ++   + KL+++R  +    S Q V+ +   Q   DR+I++
Sbjct:  107 LYIQKMKEMSLLRRAWMNIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEIS---------RNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCN----NVTKVPCERGRIIDPEFCNQCQAKH---TQQIVHNC-----------CEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQK----------SKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNK-------------TTEPGTVDTAMLRDYIAYAKENIHPILSEEAENYVTEEYVEMRKVGNAGK---GQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTL--TFSYQRVLDELRNQS--DRMITR 746          
BLAST of MCM5 vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 297.36 bits (760), Expect = 1.444e-88
Identity = 211/667 (31.63%), Postives = 327/667 (49.03%), Query Frame = 2
Query:  173 FLKSYKSVDFNYVYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVANDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTD-------------------------KEEKEFREFSL-----------------KPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCRDQC-GPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTL 2041
             L+++K  D  + Y +  K+  + +K +L V +K L  +D  L+  +M       P F     ++  +  +   EN +       +   +   +LR ++   + KL+K  G V+ + G+  +    T +C+ C   + ++  +     ++  +  I              Q      + + P++ K  DFQ +++QE    +P G +PR   + +     E A PG++    G S II  D   +   G +    + + +  E   S  +G+  LGV D                          EE E    SL                  P + + +   + P  YGN ++K+ +  +LFGG  K   EG  LRGDIN+ ++GDP TAKSQ LK +   +P AVYTSGK SSAAGLTA+V+RD  +  FV+E GA++LA+ GV CIDEFDKM+  D+VAIHEAMEQQTIS+ KAGI   LN++ SVLAAAN V G +D ++   +NI     IMSRFD+ FV+ D   E+ D +I + +                  +D   ++T I     +++YI F R  C  PR+T EA K++   Y  MR    E +  +G  ++  IT+RQLE++VR++E+ A+MR + F  E D  EA RL   S +
Sbjct:   28 LLENFKVGD-EFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYP-FLCQATQIFINKQFDETENNDRTYTCHFIDFPTLT-NLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQ-----FIFTKPTICG----------NPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTG-SLIIIPDISQLTTPGSRTLETKQIKLS-EGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRITESQR------------PVDPEKSDTRIYNEDDIQRYITFAR--CFEPRVTEEAFKLMVTEYAKMR----ERDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSII 656          
BLAST of MCM5 vs. Planmine SMEST
Match: SMESG000037542.1 (SMESG000037542.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.348e-84
Identity = 198/574 (34.49%), Postives = 291/574 (50.70%), Query Frame = 2
Query:  458 REIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVK-PGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEF---REFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCA-PIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVH------MGDGQAADV----------NENIS--------LDSLTAETGIMPVLK---------LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEY-EKETGKNT--SIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSAL 2053
            R + S  +  ++ I G+V   S +KSK       C   +++L         LN    P     +A   +  VG   ++     Y +   K    DFQ + +QE PEN P G++PR  ++ +D  L +    G+R+ V G     Q   M   K G   +  R + +      +    I+    T  E  +F   R+ + K  + +++ RSIAP I G+  IK+A+ C L GG  + +  G  +RGDIN++MLGDP  AKSQ+L+FV QCA   A+ T+G+G+S  GLTA+V+ D  +    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN V+G +D+ K   ENI    +++SRFD++F++ D  DE  D++I E V  +H        DG+A  +          NE +S         D +  ++    V K         L+KYI   R Q  P+L+ EA  I+   Y  +RS   E    E+G N   + P+T R +E ++R+A + AK R        DA  A  L   +     L
Sbjct:  108 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLN----PNLLAGAAYPTKDEVGNILET----EYGLSTYK----DFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCG-----QYRCMPGKKGGFTTAVFRTILI-----ANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVL 658          
BLAST of MCM5 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 283.108 bits (723), Expect = 8.132e-84
Identity = 180/545 (33.03%), Postives = 290/545 (53.21%), Query Frame = 2
Query:  440 SHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGV-------KHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPV--LKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLS 2044
            S   S+R + S ++  +IK+  VV+ A+ +K      T  C  C     S + +  LN  +LP   + + ++    +G   +       +++    K    Q +++QE  + VP G +PR   +           PG+ V + G+   +    M     G+        H   R+   E ++ G T      +  T+ E ++ ++    P ++ ++ARSIAP I+G+ D+KK +  ++  G       G  +RG +N+ ++GDPG AKSQLL FV++  P + YT+G+GSS AGLTASV+RD  T    +E G++VLADGG+ CIDEFDKM + DR AIHE MEQQTISIAKAGI T LN+R S+LAAAN  +G ++  +  ++NID    ++SRFD++++++D  D   D ++ +H+  VH  +     V    + DS     G++P+   +L++Y+A  R Q  P +    L  +   Y+SMR      E + G   SI  + R L A++RI+ +L++++        D  EAIRL + S  S
Sbjct:  150 SKALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRC----GSETFQEILNKTLLP---LLTCTNEVCKIGTAGR------LHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGET------IPATEAELEKLKD----PEMYSLMARSIAPEIFGHEDVKKGL-LIMMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPPSVLTTAAGDS----AGLLPLSMAELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRK-----ESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKAS 661          
The following BLAST results are available for this feature:
BLAST of MCM5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM50.000e+054.88minichromosome maintenance complex component 5 [So... [more]
MCM50.000e+052.52minichromosome maintenance complex component 5 [So... [more]
MCM44.340e-9936.17minichromosome maintenance complex component 4 [So... [more]
MCM42.982e-9836.17minichromosome maintenance complex component 4 [So... [more]
MCM42.982e-9836.17minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of MCM5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-50.000e+052.82DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-50.000e+052.82DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-41.504e-9933.65DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-41.504e-9933.65DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-23.156e-9832.99DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
back to top
BLAST of MCM5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm50.000e+053.53gene:FBgn0017577 transcript:FBtr0082279[more]
Mcm21.045e-9931.96gene:FBgn0014861 transcript:FBtr0081827[more]
dpa5.298e-9331.84gene:FBgn0015929 transcript:FBtr0345797[more]
dpa5.298e-9331.84gene:FBgn0015929 transcript:FBtr0088982[more]
Mcm36.998e-8537.50gene:FBgn0284442 transcript:FBtr0340476[more]
back to top
BLAST of MCM5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm50.000e+054.95minichromosome maintenance complex component 5 [So... [more]
mcm42.028e-9636.17minichromosome maintenance complex component 4 [So... [more]
mcm28.001e-9631.84minichromosome maintenance complex component 2 [So... [more]
mcm65.564e-8831.56minichromosome maintenance complex component 6 [So... [more]
mcm6l2.644e-8630.00MCM6 minichromosome maintenance deficient 6, like ... [more]
back to top
BLAST of MCM5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccpg10.000e+049.41cell cycle progression 1 [Source:Xenbase;Acc:XB-GE... [more]
ccpg10.000e+047.09cell cycle progression 1 [Source:Xenbase;Acc:XB-GE... [more]
adat32.780e-9631.53adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
adat32.864e-9631.53adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
adat33.026e-9631.53adenosine deaminase, tRNA-specific 3 [Source:Xenba... [more]
back to top
BLAST of MCM5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm50.000e+055.22minichromosome maintenance complex component 5 [So... [more]
Mcm50.000e+055.22minichromosome maintenance complex component 5 [So... [more]
Mcm50.000e+055.22minichromosome maintenance complex component 5 [So... [more]
Mcm41.260e-9836.06minichromosome maintenance complex component 4 [So... [more]
Mcm23.050e-9631.21minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of MCM5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55862|MCM5A_XENLA0.000e+054.95DNA replication licensing factor mcm5-A OS=Xenopus... [more]
sp|Q561P5|MCM5_XENTR0.000e+054.69DNA replication licensing factor mcm5 OS=Xenopus t... [more]
sp|Q0V8B7|MCM5_BOVIN0.000e+054.97DNA replication licensing factor MCM5 OS=Bos tauru... [more]
sp|P49718|MCM5_MOUSE0.000e+055.22DNA replication licensing factor MCM5 OS=Mus muscu... [more]
sp|P33992|MCM5_HUMAN0.000e+054.88DNA replication licensing factor MCM5 OS=Homo sapi... [more]
back to top
BLAST of MCM5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M9NPT00.000e+099.60DNA helicase OS=Schmidtea mediterranea OX=79327 PE... [more]
A0A0R3UM460.000e+058.58DNA helicase OS=Mesocestoides corti OX=53468 GN=MC... [more]
A0A0X3PT130.000e+058.67DNA helicase OS=Schistocephalus solidus OX=70667 G... [more]
A0A0R3S9V40.000e+058.79DNA helicase OS=Hymenolepis diminuta OX=6216 GN=HD... [more]
W6V1910.000e+057.61DNA helicase OS=Echinococcus granulosus OX=6210 GN... [more]
back to top
BLAST of MCM5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm50.000e+054.49minichromosome maintenance complex component 5 [So... [more]
mcm50.000e+051.92minichromosome maintenance complex component 5 [So... [more]
mcm21.337e-9633.43minichromosome maintenance complex component 2 [So... [more]
mcm21.547e-9633.43minichromosome maintenance complex component 2 [So... [more]
mcm22.234e-9633.43minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of MCM5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm50.000e+061.03minichromosome maintenance complex component 5 [So... [more]
ENSPMAT00000008164.12.808e-7434.56pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
ENSPMAT00000006035.11.293e-7229.31pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
mcm81.834e-7130.25minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000006014.16.937e-7129.12pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of MCM5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM50.000e+042.88Component of the Mcm2-7 hexameric helicase complex... [more]
MCM25.877e-10633.85Protein involved in DNA replication; component of ... [more]
MCM48.055e-9534.85Essential helicase component of heterohexameric MC... [more]
MCM35.942e-9131.67Protein involved in DNA replication; component of ... [more]
MCM78.830e-8535.36Component of the Mcm2-7 hexameric helicase complex... [more]
back to top
BLAST of MCM5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO484530.000e+054.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350609.097e-10633.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339711.519e-8430.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344251.969e-8433.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379463.079e-8433.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MCM5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm50.000e+053.30minichromosome maintenance complex component 5 [So... [more]
mcm22.905e-9632.01minichromosome maintenance complex component 2 [So... [more]
mcm41.254e-9434.74minichromosome maintenance complex component 4 [So... [more]
mcm48.666e-9434.76minichromosome maintenance complex component 4 [So... [more]
mcm73.720e-9132.21minichromosome maintenance complex component 7 [So... [more]
back to top
BLAST of MCM5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005389.10.000e+0100.00SMESG000005389.1[more]
SMESG000060238.17.596e-9832.29SMESG000060238.1[more]
SMESG000038798.11.444e-8831.63SMESG000038798.1[more]
SMESG000037542.11.348e-8434.49SMESG000037542.1[more]
SMESG000057772.18.132e-8433.03SMESG000057772.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30032563
GenBankAFL48194.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30032563 ID=SMED30032563|Name=MCM5|organism=Schmidtea mediterranea sexual|type=transcript|length=2408bp
CAATAAAGTTCTAATCTTAGTTTTTTCCAACATTTATATTTCTAAAAGTT
TCCGAAATTAAATCTAACAAATGGCTGGTTTTGATGAAGGTGCAGTATAT
CTTTCTACTGGCAGAGATACGCAATCAGAATTAAATTCTGAATTCGCAAT
CGCACATTCTAAATTGAAAGAATTTTTGAAATCATATAAATCGGTAGATT
TCAATTATGTTTATCGTGATATATTAAAAGAAAATTGTAATACTAAAAAA
TATTATCTGCCAGTTGAATGGAAACATCTTAGTTTTTTTGATCCAAACCT
AGCAGATAAGCTAATGGAAAAGCCTAATGAATTTTTACCTATTTTTGAAT
CTGTTGTTAATGAGGTTGCAAATGATGTTACTTATCCAAGATTAGAAAAT
GAAAATTTGCCTAGTATACAAATAATGTTAAAATTGGATTCTCATCCGAA
AAGTTTAAGAGAAATTAAGTCTAATCAAATATCGAAGTTAATCAAAATTA
GCGGCGTAGTTGTATCAGCATCGGGTATTAAATCGAAAGCTGCTACACTT
ACATTACGGTGCAAGGGATGTCAGCAATATCTTCCGTCGGTATCAGTTAA
ACCGGGTTTAAATGGATATGTTCTACCTAGAAAATGCATTGCTTCTGCCA
GCAGTGCCAGATTTGGAGTGGGGCAGACTGCTCAATCATGTCCAGTTGAT
CCTTATTATATCGAGCCAGATAAATGTAAATGTAATGATTTCCAAATATT
AAAATTACAAGAAGCACCCGAGAATGTACCTCATGGTGAAATGCCGAGAC
ATTCTCAACTGTTTGTTGATAGATATTTATGCGAAAAGGCTGTACCGGGT
AATCGTGTTACCGTTGTTGGAATTTCATCGATTATACAACAAGATTCAAT
GAATATGCCTAAAGATGGAGTTAAACATTCTTATATCAGAGTTTTGAATG
TGGAAATTGAAAACACTGGATCGACAAGAAGTGGAATAAGTTCTCTCGGA
GTTACTGATAAGGAGGAGAAAGAATTTCGGGAATTTTCATTGAAACCGGG
AGTTCATGAAATAATTGCTCGTAGCATTGCTCCCGGGATTTATGGGAACC
CAGATATCAAAAAAGCAATTGCTTGTTTATTGTTCGGTGGATCGAGGAAA
AAAATGCCGGAAGGAGTGTTTTTGAGGGGAGATATTAATATGATGATGCT
CGGTGATCCGGGAACAGCAAAATCCCAGCTGTTGAAATTCGTTGAACAAT
GTGCACCGATTGCAGTTTATACGTCAGGCAAAGGCAGCTCGGCCGCAGGT
CTTACTGCATCAGTAATTAGGGATTCCGCAACGCGCAGTTTTGTCATGGA
AGGAGGAGCAATGGTGCTGGCTGATGGAGGAGTTGTGTGTATTGATGAGT
TTGATAAAATGAAAGAAGACGATCGAGTGGCTATTCACGAAGCCATGGAA
CAACAGACAATATCAATTGCTAAGGCGGGCATTACGACTATGTTGAACAG
TCGGTGCTCGGTATTGGCCGCTGCAAACAGCGTTTTTGGTCATTGGGACG
AGACAAAGGGCGACGAAAATATCGATTTCATGCCGACAATTATGTCGCGA
TTTGATATGATATTTGTAGTGAAAGATGTGTATGATGAGAAAAGGGATAA
ACAGATCGTTGAGCATGTCATGTCTGTTCATATGGGAGATGGCCAAGCTG
CCGATGTCAATGAAAATATTAGCTTGGATAGTTTGACTGCTGAAACTGGA
ATAATGCCAGTGCTTAAACTGAAGAAATATATTGCTTTCTGTCGTGATCA
ATGCGGTCCGCGTTTGACCCCAGAAGCCTTGAAAATAATAACCAATCATT
ATGTTTCAATGAGATCTGGAGCTTCCGAGTATGAAAAAGAAACAGGAAAA
AATACATCAATTCCAATAACAATTCGGCAACTTGAGGCCATTGTCCGAAT
CGCTGAATCGCTGGCTAAGATGCGTTTGGCTCCGTTCGGTGTCGAAGCCG
ATGCCCGTGAAGCCATCCGCTTGTTTCAAGTCTCAACTCTCAGTTCTGCT
CTGACTGGCAATCTGGAAGGCGTTGAAGGCTTCACCGATCGCCAAGAGCA
CGATGTAATTGTTAAAGTGGAAAAATTAATGAAGAAAAGATTTGTTATTG
GAAGTCAGGTTTCCGAACAAACTGTTATTCAAGATTTTGTGAAACAAGGA
TTTCCCGATCGAATTATAAGTAAAGTTCTCCACTTTATGATCCGACGAGG
TGAAATTCAACCAAAGCATCAAAGACGAGTTTTAATGAGAGTAAAATAGA
GAGTTATTAATATTTCAGTAGTAATAGATCTGTTAAATTGAATCAGAACT
TTGCATTTATTCATAAGTGTTATTAATAAAATGTAGCTTTTCGGTATTTG
TAATCGGG
back to top

protein sequence of SMED30032563-orf-1

>SMED30032563-orf-1 ID=SMED30032563-orf-1|Name=SMED30032563-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=743bp
MAGFDEGAVYLSTGRDTQSELNSEFAIAHSKLKEFLKSYKSVDFNYVYRD
ILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEVA
NDVTYPRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSA
SGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVLPRKCIASASSARFGV
GQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVD
RYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTG
STRSGISSLGVTDKEEKEFREFSLKPGVHEIIARSIAPGIYGNPDIKKAI
ACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVY
TSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKED
DRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGDEN
IDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENI
SLDSLTAETGIMPVLKLKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSG
ASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIR
LFQVSTLSSALTGNLEGVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQ
TVIQDFVKQGFPDRIISKVLHFMIRRGEIQPKHQRRVLMRVK*
back to top
Aliases
The feature 'MCM5' has the following synonyms
Synonym
mcm-5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR041562MCM_lid
IPR033762MCM_OB
IPR001208MCM_dom
IPR008048MCM5
IPR031327MCM
IPR012340NA-bd_OB-fold
IPR027417P-loop_NTPase
IPR027925MCM_N
IPR018525MCM_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0003682chromatin binding
GO:0003678DNA helicase activity
GO:0003688DNA replication origin binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006270DNA replication initiation
GO:0032508DNA duplex unwinding
Vocabulary: cellular component
TermDefinition
GO:0042555MCM complex
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008048DNA replication licensing factor Mcm5PRINTSPR01661MCMPROTEIN5coord: 285..297
score: 36.36
coord: 130..145
score: 50.57
coord: 156..168
score: 34.27
coord: 650..667
score: 63.13
coord: 574..589
score: 52.27
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 481..493
score: 56.41
coord: 369..384
score: 66.8
coord: 457..470
score: 85.02
coord: 507..515
score: 63.32
coord: 429..443
score: 77.92
IPR001208MCM domainPFAMPF00493MCMcoord: 316..537
e-value: 3.8E-97
score: 323.8
IPR001208MCM domainPROSITEPS50051MCM_2coord: 328..533
score: 90.16
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 125..657
e-value: 1.0E-243
score: 825.6
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 29..734
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 566..655
e-value: 1.5E-25
score: 89.4
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 159..218
e-value: 3.1E-32
score: 113.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 312..661
e-value: 1.0E-126
score: 424.7
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 25..121
e-value: 7.2E-18
score: 66.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 129..278
e-value: 3.1E-32
score: 113.2
NoneNo IPR availablePANTHERPTHR11630:SF42DNA REPLICATION LICENSING FACTOR MCM5coord: 29..734
NoneNo IPR availableCDDcd17756MCM5coord: 331..655
e-value: 0.0
score: 587.427
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 31..118
e-value: 6.8E-17
score: 62.0
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 129..272
e-value: 5.4E-35
score: 120.0
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 437..445
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 338..658
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 32..286